HHsearch alignment for GI: 254780716 and conserved domain: TIGR01763

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent; InterPro: IPR011275 This entry contains bacterial and archaeal malate dehydrogenases, which convert malate into oxaloacetate in the citric acid cycle. The critical residues which discriminate malate dehydrogenase from lactate dehydrogenase have been characterised , and have been used to determine members of this group. ; GO: 0030060 L-malate dehydrogenase activity, 0006108 malate metabolic process.
Probab=92.66  E-value=0.88  Score=25.30  Aligned_cols=102  Identities=18%  Similarity=0.250  Sum_probs=70.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC--CEEEEEEC------CHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEE
Q ss_conf             0569815711168899999789--85999739------9899999997122--112784032898999860577889999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG--FRLAVYNK------DFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILM   74 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G--~~V~vydr------~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil   74 (475)
T Consensus         3 KisvIGAGfvGaTTAf~lA~KeLard~VLlDiPqvEg~pqGKALDmyEasPv~gFD~kvTGtnnYaDTAnS----DivVi   78 (308)
T TIGR01763         3 KISVIGAGFVGATTAFLLAEKELARDVVLLDIPQVEGVPQGKALDMYEASPVEGFDVKVTGTNNYADTANS----DIVVI   78 (308)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCHHHHHHCCCCCCCCCEEECCCCCHHHCCC----CEEEE
T ss_conf             58997068612589999986740671689850555868886332211027766311236257870021188----37998


Q ss_pred             E---------------CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             7---------------69906999999999720789989996798657899999
Q gi|254780716|r   75 M---------------VTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR  113 (475)
Q Consensus        75 ~---------------vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~  113 (475)
T Consensus        79 TaG~pRKPGMsReDL~s~Na~I~R~v~~~i~~~-Spn~iIvvv~N--PlDaMTy  129 (308)
T TIGR01763        79 TAGLPRKPGMSREDLVSVNADIVREVTSRIVEY-SPNAIIVVVSN--PLDAMTY  129 (308)
T ss_pred             CCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHC-CCCCEEEEECC--CHHHHHH
T ss_conf             167887547887899861334689999999731-89968999718--0578999