HHsearch alignment for GI: 254780716 and conserved domain: TIGR01830

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis . Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=96.22  E-value=0.037  Score=35.47  Aligned_cols=173  Identities=18%  Similarity=0.322  Sum_probs=100.5

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             116889999978985999739989-9999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFE-LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~-~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
T Consensus        10 IG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~----------------~~~~dvs~~~~~~~~~~~~~~~   73 (238)
T TIGR01830        10 IGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAA----------------GVVLDVSDREDVKALVEEAEEE   73 (238)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEE----------------EEEECCCCHHHHHHHHHHHHHH
T ss_conf             679999999867995999659825788899999985697599----------------9960388889999999999998


Q ss_pred             CCCCCEEEEC------------CCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             7899899967------------9865789999999998479943067546760003568437884548999888999998
Q gi|254780716|r   93 LSPEDILLDG------------GNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        93 l~~g~iiID~------------sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
T Consensus        74 ~G-iDiLVNNAGITrD~Ll~RMk~edWd~Vi~~NL--------------------------------~g~F~~t~~v~~~  120 (238)
T TIGR01830        74 LG-IDILVNNAGITRDNLLMRMKEEDWDAVINVNL--------------------------------KGVFNLTQAVLRP  120 (238)
T ss_pred             HC-CEEEEECCCCCCCCHHCCCCHHHHHHHHHHHH--------------------------------HHHHHHHHHHHHH
T ss_conf             29-90899787413430100488556899998612--------------------------------6687888998898


Q ss_pred             HHCCCCCC-----CEEEEECCCCHHHHHH----HH----------------HH-----HHHHHHHHHHHHHH--H-----
Q ss_conf             75015678-----6189856987467898----87----------------76-----78788899989999--9-----
Q gi|254780716|r  161 ISAKYQNS-----PCCALLGPDGSGHFVK----MI----------------HN-----GIEYANMQLIADIY--G-----  203 (475)
Q Consensus       161 iaak~~~~-----~cv~y~G~~GsGh~vK----MV----------------hN-----gIey~~mq~iaE~~--~-----  203 (475)
T Consensus       121 M~K~R~GrIINisSVVG~~GN~GQaNYaASKAG~IGftKSlAkElasRnItVNaVAPGFI~TdMT~~L~e~~~~~~l~~I  200 (238)
T TIGR01830       121 MIKQRSGRIINISSVVGLMGNAGQANYAASKAGVIGFTKSLAKELASRNITVNAVAPGFIETDMTDKLSEKVKKAMLSQI  200 (238)
T ss_pred             HHHHCCCCEEEEEEHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHCCHHHHHHHHHCC
T ss_conf             87506743486100200006874267888875589999999986036870588874899897000216988999998527


Q ss_pred             HHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99964289978999999860688443079999999997
Q gi|254780716|r  204 ILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS  241 (475)
Q Consensus       204 ~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~  241 (475)
T Consensus       201 PLgR~-G-~pEeVA~~v~FL-ASd~AsY---ITGqv~~  232 (238)
T TIGR01830       201 PLGRF-G-TPEEVANAVAFL-ASDEASY---ITGQVIH  232 (238)
T ss_pred             CCCCC-C-CHHHHHHHHHHH-CCCCCCC---CCCCEEE
T ss_conf             72326-7-765699999973-2512474---2551663