HHsearch alignment for GI: 254780716 and conserved domain: TIGR03451

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=94.59  E-value=0.43  Score=27.62  Aligned_cols=37  Identities=16%  Similarity=0.219  Sum_probs=14.8

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHH
Q ss_conf             5698157111688999997898-599973998999999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVF   42 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l   42 (475)
T Consensus       180 VlV~GaG~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A  217 (358)
T TIGR03451       180 VAVIGCGGVGDAAIAGAALAGASKIIAVDIDDRKLEWA  217 (358)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             99967376999999999983991899991988999999