HHsearch alignment for GI: 254780716 and conserved domain: PRK12814

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional.
Probab=90.94  E-value=0.4  Score=27.85  Aligned_cols=33  Identities=24%  Similarity=0.541  Sum_probs=30.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
T Consensus       194 KkVAIIGaGPAGLsaAy~L~~~Gh~VTVfE~~~  226 (652)
T PRK12814        194 KKVAIIGAGPAGLTAAYYLLRKGHDVTIFDANE  226 (652)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             979996837899999999997799069981588