HHsearch alignment for GI: 254780716 and conserved domain: PRK12480

>PRK12480 D-lactate dehydrogenase; Provisional.
Probab=98.51  E-value=1.5e-06  Score=67.90  Aligned_cols=115  Identities=13%  Similarity=0.159  Sum_probs=92.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
T Consensus       146 gktvGIiG~G~IG~~va~~~~~fg~~Vi~yD~~~~~~~----------~~~~~~~sleell~~s---DiIslh~Plt~~T  212 (330)
T PRK12480        146 NMTVAIIGTGRIGAATAKIYAGFGATITAYDAYPNKDL----------DFLTYKDSVKEAIKDA---DIISLHVPANKES  212 (330)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCC----------CCCEECCCHHHHHHHC---CEEEECCCCCHHH
T ss_conf             86899967588999999998756998999899864221----------2132327899998759---9999737685331


Q ss_pred             HHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC
Q ss_conf             99999-9972078998999679865789999999998479943067546
Q gi|254780716|r   83 DQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS  130 (475)
Q Consensus        83 ~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS  130 (475)
T Consensus       213 ~~lIn~~~l~~MK~~ailINtaRG~iVde~aL~~AL~~g~I~gAgLDV~  261 (330)
T PRK12480        213 YHLFDKAMFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTY  261 (330)
T ss_pred             HCCHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHCCCEEEEEEECC
T ss_conf             2004899997579997699727863319999999997598458998558