HHsearch alignment for GI: 254780716 and conserved domain: PRK12809

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed.
Probab=91.65  E-value=0.26  Score=29.27  Aligned_cols=33  Identities=18%  Similarity=0.417  Sum_probs=30.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
T Consensus       311 kKVAVIGsGPAGLaaA~~Lar~G~~VTVfE~~~  343 (639)
T PRK12809        311 EKVAVIGAGPAGLGCADILARAGVQVDVFDRHP  343 (639)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             989998975899999999997599069993688