HHsearch alignment for GI: 254780716 and conserved domain: PRK12824

>PRK12824 acetoacetyl-CoA reductase; Provisional.
Probab=95.14  E-value=0.31  Score=28.61  Aligned_cols=85  Identities=19%  Similarity=0.298  Sum_probs=55.2

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--1571116889999978985999739989999-9997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTD-VFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~-~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
T Consensus         1 M~K--valITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~~~D~~   62 (245)
T PRK12824          1 MKK--IALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTED----------------QVRLKSLDVT   62 (245)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCC----------------CEEEEECCCC
T ss_conf             985--9999478888999999999987998999958807789999998740499----------------3899991389


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        63 d~~~~~~~v~~~~~~~g~iDiLVnnA   88 (245)
T PRK12824         63 DTEECQEALARIEEEEGPVDILVNNA   88 (245)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999749998999898