HHsearch alignment for GI: 254780716 and conserved domain: TIGR01327

>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236 This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis. Shorter forms not in this group include SerA from Escherichia coli. ; GO: 0004617 phosphoglycerate dehydrogenase activity, 0006564 L-serine biosynthetic process.
Probab=96.50  E-value=0.026  Score=36.61  Aligned_cols=111  Identities=18%  Similarity=0.257  Sum_probs=85.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH--HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978985999739989--99999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE--LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~--~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
T Consensus       140 ~~~g~~g~g~~g~~~~~~~~~~~~~~~~~dp~~~~~~~~~~---------g~~~~~~~~~~~~~---~d~~~~h~p~~~~  207 (535)
T TIGR01327       140 KTLGVIGLGRIGSEVAKRAKAFGMKVLAYDPYLPPERAEKL---------GVELLADLDELLAR---ADFITLHTPLTPE  207 (535)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCEEEEECCCCCHHHHHHH---------CHHHHHHHHHHHHH---CCEEEEECCCCCH
T ss_conf             20001112301146766544312046752565663346550---------21333207888632---4535763366602


Q ss_pred             HHHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             999999-997207899899967986578999999999847994306
Q gi|254780716|r   82 VDQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        82 v~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
T Consensus       208 ~~~~~~~~~~~~~~~~~~~~~~~~gg~~~~~~l~~~~~~g~~~~~~  253 (535)
T TIGR01327       208 TKGLIGAEELAKLKPGVIIVNCARGGLIDEAALYEALEEGHVGGAA  253 (535)
T ss_pred             HHHHCCHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCCHHHHE
T ss_conf             3321032566640476069850346632068899876313100100