HHsearch alignment for GI: 254780716 and conserved domain: PRK09880

>PRK09880 L-idonate 5-dehydrogenase; Provisional.
Probab=93.19  E-value=0.75  Score=25.81  Aligned_cols=33  Identities=15%  Similarity=0.209  Sum_probs=10.9

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHH
Q ss_conf             5698157111688999997898-59997399899
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFEL   38 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~   38 (475)
T Consensus       173 VlV~G~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~r  206 (343)
T PRK09880        173 VFISGVGPIGCLIVSAVKTLGAAEIVCADLSPRS  206 (343)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHH
T ss_conf             9998477679999999998699879999797899