HHsearch alignment for GI: 254780716 and conserved domain: cd05313

>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids t
Probab=93.50  E-value=0.68  Score=26.15  Aligned_cols=113  Identities=16%  Similarity=0.145  Sum_probs=64.2

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEE--------EEC---CHHHHHHHHHH---CCCC-C------CCCEECCCHHH
Q ss_conf             88056981571116889999978985999--------739---98999999971---2211-2------78403289899
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAV--------YNK---DFELTDVFIKK---ISGL-S------QKVIVTKNLEQ   61 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~v--------ydr---~~~~~~~l~~~---~~~~-~------~~~~~~~s~~e   61 (475)
T Consensus        38 g~~vaIQGfGnVG~~aA~~l~e~GakvVaVsD~~G~i~~~~Gld~~~l~~l~~~k~~~~~~~~~~~~~~~~~~~~-~~~~  116 (254)
T cd05313          38 GKRVAISGSGNVAQYAAEKLLELGAKVVTLSDSKGYVYDPDGFTGEKLAELKEIKEVRRGRVSEYAKKYGTAKYF-EGKK  116 (254)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCEEC-CCCC
T ss_conf             999999897799999999999779979999857850887999988999999999974687102444138985663-8975


Q ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHH-HHHHCCCCC--CEEEECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             98605778899997699069999999-997207899--89996798657899999999984799430
Q gi|254780716|r   62 MVEAVCKPRKILMMVTDGDPVDQLID-KLKPLLSPE--DILLDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        62 ~v~~l~~pr~Iil~vp~g~~v~~vi~-~l~~~l~~g--~iiID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
T Consensus       117 ~~~--~~cDIli---Pa--A~en~I~~~nA~~i~a~~ck~IvEgANg--P~T~eAd~iL~~kGI~vi  174 (254)
T cd05313         117 PWE--VPCDIAF---PC--ATQNEVDAEDAKLLVKNGCKYVAEGANM--PCTAEAIEVFRQAGVLFA  174 (254)
T ss_pred             HHH--CCCCEEE---EC--CCCCCCCHHHHHHHHHCCCEEEEECCCC--CCCHHHHHHHHHCCCEEE
T ss_conf             133--0476997---43--5466789999999996798299865889--998789999998898896