>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homol

Probab=97.07 E-value=0.0023 Score=44.28 Aligned_cols=128 Identities=14% Similarity=0.200 Sum_probs=78.9 Q ss_pred CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CC--CCCCEECCCHHHHHHHCCCCCEEEEEC Q ss_conf 98805698157111688999997898-59997399899999997122--11--278403289899986057788999976 Q gi|254780716|r 2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GL--SQKVIVTKNLEQMVEAVCKPRKILMMV 76 (475) Q Consensus 2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~--~~~~~~~~s~~e~v~~l~~pr~Iil~v 76 (475) T Consensus 18 ~~s~VlVvG~GGLG~~v~~~La~aGVg~i~ivD~D~Ve~sNL~RQ~l~~~~~~diG~~Ka~~a~~~l~~lN-p~v~i~~~ 96 (198) T cd01485 18 RSAKVLIIGAGALGAEIAKNLVLAGIDSITIVDHRLVSTEDLGSNFFLDAEVSNSGMNRAAASYEFLQELN-PNVKLSIV 96 (198) T ss_pred HHCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHC-CCCEEEEE T ss_conf 70989998778899999999997499869999599635335775750265411168729999999999779-99779998 Q ss_pred CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC Q ss_conf 990699999999972078998999679865789999999998479943067546760 Q gi|254780716|r 77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV 133 (475) Q Consensus 77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~ 133 (475) T Consensus 97 ~~~--~~~~~~n~~~~~~~~DlVvd~~d-n~~~r~~in~~c~~~~iPlI~ga~~G~~ 150 (198) T cd01485 97 EED--SLSNDSNIEEYLQKFTLVIATEE-NYERTAKVNDVCRKHHIPFISCATYGLI 150 (198) T ss_pred ECC--CCCCHHHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCCCE T ss_conf 224--45778689999848999999999-9999999999999929988999745668

HHsearch alignment for GI: 254780716 and conserved domain: cd01485