HHsearch alignment for GI: 254780716 and conserved domain: TIGR03325

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=95.39  E-value=0.21  Score=29.98  Aligned_cols=79  Identities=15%  Similarity=0.192  Sum_probs=54.0

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
T Consensus         7 valITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~---~~~----------------~~~~Dv~~~~~~~   67 (262)
T TIGR03325         7 VVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGD---AVV----------------GVEGDVRSLDDHK   67 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC---CEE----------------EEECCCCCHHHHH
T ss_conf             899906787899999999998799999998998999999986799---679----------------9984579999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
T Consensus        68 ~~v~~~~~~~G~iDiLVnNA   87 (262)
T TIGR03325        68 EAVARCVAAFGKIDCLIPNA   87 (262)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999849988899726