>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin . The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA. The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III. Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) . This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.

Probab=97.77 E-value=0.00019 Score=52.36 Aligned_cols=179 Identities=13% Similarity=0.211 Sum_probs=101.8 Q ss_pred CCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCCEECC--CHHHHHHHCCCCCEEEEECCCH Q ss_conf 880569815711168899999789-8599973998999999971221127840328--9899986057788999976990 Q gi|254780716|r 3 QADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKVIVTK--NLEQMVEAVCKPRKILMMVTDG 79 (475) Q Consensus 3 k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~--s~~e~v~~l~~pr~Iil~vp~g 79 (475) T Consensus 185 ~~~~LliGAGeMg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P--~~~~f~~La~~~L~~~L~~~DivissTgA~ 262 (436) T TIGR01035 185 GKKVLLIGAGEMGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGP--EAVKFEALALEKLEEALAEADIVISSTGAP 262 (436) T ss_pred CCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCC--CCCCCCHHHHHHHHHHHHHCCEEEEECCCC T ss_conf 641899827457999999996489528988556778999999870786--645444554899999974288999855765 Q ss_pred HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH-HHHHCCCCEECCCCCCCCCCCCCCC-E-EEEECCHHHHHHHHH Q ss_conf 699999999972078998999679865789999999-9984799430675467600035684-3-788454899988899 Q gi|254780716|r 80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL-QLSEKGIYFIGIGVSGGVKGARSGA-S-LMVGGNEKAYNRVEN 156 (475) Q Consensus 80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~-~l~~kgi~fid~pVSGG~~gA~~G~-s-lMvGG~~~~~~~~~p 156 (475) T Consensus 263 ~pi~----------~-------~--~~~e~a~~~Rr~de~~~pl~~~DIAvPRdvd~~v~~L~~vfLy-----~vDDL~~ 318 (436) T TIGR01035 263 EPIV----------S-------K--EDVERALKERRRDEAARPLFIVDIAVPRDVDPEVAKLEGVFLY-----DVDDLKE 318 (436) T ss_pred CCCC----------C-------C--HHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHCCCCEEEE-----EECCHHH T ss_conf 3100----------2-------0--3489999972220015886999758899863786222966997-----3031389 Q ss_pred HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHH Q ss_conf 99987501567861898569874678988776787888999899999999642899789999998606884430799999 Q gi|254780716|r 157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236 (475) Q Consensus 157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~ 236 (475) T Consensus 319 ~~~~N~a~------------------------R~-----~~~~~ae~I~~-------~E~~~f~~w~~~l~~~p~I~~Lr 362 (436) T TIGR01035 319 VVEENLAE------------------------RR-----EEAEKAELIVE-------EEVAEFKQWLRSLEVEPTIKELR 362 (436) T ss_pred HHHHHHHH------------------------HH-----HHHHHHHHHHH-------HHHHHHHHHHHHCCCCHHHHHHH T ss_conf 99999999------------------------99-----99999999999-------99999999998658317889999 Q ss_pred HHHHHHC Q ss_conf 9999740 Q gi|254780716|r 237 AEILSSS 243 (475) Q Consensus 237 ~~il~~k 243 (475) T Consensus 363 ~~ae~~~ 369 (436) T TIGR01035 363 SKAEEVR 369 (436) T ss_pred HHHHHHH T ss_conf 9999999

HHsearch alignment for GI: 254780716 and conserved domain: TIGR01035