HHsearch alignment for GI: 254780716 and conserved domain: PRK11199

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional.
Probab=98.42  E-value=0.00012  Score=53.69  Aligned_cols=176  Identities=15%  Similarity=0.202  Sum_probs=115.5

Q ss_pred             EEEEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             05698-15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
T Consensus       100 ~i~IIGG~G~mG~~F~~~f~~sGy~V~ild~~d-------------------w~~~~~~~---~~advViVsVPI-~~T~  156 (374)
T PRK11199        100 PVVIVGGKGQLGRLFAKMLTLSGYQVRILEKDD-------------------WDRADDIL---ADAGMVIVSVPI-HLTE  156 (374)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCC-------------------CCCHHHHH---HCCCEEEEEECH-HHHH
T ss_conf             179980798277999999996798799616444-------------------53489887---179989998145-8899


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCCCCCCCCE-EE-EECCHHHHHHHHHHHHH
Q ss_conf             99999972078998999679865789999999998479943067-54676000356843-78-84548999888999998
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVKGARSGAS-LM-VGGNEKAYNRVENILLS  160 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~gA~~G~s-lM-vGG~~~~~~~~~piL~~  160 (475)
T Consensus       157 ~VI~~l-~~l~~~~lL~DiTSvK~~Pl---~aMl~~h~gpV~GlHPMFGP~v~sl~~QvVV~c~gr~~e~~~wl~~~~~~  232 (374)
T PRK11199        157 EVIEKL-PPLPEDCILVDLTSVKNGPL---QAMLAAHSGPVLGLHPMFGPDVGSLAKQVVVVCDGRQPEAYQWLLEQIQI  232 (374)
T ss_pred             HHHHHC-CCCCCCCEEEECHHCCHHHH---HHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             999857-78999868986100427899---99998568985022778799964447876998899983778999999998


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             7501567861898569874678988776787888999899999999642899789999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISH  218 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~  218 (475)
T Consensus       233 ~Ga~------l~~~~~~eHD~~Ma~V-QgL~HF~--~~~~g~~L~~--~~~dl~~ll~  279 (374)
T PRK11199        233 WGAR------LHRISAVEHDQAMAFI-QALRHFS--TFAYGLHLAK--ENVDLEQLLA  279 (374)
T ss_pred             HCCE------EEECCHHHHHHHHHHH-HHHHHHH--HHHHHHHHHH--CCCCHHHHHH
T ss_conf             4878------9986888888997999-9999999--9999999986--4999899987