HHsearch alignment for GI: 254780716 and conserved domain: PRK11880

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed.
Probab=99.20  E-value=8.8e-08  Score=76.92  Aligned_cols=243  Identities=15%  Similarity=0.179  Sum_probs=138.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC---CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             99880569815711168899999789---859997399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG---FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G---~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
T Consensus         1 mm~-kI~~IG~G~Mg~Aii~gl~~~~~~~~~i~v~~r~~~~~~~l~~~~-----~v~~~~~~~~~~~~~---diIiLaVK   71 (267)
T PRK11880          1 MMK-KIGFIGGGNMASAIIGGLLASGVPAKDIIVSDPSPEKRAALAEEY-----GVRAATDNQEAAQEA---DVVVLAVK   71 (267)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHH-----CCEEECCHHHHHHCC---CEEEEEEC
T ss_conf             998-799986689999999999977989452899779999999999973-----967857869887219---99999728


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCCEE-CCCCCCCCCCCCCCCEEEEEC---CHHHHH
Q ss_conf             9069999999997207899899967-98657899999999984799430-675467600035684378845---489998
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIYFI-GIGVSGGVKGARSGASLMVGG---NEKAYN  152 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~fi-d~pVSGG~~gA~~G~slMvGG---~~~~~~  152 (475)
T Consensus        72 P-~~~~~vl~~l~~~~~--~~iISv~AGi~i~~---l~~~l~-~~~~ivR~MPN--~~~~v~~G~t~i~~~~~~~~~~~~  142 (267)
T PRK11880         72 P-QVMEDVLSELKGSLD--KLVVSIAAGITLAR---LERALG-ADLPVVRAMPN--TPALVGAGMTALCANALVSEEQRA  142 (267)
T ss_pred             H-HHHHHHHHHHHHHHC--CEEEEECCCCCHHH---HHHHHC-CCCHHHHCCCC--HHHHHCCCCEEEECCCCCCHHHHH
T ss_conf             7-899999999876508--78999169999999---998863-68703420874--899970786466259999999999


Q ss_pred             HHHHHHHHHHCCC--CCCCEE-EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             8899999875015--678618-9856987467898877678788899989999999964289978999999860688443
Q gi|254780716|r  153 RVENILLSISAKY--QNSPCC-ALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS  229 (475)
Q Consensus       153 ~~~piL~~iaak~--~~~~cv-~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~  229 (475)
T Consensus       143 ~v~~lf~~~G~~~~v~~E~~~d~~TalsGsGP-------Ay~~~~~eal~~a~--v~--~Gl~~~~A~~l~---------  202 (267)
T PRK11880        143 FALELLSAVGEVVWVDDESQMDAVTAVSGSGP-------AYVFLFIEALADAG--VK--LGLPRETARKLA---------  202 (267)
T ss_pred             HHHHHHHHCCCEEEECCHHCCCHHHHHHCCCH-------HHHHHHHHHHHHHH--HH--CCCCHHHHHHHH---------
T ss_conf             99999972586799884210221134517717-------99999999999999--98--699799999999---------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             079999999997405679995200102333658716778988775178885146777
Q gi|254780716|r  230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAI  286 (475)
Q Consensus       230 syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av  286 (475)
T Consensus       203 ~qt~~G~a~ll~~~----~~~-p~~L~~~V~SpgGtT~~gl~~Le~~g~~~~i~~Ai  254 (267)
T PRK11880        203 AQTVLGAAKLLLES----GEH-PAELRDNVTSPGGTTIAALRVLEEGGFRAAVIEAV  254 (267)
T ss_pred             HHHHHHHHHHHHHC----CCC-HHHHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             99999999999872----999-99999836799653999999999888499999999