HHsearch alignment for GI: 254780716 and conserved domain: cd00704

>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=90.75  E-value=1.4  Score=23.86  Aligned_cols=105  Identities=19%  Similarity=0.200  Sum_probs=61.3

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHCCC-------EEEEEECCH--HHHHHHHH---HCC-CCCCCCEECCCHHHHHHHCCCCC
Q ss_conf             0569815-7111688999997898-------599973998--99999997---122-11278403289899986057788
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDKGF-------RLAVYNKDF--ELTDVFIK---KIS-GLSQKVIVTKNLEQMVEAVCKPR   70 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~G~-------~V~vydr~~--~~~~~l~~---~~~-~~~~~~~~~~s~~e~v~~l~~pr   70 (475)
T Consensus         2 KV~IiGA~G~IG~~la~~l~~~~l~g~~~~i~l~L~Di~~~~~~~~G~~mdl~~~a~~~~~~v~~~~~~~---~~~~~aD   78 (323)
T cd00704           2 HVLITGAAGQIGYNLLFLIASGELFGDDQPVILHLLDIPPAMKALEGVVMELQDCAFPLLKGVVITTDPE---EAFKDVD   78 (323)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEECCCHH---HHHCCCC
T ss_conf             8999899978999999999728636998600899975888655531487866534665558748428858---9837998


Q ss_pred             EEEEECC---------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             9999769---------------9069999999997207899899967986578999999
Q gi|254780716|r   71 KILMMVT---------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS  114 (475)
Q Consensus        71 ~Iil~vp---------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~  114 (475)
T Consensus        79 vViitaG~prkpG~tR~DLl~~N~~I~k~~~~~i~~~a~p~~~vivvsN--PvD~~~~v  135 (323)
T cd00704          79 VAILVGAFPRKPGMERADLLRKNAKIFKEQGEALNKVAKPTVKVLVVGN--PANTNALI  135 (323)
T ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC--CCHHHHHH
T ss_conf             8998278788999827999987489999999999851799838999578--64689999