HHsearch alignment for GI: 254780716 and conserved domain: TIGR03026

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=99.57  E-value=5.9e-12  Score=107.65  Aligned_cols=208  Identities=17%  Similarity=0.181  Sum_probs=151.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--------------CCCCCEECCCHHHHHHHCCCCC
Q ss_conf             05698157111688999997898599973998999999971221--------------1278403289899986057788
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG--------------LSQKVIVTKNLEQMVEAVCKPR   70 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~--------------~~~~~~~~~s~~e~v~~l~~pr   70 (475)
T Consensus         2 kI~ViGlGyVGl~~a~~lA~~G~~V~g~D~d~~~i~~l~~g~~p~~E~gl~~ll~~~~~~~~l~~ttd~~~~i---~~~d   78 (411)
T TIGR03026         2 KIAVIGLGYVGLPLAALLADLGHEVTGVDIDQEKVDKLNKGKSPIYEPGLDELLAKALAAGRLRATTDYEDAI---RDAD   78 (411)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCEEEECCHHHHH---HHCC
T ss_conf             7999897877999999999489948999899999999977989978989899999998639979987889987---2099


Q ss_pred             EEEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC--------CCCEECCCCC---
Q ss_conf             999976990---------69999999997207899899967986578999999999847--------9943067546---
Q gi|254780716|r   71 KILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK--------GIYFIGIGVS---  130 (475)
Q Consensus        71 ~Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k--------gi~fid~pVS---  130 (475)
T Consensus        79 ii~I~V~TP~~~~g~~d~s~l~~a~~~i~~~l~~~~lvii~STV~pGTt~~i~~~ile~~~~~~~g~df~v~~~PEfl~e  158 (411)
T TIGR03026        79 VIIICVPTPLKEDGSPDLSYVESAAETIAKHLRKGATVVLESTVPPGTTEEVVKPILERASGLKLGEDFYLAYNPEFLRE  158 (411)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC
T ss_conf             99997689866688721389999999999766899989995786868104899998877404666885479968354687


Q ss_pred             CCC-CCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             760-0035684378845489998889999987501567861898569874678988776787888999899999999642
Q gi|254780716|r  131 GGV-KGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSL  209 (475)
Q Consensus       131 GG~-~gA~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~  209 (475)
T Consensus       159 G~a~~d~~~~~riV~G~~~~~~~~~~~ly~~~~~~~-----~i~~~~~~~AEl~K~~~N~~~a~~Isf~Nela~lce~-~  232 (411)
T TIGR03026       159 GNAVHDLLNPDRIVGGETEEAGEAVAELYAPIIEDG-----PVLVTSIETAEMIKLAENTFRAVKIAFANELARICEA-L  232 (411)
T ss_pred             CCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHCCCC-----EEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H
T ss_conf             472234236985999684999999999999746598-----4982588999999999999999889999999999998-5


Q ss_pred             CCCHHHHHHHHH
Q ss_conf             899789999998
Q gi|254780716|r  210 NKNPLEISHLFS  221 (475)
Q Consensus       210 ~~~~~~i~~vf~  221 (475)
T Consensus       233 gid~~eV~~a~~  244 (411)
T TIGR03026       233 GIDVYEVIEAAG  244 (411)
T ss_pred             CCCHHHHHHHHC
T ss_conf             689999997617