HHsearch alignment for GI: 254780716 and conserved domain: TIGR02352

>TIGR02352 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as Escherichia coli that instead use tyrosine and the ThiH protein .; GO: 0016491 oxidoreductase activity, 0050660 FAD binding.
Probab=93.21  E-value=0.14  Score=31.25  Aligned_cols=36  Identities=17%  Similarity=0.444  Sum_probs=31.5

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
Q ss_conf             569815711168899999789859997399899999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDV   41 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~   41 (475)
T Consensus         1 ~~ViGGGvIGL~~A~~L~~~G~~V~l~~~~~~~g~~   36 (357)
T TIGR02352         1 VLVIGGGVIGLSVAVELAERGHSVTLLDRDPTVGGG   36 (357)
T ss_pred             CEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHH
T ss_conf             978453187899999999749938999658604567