HHsearch alignment for GI: 254780716 and conserved domain: TIGR01850

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR000706 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms. In prokaryotes, lower eukaryotes and plants it is the first intermediate in the biosynthesis of arginine, whereas in ureotelic (excreting nitrogen mostly in the form of urea) vertebrates, it is an essential allosteric cofactor for carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle. The pathway that leads from glutamate to arginine in lower organisms employs eight steps, starting with the acetylation of glutamate to form NAG. In these species, NAG can be produced by two enzymatic reactions: one catalysed by NAG synthase (NAGS) and the other by ornithine acetyltransferase (OAT). In ureotelic species, NAG is produced exclusively by NAGS. In lower organisms, NAGS is feedback-inhibited by L-arginine, whereas mammalian NAGS activity is significantly enhanced by this amino acid. The NAGS genes of bacteria, fungi and mammals are more diverse than other arginine-biosynthesis and urea-cycle genes. The evolutionary relationship between the distinctly different roles of NAG and its metabolism in lower and higher organisms remains to be determined . The pathway from glutamate to arginine is: NAGS; N-acetylglutamate synthase (2.3.1.1 from EC) (glutamate to N-acetylglutamate) NAGK; N-acetylglutamate kinase (2.7.2.8 from EC) (N-acetylglutamate to N-acetylglutamate-5P) NAGSA; N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (N-acetylglutamate-5P to N-acetylglumate semialdehyde) Acetylornithine aminotransferase (2.6.1.11 from EC) (N-acetylglumate semialdehyde to N-acetylornithine) Acetylornithine deacetylase (3.5.1.16 from EC) (N-acetylornithine to ornithine) Arginase (3.5.3.1 from EC) (ornithine to arginine) N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (AGPR) , is the enzyme that catalyzes the third step in the biosynthesis of arginine from glutamate, the NADP-dependent reduction of N-acetyl-5-glutamyl phosphate into N-acetylglutamate 5-semialdehyde. In bacteria it is a monofunctional protein of 35 to 38 kD (gene argC), while in fungi it is part of a bifunctional mitochondrial enzyme (gene ARG5,6, arg11 or arg-6) which contains a N-terminal acetylglutamate kinase (2.7.2.8 from EC) domain and a C-terminal AGPR domain. In the Escherichia coli enzyme, a cysteine has been shown to be implicated in the catalytic activity, and the region around this residue is well conserved.; GO: 0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity, 0006526 arginine biosynthetic process.
Probab=92.73  E-value=0.5  Score=27.15  Aligned_cols=211  Identities=14%  Similarity=0.078  Sum_probs=128.6

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHC-CCEEE-EEECCHH-HHHHHHHHCCCCCCCCE--ECCCHHH--HHHHC-CCCCEEEEE
Q ss_conf             0569815-71116889999978-98599-9739989-99999971221127840--3289899--98605-778899997
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDK-GFRLA-VYNKDFE-LTDVFIKKISGLSQKVI--VTKNLEQ--MVEAV-CKPRKILMM   75 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~-G~~V~-vydr~~~-~~~~l~~~~~~~~~~~~--~~~s~~e--~v~~l-~~pr~Iil~   75 (475)
T Consensus         2 ~V~IvGAsGYtG~EL~RLL~~HP~~e~~~~~ss~~~~aG~~~~~~~P~L~g~~~~~~~~~~~~~~~~~~~L~~~DvVFlA   81 (361)
T TIGR01850         2 KVGIVGASGYTGGELLRLLANHPEVEITYLVSSRESLAGKPLSEVHPHLRGLVDYLNLEPLDDAKLEEIELEDADVVFLA   81 (361)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCEEEEEEEEEEEHHCCCCHHHHCCCHHHHHCCCCCCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             68999334446899999984199537888887620113852577366111010023336667667888621376789986


Q ss_pred             CCCHHHHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHHHHC--CCCEECCCCCCCCCCC-----CCCC-EE-EEE
Q ss_conf             699069999999997-207899899967986578999999999847--9943067546760003-----5684-37-884
Q gi|254780716|r   76 VTDGDPVDQLIDKLK-PLLSPEDILLDGGNSHFCDTQIRSLQLSEK--GIYFIGIGVSGGVKGA-----RSGA-SL-MVG  145 (475)
Q Consensus        76 vp~g~~v~~vi~~l~-~~l~~g~iiID~sts~~~~t~~~~~~l~~k--gi~fid~pVSGG~~gA-----~~G~-sl-MvG  145 (475)
T Consensus        82 lPhgvs-----~~~~p~~l~~g~~ViDLSADFRl~d~~~Ye~wYG~h~~~~ll~~avYGLpEl~~~re~i~~A~liAnPG  156 (361)
T TIGR01850        82 LPHGVS-----MELAPELLEAGVKVIDLSADFRLKDPEVYEKWYGFHAAPELLQEAVYGLPELHGAREEIKGARLIANPG  156 (361)
T ss_pred             CCHHHH-----HHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHCCCEEECCC
T ss_conf             872556-----999999984798699888343369979999966778896666311556767010588984295764488


Q ss_pred             CCHH-HHHHHHHHHHHHHCCCCCC-CEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHH
Q ss_conf             5489-9988899999875015678-6189856987467898877678788899989999999964-28997899999986
Q gi|254780716|r  146 GNEK-AYNRVENILLSISAKYQNS-PCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSK  222 (475)
Q Consensus       146 G~~~-~~~~~~piL~~iaak~~~~-~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~  222 (475)
T Consensus       157 CYpTA~~LaL~PL~~~~l~~~~~~~i~dakSGvSGAGr~as~~~~~~E------~~en~~pY~~~G~HRH~PEI~q~L~~  230 (361)
T TIGR01850       157 CYPTATLLALAPLLKEGLIDPTSEIIVDAKSGVSGAGRKASEKSHFPE------VNENLRPYKVTGGHRHTPEIEQELGK  230 (361)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCHHH------HHCCCEECCCCCCCCCHHHHHHHHHH
T ss_conf             617899999899998315676776589887445566777763357344------32770620379985027999998767


Q ss_pred             CCCC
Q ss_conf             0688
Q gi|254780716|r  223 WDTG  226 (475)
Q Consensus       223 w~~~  226 (475)
T Consensus       231 ~~~~  234 (361)
T TIGR01850       231 LAGG  234 (361)
T ss_pred             HHCC
T ss_conf             6304