Query         gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 475
No_of_seqs    253 out of 3103
Neff          6.4 
Searched_HMMs 39220
Date          Sun May 29 19:53:30 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780716.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00873 gnd 6-phosphoglucona 100.0       0       0 1414.0  39.6  465    5-470     1-480 (480)
  2 PTZ00142 6-phosphogluconate de 100.0       0       0 1219.1  51.5  468    2-469     4-474 (474)
  3 COG0362 Gnd 6-phosphogluconate 100.0       0       0 1224.7  45.5  473    1-474     1-473 (473)
  4 PRK09287 6-phosphogluconate de 100.0       0       0 1201.3  51.0  458   14-472     1-459 (459)
  5 KOG2653 consensus              100.0       0       0 1114.3  41.2  472    1-474     1-479 (487)
  6 pfam00393 6PGD 6-phosphoglucon 100.0       0       0  790.4  30.4  289  180-469     1-290 (290)
  7 PRK09599 6-phosphogluconate de 100.0       0       0  628.5  29.8  276    5-296     2-278 (301)
  8 PRK12490 6-phosphogluconate de 100.0       0       0  606.3  29.3  275    5-297     2-277 (298)
  9 TIGR00872 gnd_rel 6-phosphoglu 100.0       0       0  599.5  23.0  322    5-459     3-341 (341)
 10 COG1023 Gnd Predicted 6-phosph 100.0       0       0  561.5  26.5  274    5-296     2-277 (300)
 11 PRK11559 garR tartronate semia 100.0 1.4E-45       0  356.7  26.3  254    5-285     3-261 (295)
 12 TIGR01692 HIBADH 3-hydroxyisob 100.0       0       0  360.6  20.1  199    8-222     1-203 (290)
 13 COG2084 MmsB 3-hydroxyisobutyr 100.0 1.7E-44       0  347.5  29.0  255    5-286     2-262 (286)
 14 TIGR01505 tartro_sem_red 2-hyd 100.0 1.6E-42       0  333.0  16.8  252    5-283     1-257 (291)
 15 KOG0409 consensus              100.0 1.2E-40 2.8E-45  319.1  24.6  259    3-287    35-298 (327)
 16 pfam03446 NAD_binding_2 NAD bi 100.0 2.6E-36 6.6E-41  287.2  16.2  159    1-176     1-163 (163)
 17 COG1023 Gnd Predicted 6-phosph  99.9 2.4E-21 6.1E-26  176.9   8.2  133  316-459   167-300 (300)
 18 PRK09599 6-phosphogluconate de  99.7 1.8E-15 4.5E-20  133.6  13.1  133  315-458   167-300 (301)
 19 PRK12490 6-phosphogluconate de  99.6 2.8E-15 7.1E-20  132.2  11.9  133  315-458   165-298 (298)
 20 TIGR03026 NDP-sugDHase nucleot  99.6 5.9E-12 1.5E-16  107.7  22.7  208    5-221     2-244 (411)
 21 PRK11064 wecC UDP-N-acetyl-D-m  99.5 2.1E-11 5.4E-16  103.6  22.1  209    1-221     1-248 (415)
 22 TIGR00872 gnd_rel 6-phosphoglu  99.5 5.2E-14 1.3E-18  122.8   6.1   81  208-297   238-319 (341)
 23 COG0677 WecC UDP-N-acetyl-D-ma  99.4 2.4E-10 6.2E-15   95.8  21.1  255    4-282    10-304 (436)
 24 PRK07502 cyclohexadienyl dehyd  99.4 6.1E-11 1.5E-15  100.2  17.8  158    5-177     8-180 (307)
 25 PRK07417 arogenate dehydrogena  99.4 6.1E-11 1.5E-15  100.2  16.2  162    4-184     2-176 (280)
 26 PRK08507 prephenate dehydrogen  99.3 1.9E-09 4.8E-14   89.2  21.8  162    5-186     2-178 (275)
 27 PRK08655 prephenate dehydrogen  99.3 5.6E-09 1.4E-13   85.7  22.1  212    5-242     2-219 (441)
 28 PRK06928 pyrroline-5-carboxyla  99.3 7.2E-08 1.8E-12   77.6  26.4  241    1-292     1-259 (275)
 29 COG0287 TyrA Prephenate dehydr  99.3 7.3E-10 1.9E-14   92.2  15.8  163    3-177     3-172 (279)
 30 PRK12491 pyrroline-5-carboxyla  99.2 9.5E-08 2.4E-12   76.7  25.6  246    1-287     1-257 (272)
 31 PRK07680 late competence prote  99.2 1.2E-07 3.2E-12   75.8  25.3  257    5-303     2-269 (273)
 32 PRK11880 pyrroline-5-carboxyla  99.2 8.8E-08 2.2E-12   76.9  23.6  243    1-286     1-254 (267)
 33 pfam03721 UDPG_MGDP_dh_N UDP-g  99.2 1.5E-09 3.7E-14   90.0  13.3  113    5-120     2-136 (185)
 34 PRK07679 pyrroline-5-carboxyla  99.2 2.7E-07 6.9E-12   73.3  24.6  249    1-288     1-260 (279)
 35 PRK07531 bifunctional 3-hydrox  99.1 5.6E-08 1.4E-12   78.3  19.9  193    1-221     1-216 (489)
 36 pfam01210 NAD_Gly3P_dh_N NAD-d  99.1 1.3E-09 3.2E-14   90.5  11.4  140    5-149     2-155 (159)
 37 PRK06545 prephenate dehydrogen  99.1 9.6E-09 2.4E-13   84.0  15.8  165    5-185     2-181 (357)
 38 PRK00094 gpsA NAD(P)H-dependen  99.1   1E-08 2.6E-13   83.8  15.6  153    1-160     1-169 (325)
 39 PRK05808 3-hydroxybutyryl-CoA   99.1   8E-08   2E-12   77.2  19.3  193    1-221     1-219 (282)
 40 PRK06129 3-hydroxyacyl-CoA deh  99.1 9.6E-08 2.5E-12   76.6  18.9  191    4-221     3-220 (308)
 41 PRK06522 2-dehydropantoate 2-r  99.1 3.6E-07 9.1E-12   72.4  21.5   97    5-106     2-105 (307)
 42 pfam03807 F420_oxidored NADP o  99.0 4.4E-09 1.1E-13   86.5  11.0   91    5-104     1-92  (93)
 43 PRK08293 3-hydroxybutyryl-CoA   99.0 1.8E-07 4.5E-12   74.7  18.4  194    1-221     1-222 (288)
 44 PRK07660 consensus              99.0 2.9E-07 7.3E-12   73.1  19.0  194    1-222     1-220 (283)
 45 PRK06476 pyrroline-5-carboxyla  99.0 1.9E-06 4.8E-11   67.1  23.1  141    5-164     2-146 (255)
 46 PRK06035 3-hydroxyacyl-CoA deh  99.0 3.7E-07 9.4E-12   72.3  19.3  194    1-222     1-223 (291)
 47 PRK07066 3-hydroxybutyryl-CoA   99.0 3.5E-07 8.9E-12   72.5  18.9  246    4-295     8-282 (321)
 48 PRK07530 3-hydroxybutyryl-CoA   99.0 3.8E-07 9.7E-12   72.2  18.9  193    1-221     2-220 (292)
 49 PRK06130 3-hydroxybutyryl-CoA   99.0 2.5E-07 6.4E-12   73.6  17.8  191    4-221     6-216 (310)
 50 PRK09117 consensus              99.0 3.6E-07 9.2E-12   72.4  18.4  190    4-221     3-218 (282)
 51 PRK09260 3-hydroxybutyryl-CoA   98.9 2.4E-07 6.1E-12   73.7  17.0  193    1-221     1-219 (289)
 52 PRK07634 pyrroline-5-carboxyla  98.9 1.7E-06 4.2E-11   67.5  20.0  149    1-164     2-159 (245)
 53 PRK12439 NAD(P)H-dependent gly  98.9   4E-07   1E-11   72.0  16.0  152    3-160     6-173 (340)
 54 PRK08268 3-hydroxybutyryl-CoA   98.9 1.4E-06 3.5E-11   68.1  18.6  191    4-222     4-220 (503)
 55 COG0240 GpsA Glycerol-3-phosph  98.8 4.1E-07   1E-11   72.0  15.2  150    5-160     3-168 (329)
 56 PRK08229 2-dehydropantoate 2-r  98.8 2.8E-06 7.1E-11   65.8  18.5   98    1-106     2-110 (341)
 57 PRK07819 3-hydroxybutyryl-CoA   98.8 3.7E-06 9.4E-11   64.9  18.3  192    4-222     3-221 (284)
 58 pfam02153 PDH Prephenate dehyd  98.8   1E-05 2.7E-10   61.6  20.4  152   18-185     1-167 (258)
 59 PRK05708 2-dehydropantoate 2-r  98.8   7E-06 1.8E-10   62.9  19.4  114    1-117     1-117 (305)
 60 COG0345 ProC Pyrroline-5-carbo  98.8 1.7E-07 4.4E-12   74.8  10.9  242    5-287     3-254 (266)
 61 COG1004 Ugd Predicted UDP-gluc  98.7 2.6E-05 6.6E-10   58.7  21.9  206    5-219     2-240 (414)
 62 COG1250 FadB 3-hydroxyacyl-CoA  98.7 2.4E-06 6.2E-11   66.3  16.3  194    1-222     1-220 (307)
 63 COG2085 Predicted dinucleotide  98.7 8.6E-07 2.2E-11   69.6  14.0  153    1-164     1-174 (211)
 64 pfam02737 3HCDH_N 3-hydroxyacy  98.7 7.3E-07 1.9E-11   70.1  13.2  146    5-164     1-173 (180)
 65 PRK06249 2-dehydropantoate 2-r  98.7 3.4E-05 8.7E-10   57.8  20.8   97    3-106     5-109 (313)
 66 PRK12921 2-dehydropantoate 2-r  98.7   2E-05   5E-10   59.6  19.2   98    5-107     2-106 (306)
 67 COG1893 ApbA Ketopantoate redu  98.6 2.4E-05 6.1E-10   58.9  18.2  175    5-188     2-188 (307)
 68 PRK11730 fadB multifunctional   98.6   3E-05 7.5E-10   58.3  18.4  192    4-224   314-532 (715)
 69 COG0111 SerA Phosphoglycerate   98.6 5.4E-07 1.4E-11   71.1   9.2  110    4-123   143-253 (324)
 70 KOG2380 consensus               98.6 5.3E-06 1.4E-10   63.8  14.3  149    5-164    54-214 (480)
 71 PRK09287 6-phosphogluconate de  98.6   1E-06 2.6E-11   69.1  10.5  110  316-432   166-279 (459)
 72 pfam02826 2-Hacid_dh_C D-isome  98.6 7.2E-07 1.8E-11   70.2   9.4  115    3-129    36-151 (176)
 73 PTZ00142 6-phosphogluconate de  98.5 3.9E-07   1E-11   72.1   7.6  114  315-432   180-295 (474)
 74 PRK11154 fadJ multifunctional   98.5 7.5E-05 1.9E-09   55.3  19.0  193    4-225   310-529 (706)
 75 PRK06436 glycerate dehydrogena  98.5 3.4E-06 8.8E-11   65.2  12.2  109    3-125   122-231 (303)
 76 pfam10727 Rossmann-like Rossma  98.5 3.1E-06 7.9E-11   65.5  11.6   96    7-112     1-97  (111)
 77 PRK12480 D-lactate dehydrogena  98.5 1.5E-06 3.7E-11   67.9   9.9  115    3-130   146-261 (330)
 78 COG1052 LdhA Lactate dehydroge  98.5 3.8E-06 9.6E-11   64.9  11.2  113    4-127   147-260 (324)
 79 TIGR03376 glycerol3P_DH glycer  98.5   4E-06   1E-10   64.7  11.2  148    5-159     1-183 (342)
 80 PRK07574 formate dehydrogenase  98.5 4.1E-06   1E-10   64.6  11.0  151    4-165   193-360 (385)
 81 PRK11790 D-3-phosphoglycerate   98.4 6.1E-06 1.5E-10   63.4  11.2  107    4-123   152-259 (409)
 82 PRK11199 tyrA bifunctional cho  98.4 0.00012 3.2E-09   53.7  17.9  176    5-218   100-279 (374)
 83 pfam01488 Shikimate_DH Shikima  98.4 2.2E-06 5.5E-11   66.7   8.6   96    3-103    12-108 (134)
 84 pfam01408 GFO_IDH_MocA Oxidore  98.4 2.8E-05   7E-10   58.5  14.0  111    5-124     2-116 (120)
 85 PRK13581 D-3-phosphoglycerate   98.4 9.7E-06 2.5E-10   61.9  11.5  108    4-124   139-249 (524)
 86 PRK08605 D-lactate dehydrogena  98.4   1E-05 2.6E-10   61.7  11.2  116    3-130   146-263 (332)
 87 pfam00393 6PGD 6-phosphoglucon  98.4 2.2E-06 5.7E-11   66.6   7.7  113  175-288   133-250 (290)
 88 PRK13243 glyoxylate reductase;  98.4 5.4E-06 1.4E-10   63.7   9.7  112    4-126   151-263 (333)
 89 PRK06932 glycerate dehydrogena  98.3 1.6E-05 4.1E-10   60.2  11.8  112    4-130   148-260 (314)
 90 PRK08410 2-hydroxyacid dehydro  98.3 7.8E-06   2E-10   62.5  10.0  105    4-122   146-251 (311)
 91 TIGR00745 apbA_panE 2-dehydrop  98.3  0.0002 5.2E-09   52.1  16.6  176    5-188     1-199 (332)
 92 PRK00257 erythronate-4-phospha  98.3 9.1E-06 2.3E-10   62.1   9.3  107    3-123   116-227 (379)
 93 KOG0069 consensus               98.3   2E-05 5.1E-10   59.5  10.7  110    4-123   163-273 (336)
 94 COG1748 LYS9 Saccharopine dehy  98.2 3.9E-05   1E-09   57.4  12.1  229    1-244     1-282 (389)
 95 cd05213 NAD_bind_Glutamyl_tRNA  98.2 1.8E-05 4.5E-10   60.0  10.2   95    2-103   177-273 (311)
 96 PRK00045 hemA glutamyl-tRNA re  98.2 2.5E-05 6.3E-10   58.8  10.4   74    3-82    182-256 (429)
 97 COG0673 MviM Predicted dehydro  98.2 0.00016   4E-09   53.0  14.2  114    1-123     1-120 (342)
 98 PRK06487 glycerate dehydrogena  98.2 2.3E-05 5.7E-10   59.2   9.6  105    4-124   149-254 (317)
 99 pfam02558 ApbA Ketopantoate re  98.1 2.9E-05 7.4E-10   58.4   8.7   99    6-106     1-103 (150)
100 pfam07991 IlvN Acetohydroxy ac  98.0 9.8E-05 2.5E-09   54.5  10.4   90    2-101     3-93  (165)
101 PRK05479 ketol-acid reductoiso  98.0 8.5E-05 2.2E-09   54.9   9.7  181    3-214    17-222 (336)
102 pfam03435 Saccharop_dh Sacchar  98.0 0.00018 4.6E-09   52.5  11.4  123    6-133     1-128 (384)
103 PRK13304 L-aspartate dehydroge  98.0 0.00019 4.9E-09   52.3  11.1  172    1-188     1-189 (265)
104 COG0373 HemA Glutamyl-tRNA red  97.9 0.00018 4.6E-09   52.5  10.5   72    3-80    178-250 (414)
105 PRK08818 prephenate dehydrogen  97.9 0.00063 1.6E-08   48.5  13.0  144    3-177     4-156 (373)
106 PRK08306 dipicolinate synthase  97.9 0.00032 8.3E-09   50.6  11.5  246    4-297     3-288 (296)
107 TIGR01915 npdG NADPH-dependent  97.9 9.5E-05 2.4E-09   54.6   8.7  169    5-183     2-209 (233)
108 PRK13302 putative L-aspartate   97.9 0.00041 1.1E-08   49.8  11.9  174    3-188     6-194 (271)
109 PRK13403 ketol-acid reductoiso  97.9 0.00014 3.6E-09   53.3   9.4  187    4-223    17-227 (335)
110 PRK08269 3-hydroxybutyryl-CoA   97.8  0.0023 5.8E-08   44.4  14.4  184   14-222     1-217 (311)
111 COG0059 IlvC Ketol-acid reduct  97.8 0.00024 6.2E-09   51.6   8.9   94    4-108    19-116 (338)
112 TIGR01035 hemA glutamyl-tRNA r  97.8 0.00019 4.8E-09   52.4   8.3  179    3-243   185-369 (436)
113 PRK06823 ornithine cyclodeamin  97.8 0.00026 6.6E-09   51.4   8.7  115    4-127   129-246 (315)
114 PRK10669 putative cation:proto  97.7  0.0022 5.6E-08   44.5  13.2  114    5-127   419-534 (558)
115 COG4007 Predicted dehydrogenas  97.7  0.0074 1.9E-07   40.6  18.5  185    6-209     4-227 (340)
116 PRK11579 putative oxidoreducta  97.7  0.0036 9.1E-08   42.9  13.7  112    1-123     1-117 (346)
117 PRK13940 glutamyl-tRNA reducta  97.6 0.00043 1.1E-08   49.7   8.5   74    4-82    182-256 (414)
118 pfam02423 OCD_Mu_crystall Orni  97.6 0.00081 2.1E-08   47.7   9.7  115    4-127   130-247 (312)
119 COG0569 TrkA K+ transport syst  97.6  0.0029 7.3E-08   43.6  12.5  101    5-108     2-106 (225)
120 PRK13301 putative L-aspartate   97.6  0.0015 3.8E-08   45.7  10.4  118    1-132     1-126 (267)
121 KOG2741 consensus               97.6  0.0039 9.9E-08   42.7  12.5  118    5-128     8-130 (351)
122 PRK12557 H(2)-dependent methyl  97.5   0.011 2.9E-07   39.3  18.1  185   15-216    32-232 (341)
123 PRK08618 ornithine cyclodeamin  97.5 0.00082 2.1E-08   47.6   8.8  114    4-127   128-245 (325)
124 PRK06141 ornithine cyclodeamin  97.5 0.00047 1.2E-08   49.4   7.5  115    4-127   126-242 (313)
125 TIGR02279 PaaC-3OHAcCoADH 3-hy  97.5 0.00023 5.8E-09   51.7   5.7  149    3-163     5-178 (508)
126 PRK07340 ornithine cyclodeamin  97.5  0.0009 2.3E-08   47.4   8.6  162    4-182   126-289 (304)
127 PRK06407 ornithine cyclodeamin  97.5  0.0013 3.3E-08   46.2   9.3  115    4-127   119-237 (302)
128 PRK08291 ornithine cyclodeamin  97.5  0.0011 2.7E-08   46.8   8.6  114    4-126   133-250 (330)
129 COG2423 Predicted ornithine cy  97.5  0.0014 3.7E-08   45.8   9.1  116    4-128   131-250 (330)
130 PRK09496 trkA potassium transp  97.5  0.0064 1.6E-07   41.1  12.4   86    5-93      2-89  (455)
131 PRK13303 L-aspartate dehydroge  97.4  0.0053 1.4E-07   41.7  11.8  171    1-187     1-188 (265)
132 pfam02254 TrkA_N TrkA-N domain  97.4  0.0051 1.3E-07   41.8  11.6  110    6-125     1-112 (115)
133 pfam01262 AlaDh_PNT_C Alanine   97.4  0.0013 3.3E-08   46.2   8.4  100    4-104    21-122 (150)
134 cd01075 NAD_bind_Leu_Phe_Val_D  97.4  0.0033 8.4E-08   43.2  10.3  116    4-133    29-146 (200)
135 PRK03562 glutathione-regulated  97.4   0.015 3.9E-07   38.3  13.4  117    4-129   400-518 (615)
136 PRK03659 glutathione-regulated  97.3   0.018 4.6E-07   37.8  13.6  117    4-129   401-519 (602)
137 KOG2304 consensus               97.3  0.0036 9.1E-08   42.9   9.7  198    3-220    11-232 (298)
138 pfam00389 2-Hacid_dh D-isomer   97.3  0.0026 6.7E-08   43.9   8.9   84   58-149    29-112 (313)
139 PRK03369 murD UDP-N-acetylmura  97.3  0.0097 2.5E-07   39.7  11.6  114    4-124    13-146 (487)
140 PRK07589 ornithine cyclodeamin  97.2  0.0019 4.8E-08   45.0   7.7  116    4-126   130-247 (346)
141 cd01483 E1_enzyme_family Super  97.2  0.0023 5.8E-08   44.4   8.0  123    5-133     1-126 (143)
142 COG4091 Predicted homoserine d  97.2   0.018 4.6E-07   37.8  12.6  118    5-133    19-142 (438)
143 cd01065 NAD_bind_Shikimate_DH   97.2  0.0018 4.6E-08   45.1   7.4  118    3-126    19-137 (155)
144 PRK08643 acetoin reductase; Va  97.2  0.0077   2E-07   40.5  10.4   85    1-103     1-87  (256)
145 PRK05472 redox-sensing transcr  97.2  0.0007 1.8E-08   48.2   4.9   81    4-91     85-168 (211)
146 PRK01710 murD UDP-N-acetylmura  97.2    0.01 2.5E-07   39.7  10.8  115    3-124    14-146 (458)
147 PRK05225 ketol-acid reductoiso  97.2  0.0028 7.2E-08   43.7   7.9   89    4-100    38-129 (489)
148 pfam00899 ThiF ThiF family. Th  97.2  0.0049 1.2E-07   42.0   9.1  124    4-133     2-128 (134)
149 PRK06199 ornithine cyclodeamin  97.1  0.0023 5.9E-08   44.3   7.1   95    4-103   156-259 (379)
150 PRK06046 alanine dehydrogenase  97.1   0.005 1.3E-07   41.9   8.8  114    4-127   130-246 (326)
151 PRK00421 murC UDP-N-acetylmura  97.1   0.033 8.4E-07   35.8  14.0  111    5-123    10-136 (459)
152 PRK01390 murD UDP-N-acetylmura  97.1  0.0096 2.4E-07   39.8  10.0  116    4-128    10-147 (457)
153 COG1712 Predicted dinucleotide  97.1   0.016 4.1E-07   38.1  11.1  111    5-127     2-117 (255)
154 cd01485 E1-1_like Ubiquitin ac  97.1  0.0023   6E-08   44.3   6.7  128    2-133    18-150 (198)
155 PRK08328 hypothetical protein;  97.1  0.0026 6.5E-08   44.0   6.8  125    2-133    26-155 (230)
156 PRK02472 murD UDP-N-acetylmura  97.0   0.023 5.9E-07   37.0  11.7  115    4-124    10-141 (450)
157 PRK07454 short chain dehydroge  97.0   0.018 4.6E-07   37.8  11.1   87    1-103     3-91  (241)
158 cd01492 Aos1_SUMO Ubiquitin ac  97.0  0.0057 1.5E-07   41.5   8.1  124    2-132    20-146 (197)
159 PTZ00082 L-lactate dehydrogena  97.0   0.013 3.3E-07   38.8   9.9  105    1-112     5-136 (322)
160 PRK00258 aroE shikimate 5-dehy  97.0   0.011 2.7E-07   39.4   9.3   11  171-181   125-135 (275)
161 cd05293 LDH_1 A subgroup of L-  97.0   0.044 1.1E-06   34.9  14.2  103    4-113     4-128 (312)
162 PRK00683 murD UDP-N-acetylmura  96.9   0.022 5.5E-07   37.2  10.8  122    1-131     1-138 (418)
163 COG0771 MurD UDP-N-acetylmuram  96.9   0.013 3.4E-07   38.7   9.7  126    4-133     8-148 (448)
164 KOG0068 consensus               96.9   0.011 2.9E-07   39.2   9.3  105    4-119   147-252 (406)
165 pfam02629 CoA_binding CoA bind  96.9  0.0066 1.7E-07   41.0   8.0   80    3-91      3-84  (96)
166 PRK12549 shikimate 5-dehydroge  96.9  0.0035   9E-08   43.0   6.5   12  171-182   130-141 (284)
167 TIGR01087 murD UDP-N-acetylmur  96.9   0.019 4.9E-07   37.5  10.2  129    5-133     1-148 (476)
168 TIGR02853 spore_dpaA dipicolin  96.8   0.014 3.7E-07   38.5   9.2  114    4-131   153-267 (288)
169 PRK00141 murD UDP-N-acetylmura  96.8   0.041   1E-06   35.1  11.5  118    2-126    17-154 (476)
170 PRK10206 putative dehydrogenas  96.8   0.058 1.5E-06   34.0  13.7  114    1-123     1-118 (345)
171 TIGR00873 gnd 6-phosphoglucona  96.8  0.0024 6.2E-08   44.2   4.9  124  320-457   183-314 (480)
172 PRK04308 murD UDP-N-acetylmura  96.8   0.062 1.6E-06   33.8  12.3  117    3-125     5-140 (445)
173 PRK06349 homoserine dehydrogen  96.7   0.019 4.9E-07   37.6   9.1  167    1-202     1-184 (432)
174 PRK05653 fabG 3-ketoacyl-(acyl  96.7   0.026 6.7E-07   36.5   9.7   83    5-103     6-90  (246)
175 TIGR03206 benzo_BadH 2-hydroxy  96.7   0.024 6.2E-07   36.8   9.5   82    6-103     5-88  (250)
176 cd00757 ThiF_MoeB_HesA_family   96.7  0.0081 2.1E-07   40.3   7.1  126    2-133    20-148 (228)
177 PTZ00117 malate dehydrogenase;  96.7   0.028 7.2E-07   36.3   9.7  103    1-112     1-125 (313)
178 PRK00048 dihydrodipicolinate r  96.6   0.067 1.7E-06   33.6  11.4  126    1-180     1-129 (265)
179 PRK07688 thiamine/molybdopteri  96.6    0.01 2.6E-07   39.6   7.2  126    2-133    23-153 (339)
180 PRK12384 sorbitol-6-phosphate   96.6   0.049 1.2E-06   34.6  10.6   85    1-103     1-89  (259)
181 KOG2305 consensus               96.6    0.01 2.6E-07   39.5   7.2  199    1-221     1-222 (313)
182 pfam06408 consensus             96.6   0.075 1.9E-06   33.2  13.6  150    5-185     3-164 (471)
183 cd01491 Ube1_repeat1 Ubiquitin  96.6   0.029 7.4E-07   36.2   9.4  122    1-132    17-141 (286)
184 PRK08862 short chain dehydroge  96.6   0.027   7E-07   36.4   9.3   81    6-102     7-90  (227)
185 cd01493 APPBP1_RUB Ubiquitin a  96.6  0.0072 1.8E-07   40.7   6.3  127    1-131    18-147 (425)
186 PRK09134 short chain dehydroge  96.6   0.037 9.5E-07   35.4   9.9   87    1-103     6-95  (256)
187 PRK07831 short chain dehydroge  96.6   0.042 1.1E-06   35.1  10.2   85    5-103    17-104 (261)
188 pfam05368 NmrA NmrA-like famil  96.6   0.079   2E-06   33.0  11.5   91    8-124     3-97  (232)
189 COG0169 AroE Shikimate 5-dehyd  96.6  0.0096 2.5E-07   39.8   6.8  114    4-123   127-244 (283)
190 PRK05690 molybdopterin biosynt  96.6   0.016   4E-07   38.2   7.9  141    2-153    31-176 (245)
191 PRK11861 bifunctional prephena  96.6    0.01 2.6E-07   39.6   6.9   99   72-177     1-112 (673)
192 cd05292 LDH_2 A subgroup of L-  96.6   0.054 1.4E-06   34.3  10.6  101    5-112     2-123 (308)
193 COG0686 Ald Alanine dehydrogen  96.6    0.02 5.2E-07   37.4   8.4   96    5-102   170-267 (371)
194 PRK06223 malate dehydrogenase;  96.6   0.048 1.2E-06   34.6  10.3  101    5-112     2-125 (312)
195 PRK12475 thiamine/molybdopteri  96.6   0.012 3.1E-07   39.0   7.2  199    2-227    23-226 (337)
196 PTZ00325 malate dehydrogenase;  96.6   0.052 1.3E-06   34.4  10.4  103    1-111     1-123 (313)
197 PRK07666 fabG 3-ketoacyl-(acyl  96.6   0.032 8.1E-07   35.9   9.3   77   11-103    15-91  (238)
198 KOG2711 consensus               96.6   0.029 7.5E-07   36.2   9.1   98    2-103    20-139 (372)
199 PRK01438 murD UDP-N-acetylmura  96.5   0.034 8.7E-07   35.7   9.4  114    4-124    15-151 (481)
200 PRK07576 short chain dehydroge  96.5   0.087 2.2E-06   32.7  11.5   81    6-102    10-92  (260)
201 cd05211 NAD_bind_Glu_Leu_Phe_V  96.5   0.057 1.4E-06   34.1  10.3  115    3-126    23-148 (217)
202 TIGR01327 PGDH D-3-phosphoglyc  96.5   0.026 6.6E-07   36.6   8.5  111    4-126   140-253 (535)
203 PRK06181 short chain dehydroge  96.5   0.033 8.5E-07   35.8   9.0   77   11-103    10-86  (263)
204 cd01337 MDH_glyoxysomal_mitoch  96.5   0.047 1.2E-06   34.7   9.7   71    5-75      2-75  (310)
205 PRK08223 hypothetical protein;  96.5   0.026 6.6E-07   36.6   8.4  137    2-147    26-167 (287)
206 PRK03803 murD UDP-N-acetylmura  96.5   0.093 2.4E-06   32.5  11.5  122    6-132    10-146 (448)
207 PRK07775 short chain dehydroge  96.4   0.038 9.8E-07   35.3   9.1   78   10-103    18-95  (275)
208 PRK09310 aroDE bifunctional 3-  96.4   0.018 4.6E-07   37.8   7.3  117   68-189   103-236 (477)
209 PRK08277 D-mannonate oxidoredu  96.4   0.041   1E-06   35.1   9.1   82    6-103    12-95  (278)
210 PRK07024 short chain dehydroge  96.4   0.083 2.1E-06   32.9  10.7   83    1-102     1-84  (256)
211 PRK05678 succinyl-CoA syntheta  96.4     0.1 2.6E-06   32.2  11.7  120    3-133     8-128 (289)
212 PRK07097 gluconate 5-dehydroge  96.4   0.048 1.2E-06   34.6   9.4   82    6-103    12-95  (265)
213 PRK08644 thiamine biosynthesis  96.4   0.029 7.4E-07   36.2   8.2  120    2-127    26-148 (209)
214 PRK06180 short chain dehydroge  96.4   0.093 2.4E-06   32.5  10.8   84    1-103     1-86  (277)
215 PRK07677 short chain dehydroge  96.4   0.044 1.1E-06   34.9   9.1   81    6-102     5-87  (254)
216 PRK12749 quinate/shikimate deh  96.4   0.037 9.3E-07   35.5   8.7   13   31-43     41-53  (288)
217 PRK02006 murD UDP-N-acetylmura  96.4    0.11 2.8E-06   32.0  11.7  121    2-128     6-155 (501)
218 cd01339 LDH-like_MDH L-lactate  96.3   0.071 1.8E-06   33.4   9.9  100    6-112     1-122 (300)
219 PRK07774 short chain dehydroge  96.3   0.047 1.2E-06   34.7   9.0   82    6-103     8-91  (250)
220 PRK06346 consensus              96.3   0.045 1.1E-06   34.9   8.9   83    6-104     7-91  (251)
221 PRK06124 gluconate 5-dehydroge  96.3    0.06 1.5E-06   33.9   9.5   82    6-103    16-99  (259)
222 COG5495 Uncharacterized conser  96.3    0.11 2.9E-06   31.8  11.1  181    4-209    11-202 (289)
223 TIGR00507 aroE shikimate 5-deh  96.3   0.016 4.1E-07   38.1   6.5  120    3-126   121-249 (286)
224 PRK06949 short chain dehydroge  96.3     0.1 2.6E-06   32.2  10.6   82    6-103    12-94  (258)
225 PRK07890 short chain dehydroge  96.3   0.058 1.5E-06   34.0   9.3   83    5-103     6-90  (258)
226 PRK06482 short chain dehydroge  96.3    0.11 2.7E-06   32.1  10.6   82    1-103     1-84  (276)
227 PRK08085 gluconate 5-dehydroge  96.3   0.055 1.4E-06   34.2   9.1   83    6-104    11-95  (254)
228 COG2344 AT-rich DNA-binding pr  96.3   0.016 4.1E-07   38.2   6.3   81    4-91     85-168 (211)
229 PRK12939 short chain dehydroge  96.3   0.066 1.7E-06   33.6   9.4   83    5-103     8-92  (250)
230 PRK05866 short chain dehydroge  96.2   0.045 1.1E-06   34.8   8.5   76   12-103    50-125 (290)
231 PRK12826 3-ketoacyl-(acyl-carr  96.2   0.073 1.9E-06   33.3   9.6   83    5-103     7-91  (253)
232 PRK09496 trkA potassium transp  96.2    0.13 3.2E-06   31.5  11.4   52  136-190   203-255 (455)
233 TIGR01830 3oxo_ACP_reduc 3-oxo  96.2   0.037 9.4E-07   35.5   8.0  173   14-241    10-232 (238)
234 PRK07832 short chain dehydroge  96.2   0.062 1.6E-06   33.8   9.1   77   12-103    10-86  (272)
235 KOG2012 consensus               96.2   0.028 7.2E-07   36.3   7.4  120    1-131    35-158 (1013)
236 PRK08217 fabG 3-ketoacyl-(acyl  96.2   0.064 1.6E-06   33.7   9.2   78   10-103    13-90  (253)
237 pfam00056 Ldh_1_N lactate/mala  96.2   0.038 9.7E-07   35.4   8.0  104    5-115     2-128 (142)
238 COG1064 AdhP Zn-dependent alco  96.2    0.11 2.8E-06   32.0  10.3   44    4-48    168-212 (339)
239 cd05291 HicDH_like L-2-hydroxy  96.2   0.091 2.3E-06   32.6   9.9  100    5-111     2-123 (306)
240 COG0074 SucD Succinyl-CoA synt  96.2   0.098 2.5E-06   32.3  10.0  220    4-260     9-240 (293)
241 PRK08762 molybdopterin biosynt  96.2    0.04   1E-06   35.2   7.9  125    3-133   138-265 (379)
242 PRK05650 short chain dehydroge  96.2   0.061 1.6E-06   33.8   8.8   75   12-102    10-84  (270)
243 PRK08251 short chain dehydroge  96.1   0.069 1.7E-06   33.5   9.0   86    3-102     2-88  (248)
244 cd01076 NAD_bind_1_Glu_DH NAD(  96.1    0.14 3.5E-06   31.3  10.4  121    3-133    31-166 (227)
245 COG0579 Predicted dehydrogenas  96.1   0.021 5.4E-07   37.2   6.3  114    1-123     1-117 (429)
246 PRK02705 murD UDP-N-acetylmura  96.1    0.15 3.8E-06   31.0  12.8  116    7-124     4-138 (459)
247 PRK05717 oxidoreductase; Valid  96.1   0.093 2.4E-06   32.5   9.5   78    6-102    12-91  (255)
248 cd00300 LDH_like L-lactate deh  96.1   0.092 2.3E-06   32.5   9.4   99    6-111     1-121 (300)
249 pfam01113 DapB_N Dihydrodipico  96.1    0.14 3.5E-06   31.3  10.2   89    5-125     2-93  (122)
250 TIGR03366 HpnZ_proposed putati  96.0    0.15 3.9E-06   30.9  11.3   44    4-47    122-166 (280)
251 COG0362 Gnd 6-phosphogluconate  96.0    0.03 7.7E-07   36.1   6.9  106  320-432   182-291 (473)
252 PRK08265 short chain dehydroge  96.0   0.091 2.3E-06   32.6   9.2   80    5-103     7-88  (261)
253 PRK07479 consensus              96.0   0.096 2.4E-06   32.4   9.3   83    5-103     6-90  (252)
254 PRK06172 short chain dehydroge  96.0    0.09 2.3E-06   32.6   9.1   83    5-103     8-92  (253)
255 PRK05867 short chain dehydroge  96.0   0.081 2.1E-06   32.9   8.9   82    6-103    11-94  (253)
256 PRK09466 metL bifunctional asp  96.0    0.16 4.1E-06   30.8  10.8   18  402-419   670-687 (810)
257 PRK06113 7-alpha-hydroxysteroi  96.0   0.085 2.2E-06   32.8   9.0   82    6-103    13-96  (255)
258 PRK09242 tropinone reductase;   96.0    0.14 3.5E-06   31.3   9.9   84    6-103    12-97  (258)
259 PRK07062 short chain dehydroge  96.0    0.11 2.7E-06   32.1   9.4   82    6-103    10-95  (265)
260 PRK04663 murD UDP-N-acetylmura  96.0    0.16 4.2E-06   30.7  10.5  115    1-125     7-138 (438)
261 PRK08263 short chain dehydroge  96.0    0.16 4.2E-06   30.7  10.9   83    1-103     1-85  (275)
262 PRK12429 3-hydroxybutyrate deh  96.0     0.1 2.5E-06   32.3   9.2   83    5-103     5-89  (258)
263 PRK06139 short chain dehydroge  96.0   0.086 2.2E-06   32.8   8.8   77   11-103    15-91  (324)
264 PRK09424 pntA NAD(P) transhydr  96.0   0.049 1.3E-06   34.5   7.6   36   90-127    80-115 (510)
265 PRK07109 short chain dehydroge  95.9   0.099 2.5E-06   32.3   9.1   81    6-102    11-92  (338)
266 cd00650 LDH_MDH_like NAD-depen  95.9   0.074 1.9E-06   33.2   8.4  102    6-113     1-127 (263)
267 PRK08213 gluconate 5-dehydroge  95.9     0.1 2.6E-06   32.2   9.1   82    6-103    14-97  (259)
268 PRK12743 acetoin dehydrogenase  95.9    0.17 4.4E-06   30.5  10.4   85    1-103     1-88  (253)
269 PRK00066 ldh L-lactate dehydro  95.9    0.17 4.4E-06   30.5  13.2  103    3-112     6-129 (315)
270 PRK03806 murD UDP-N-acetylmura  95.9    0.17 4.4E-06   30.5  13.0  114    4-125     7-135 (438)
271 PRK07201 short chain dehydroge  95.9    0.12 3.2E-06   31.6   9.5   36   10-45      8-46  (663)
272 pfam00208 ELFV_dehydrog Glutam  95.9    0.15 3.8E-06   31.0   9.9  114    4-126    33-161 (237)
273 PRK10538 3-hydroxy acid dehydr  95.9    0.12 3.1E-06   31.7   9.3   73   12-103    10-82  (248)
274 PRK06200 2,3-dihydroxy-2,3-dih  95.9     0.1 2.6E-06   32.3   8.9   75   10-103    14-88  (263)
275 PRK06720 hypothetical protein;  95.9   0.088 2.2E-06   32.7   8.6   82    6-103    18-101 (169)
276 TIGR02356 adenyl_thiF thiazole  95.9   0.078   2E-06   33.1   8.3  124    3-132    21-151 (210)
277 PRK06914 short chain dehydroge  95.9    0.17 4.3E-06   30.6  10.0   88    1-103     1-89  (280)
278 PRK06182 short chain dehydroge  95.9    0.18 4.7E-06   30.3  10.7   81    1-103     1-82  (273)
279 PRK06194 hypothetical protein;  95.8   0.082 2.1E-06   32.9   8.3   82    5-102     7-90  (301)
280 cd00755 YgdL_like Family of ac  95.8    0.12   3E-06   31.8   9.1  136    2-146    10-149 (231)
281 PRK05597 molybdopterin biosynt  95.8    0.14 3.5E-06   31.3   9.3  125    3-133    28-155 (355)
282 TIGR01921 DAP-DH diaminopimela  95.8    0.19 4.9E-06   30.2  10.3  183    1-217     1-197 (326)
283 PRK07523 gluconate 5-dehydroge  95.8    0.19 4.8E-06   30.3  10.0   75   10-103    17-91  (251)
284 PRK07814 short chain dehydroge  95.8    0.13 3.4E-06   31.4   9.2   82    5-102    11-94  (263)
285 PRK09186 flagellin modificatio  95.8    0.14 3.7E-06   31.1   9.4   84    3-103     3-90  (255)
286 CHL00194 ycf39 Ycf39; Provisio  95.8   0.082 2.1E-06   32.9   8.1  109    6-132     3-113 (319)
287 PRK07326 short chain dehydroge  95.8    0.11 2.9E-06   31.9   8.7   80    6-103     7-88  (235)
288 PRK05786 fabG 3-ketoacyl-(acyl  95.8    0.15 3.7E-06   31.1   9.3   80    6-102     8-88  (238)
289 cd01487 E1_ThiF_like E1_ThiF_l  95.8    0.09 2.3E-06   32.6   8.2  121    5-131     1-124 (174)
290 PRK07478 short chain dehydroge  95.8    0.12   3E-06   31.8   8.8   82    5-102     7-90  (254)
291 PRK07035 short chain dehydroge  95.7    0.14 3.6E-06   31.2   9.1   81    6-102    10-92  (252)
292 PRK06138 short chain dehydroge  95.7    0.15 3.9E-06   30.9   9.3   82    5-103     6-89  (252)
293 PRK12409 D-amino acid dehydrog  95.7   0.017 4.3E-07   38.0   4.4   34    1-36      1-34  (410)
294 PRK12829 short chain dehydroge  95.7    0.16   4E-06   30.8   9.3   81    5-103    12-94  (264)
295 PRK12828 short chain dehydroge  95.7    0.19 4.9E-06   30.2   9.7   81    5-103     8-90  (239)
296 PRK05600 thiamine biosynthesis  95.7     0.1 2.5E-06   32.3   8.3  126    2-133    40-168 (370)
297 PRK12936 3-ketoacyl-(acyl-carr  95.7    0.16 4.1E-06   30.8   9.3   75   10-103    14-88  (245)
298 PRK05855 short chain dehydroge  95.7    0.12 3.2E-06   31.6   8.6   72   14-101   327-398 (582)
299 PRK07776 consensus              95.6    0.22 5.6E-06   29.8   9.9   79    6-102    10-90  (252)
300 cd01078 NAD_bind_H4MPT_DH NADP  95.6    0.21 5.2E-06   30.0   9.7  100    5-107    30-133 (194)
301 PRK08340 glucose-1-dehydrogena  95.6    0.16 4.1E-06   30.8   9.1   79    6-101     3-82  (259)
302 PRK06123 short chain dehydroge  95.6    0.22 5.7E-06   29.7  10.0   86    1-103     1-89  (249)
303 PRK05565 fabG 3-ketoacyl-(acyl  95.6    0.14 3.6E-06   31.1   8.8   78   10-103    13-91  (247)
304 PRK07067 sorbitol dehydrogenas  95.6     0.2 5.2E-06   30.0   9.6   80    5-103     6-87  (256)
305 TIGR02371 ala_DH_arch alanine   95.6   0.062 1.6E-06   33.8   6.9  123    4-135   130-267 (327)
306 PRK13394 3-hydroxybutyrate deh  95.5    0.17 4.4E-06   30.6   9.0   83    5-103     8-92  (262)
307 PRK06198 short chain dehydroge  95.5    0.17 4.4E-06   30.5   9.1   82    6-103     9-92  (268)
308 TIGR02717 AcCoA-syn-alpha acet  95.5   0.085 2.2E-06   32.8   7.4  252    5-292     9-339 (457)
309 PRK07231 fabG 3-ketoacyl-(acyl  95.5    0.18 4.5E-06   30.4   9.0   81    5-103     7-89  (250)
310 PRK12548 shikimate 5-dehydroge  95.5   0.085 2.2E-06   32.8   7.4   15   30-44     42-56  (289)
311 PRK07825 short chain dehydroge  95.5     0.2 5.1E-06   30.1   9.2   73   11-103    14-86  (273)
312 PRK06947 glucose-1-dehydrogena  95.4    0.16   4E-06   30.8   8.6   83    5-103     7-92  (252)
313 PRK08324 short chain dehydroge  95.4     0.2   5E-06   30.1   9.0   51  228-282   400-451 (676)
314 PRK12935 acetoacetyl-CoA reduc  95.4    0.18 4.5E-06   30.4   8.8   83    5-103     7-92  (247)
315 pfam03447 NAD_binding_3 Homose  95.4    0.26 6.7E-06   29.2  10.2  105   10-124     1-113 (116)
316 COG0460 ThrA Homoserine dehydr  95.4    0.15 3.9E-06   30.9   8.4  124    1-132     1-144 (333)
317 PRK06500 short chain dehydroge  95.4    0.26 6.7E-06   29.2   9.6   75   10-103    14-88  (249)
318 TIGR03325 BphB_TodD cis-2,3-di  95.4    0.21 5.2E-06   30.0   9.0   79    6-103     7-87  (262)
319 PRK06940 short chain dehydroge  95.4    0.27 6.8E-06   29.1  10.0   85    1-104     3-88  (277)
320 COG0057 GapA Glyceraldehyde-3-  95.4   0.049 1.3E-06   34.6   5.8  166    5-198     3-178 (335)
321 PRK05693 short chain dehydroge  95.4    0.27 6.9E-06   29.1   9.5   76    6-103     4-80  (274)
322 PRK12745 3-ketoacyl-(acyl-carr  95.3    0.28   7E-06   29.0  10.4   87    1-103     1-91  (259)
323 PRK12938 acetyacetyl-CoA reduc  95.3    0.16   4E-06   30.8   8.3   86    1-103     1-89  (246)
324 PRK05134 3-demethylubiquinone-  95.3    0.28   7E-06   29.0   9.5   95    5-101    51-149 (233)
325 PRK08267 short chain dehydroge  95.3     0.2   5E-06   30.1   8.7   79    6-102     4-84  (258)
326 PRK07063 short chain dehydroge  95.3    0.27 6.8E-06   29.1   9.3   83    5-103     8-93  (259)
327 PRK05875 short chain dehydroge  95.2    0.21 5.4E-06   29.9   8.6   81   10-103    15-95  (277)
328 PRK07806 short chain dehydroge  95.2     0.2 5.1E-06   30.1   8.5   81    6-102     8-91  (248)
329 PRK05872 short chain dehydroge  95.2     0.3 7.8E-06   28.7   9.5   79    6-103    11-91  (296)
330 pfam00107 ADH_zinc_N Zinc-bind  95.2     0.3 7.8E-06   28.7   9.8   36   10-48      1-37  (131)
331 PRK05876 short chain dehydroge  95.2     0.2 5.2E-06   30.0   8.4   82    5-102     7-90  (275)
332 PRK06179 short chain dehydroge  95.2    0.31 7.9E-06   28.7   9.5   79    1-103     1-81  (270)
333 PRK08226 short chain dehydroge  95.2    0.31 7.8E-06   28.7   9.3   81    6-103     8-90  (263)
334 PRK06227 consensus              95.2    0.29 7.3E-06   28.9   9.1   82    6-103     7-90  (256)
335 PRK06841 short chain dehydroge  95.2    0.31 7.9E-06   28.6   9.6   79    6-103    17-97  (255)
336 PRK12824 acetoacetyl-CoA reduc  95.1    0.31   8E-06   28.6  10.8   85    1-103     1-88  (245)
337 PRK09730 hypothetical protein;  95.1    0.21 5.4E-06   29.9   8.4   82    6-103     3-87  (247)
338 PRK08063 enoyl-(acyl carrier p  95.1    0.27 6.8E-06   29.2   8.9   84    4-103     4-90  (250)
339 PRK07411 hypothetical protein;  95.1    0.13 3.3E-06   31.4   7.3  125    3-133    38-165 (390)
340 PRK01747 mnmC 5-methylaminomet  95.1   0.033 8.4E-07   35.8   4.2   34    3-36    256-289 (660)
341 PRK06077 fabG 3-ketoacyl-(acyl  95.1    0.26 6.7E-06   29.2   8.7   78   10-103    11-89  (249)
342 COG0002 ArgC Acetylglutamate s  95.0     0.2 5.2E-06   30.0   8.1  210    4-226     3-228 (349)
343 PRK12746 short chain dehydroge  95.0    0.22 5.6E-06   29.8   8.3   43    5-47      7-52  (254)
344 PRK08339 short chain dehydroge  95.0    0.33 8.5E-06   28.4   9.1   81    5-101     9-91  (263)
345 COG0476 ThiF Dinucleotide-util  95.0    0.19 4.9E-06   30.2   7.9  127    1-133    28-157 (254)
346 PRK07102 short chain dehydroge  94.9    0.35   9E-06   28.2   9.6   44    1-46      1-45  (243)
347 PRK12825 fabG 3-ketoacyl-(acyl  94.9    0.36 9.1E-06   28.2  10.9   82    6-103    10-93  (250)
348 cd05191 NAD_bind_amino_acid_DH  94.9    0.14 3.5E-06   31.3   6.9   62    4-103    24-86  (86)
349 PRK09436 thrA bifunctional asp  94.9    0.37 9.3E-06   28.1   9.6   18  403-420   677-694 (817)
350 KOG0023 consensus               94.9    0.27 6.8E-06   29.1   8.3   40    5-45    184-224 (360)
351 pfam01118 Semialdhyde_dh Semia  94.9   0.083 2.1E-06   32.9   5.7   95    5-106     1-100 (121)
352 TIGR01829 AcAcCoA_reduct aceto  94.8    0.26 6.7E-06   29.2   8.2   84   10-109     8-93  (244)
353 PRK08945 short chain dehydroge  94.8    0.37 9.6E-06   28.0   9.8   78   10-102    21-100 (245)
354 PRK07707 consensus              94.8    0.39 9.9E-06   27.9  10.0   44    1-46      1-47  (239)
355 PRK00676 hemA glutamyl-tRNA re  94.7    0.11 2.9E-06   31.9   6.1   23  139-161    99-121 (338)
356 PRK04207 glyceraldehyde-3-phos  94.7    0.22 5.6E-06   29.8   7.5  152    1-188     1-155 (338)
357 PRK07074 short chain dehydroge  94.7    0.41   1E-05   27.8   9.2   78    6-102     4-83  (256)
358 PRK07878 molybdopterin biosynt  94.7    0.13 3.2E-06   31.5   6.2  125    3-133    42-169 (392)
359 smart00859 Semialdhyde_dh Semi  94.7    0.15 3.9E-06   30.9   6.6   99    5-106     1-102 (122)
360 PRK06484 short chain dehydroge  94.7    0.41 1.1E-05   27.7  10.0   78    6-102     7-86  (530)
361 PRK12823 benD 1,6-dihydroxycyc  94.7    0.41 1.1E-05   27.7   8.9   81    5-102     9-91  (260)
362 PRK06484 short chain dehydroge  94.7    0.41 1.1E-05   27.7   9.5   13  111-123   163-175 (530)
363 PRK06114 short chain dehydroge  94.6    0.41 1.1E-05   27.7   9.2   82    6-103    18-102 (262)
364 PRK12827 short chain dehydroge  94.6    0.33 8.3E-06   28.5   8.3   86    6-103     8-95  (251)
365 PRK07236 hypothetical protein;  94.6    0.05 1.3E-06   34.5   4.1   37    1-37      4-40  (386)
366 TIGR03451 mycoS_dep_FDH mycoth  94.6    0.43 1.1E-05   27.6  10.4   37    6-42    180-217 (358)
367 PRK12550 shikimate 5-dehydroge  94.5    0.18 4.7E-06   30.3   6.8   11  171-181   125-135 (272)
368 PRK05993 short chain dehydroge  94.5    0.44 1.1E-05   27.5  10.6   80    1-103     3-84  (277)
369 PRK06057 short chain dehydroge  94.5    0.45 1.2E-05   27.5   9.8   78    5-103     8-87  (255)
370 cd01080 NAD_bind_m-THF_DH_Cycl  94.4    0.13 3.4E-06   31.4   5.9   77    4-109    45-122 (168)
371 PRK06019 phosphoribosylaminoim  94.4   0.092 2.3E-06   32.5   5.0   68    3-74      7-74  (377)
372 PRK06101 short chain dehydroge  94.3    0.48 1.2E-05   27.2   9.9   41    6-46      4-45  (241)
373 pfam02882 THF_DHG_CYH_C Tetrah  94.3    0.18 4.6E-06   30.4   6.3   75    4-107    37-112 (159)
374 PRK09135 pteridine reductase;   94.3    0.49 1.3E-05   27.2   9.3   85    5-104     7-94  (249)
375 PRK06483 short chain dehydroge  94.3     0.5 1.3E-05   27.1  10.5   80    1-103     1-82  (236)
376 COG2910 Putative NADH-flavin r  94.3    0.38 9.6E-06   28.0   8.0   71    5-79      2-73  (211)
377 PRK11863 N-acetyl-gamma-glutam  94.3     0.5 1.3E-05   27.1   8.8  140    1-182     1-154 (314)
378 PRK12937 short chain dehydroge  94.2     0.5 1.3E-05   27.1   8.5   83    5-103     6-91  (245)
379 TIGR01724 hmd_rel coenzyme F42  94.2    0.44 1.1E-05   27.5   8.2  152   14-180    31-197 (341)
380 TIGR03026 NDP-sugDHase nucleot  94.2    0.51 1.3E-05   27.0   9.1   19   51-69     24-42  (411)
381 PRK08936 glucose-1-dehydrogena  94.1    0.53 1.3E-05   27.0   8.6   82    6-103     9-93  (261)
382 PRK00711 D-amino acid dehydrog  94.1   0.078   2E-06   33.1   4.2   32    5-36      2-33  (416)
383 TIGR01963 PHB_DH 3-hydroxybuty  94.1    0.45 1.1E-05   27.5   8.0  184   14-262    13-202 (258)
384 TIGR02415 23BDH acetoin reduct  94.1    0.38 9.6E-06   28.0   7.6   74   12-101    10-85  (258)
385 cd05294 LDH-like_MDH_nadp A la  94.1    0.55 1.4E-05   26.8   9.4  101    5-112     2-128 (309)
386 COG0190 FolD 5,10-methylene-te  94.0     0.4   1E-05   27.8   7.6   75    5-108   158-233 (283)
387 PRK08589 short chain dehydroge  93.9    0.57 1.5E-05   26.7   9.2   82    5-103     7-90  (272)
388 TIGR02354 thiF_fam2 thiamine b  93.9    0.37 9.6E-06   28.0   7.4  131    2-144    20-182 (200)
389 COG0289 DapB Dihydrodipicolina  93.9    0.59 1.5E-05   26.6   9.9  172    5-243     4-178 (266)
390 PRK07041 short chain dehydroge  93.9    0.59 1.5E-05   26.6   8.9   41    6-46     10-51  (240)
391 TIGR03364 HpnW_proposed FAD de  93.8   0.074 1.9E-06   33.3   3.6   32    5-36      2-33  (365)
392 TIGR01318 gltD_gamma_fam gluta  93.8   0.082 2.1E-06   32.9   3.8   34    4-37    144-177 (480)
393 PRK05557 fabG 3-ketoacyl-(acyl  93.8    0.62 1.6E-05   26.4   9.2   82    6-103     7-91  (248)
394 KOG1200 consensus               93.7    0.43 1.1E-05   27.6   7.4   35   13-47     25-59  (256)
395 TIGR00518 alaDH alanine dehydr  93.7    0.34 8.6E-06   28.4   6.8   99    3-103   168-268 (372)
396 KOG1399 consensus               93.7   0.076 1.9E-06   33.2   3.4   37    1-37      4-40  (448)
397 PRK11259 solA N-methyltryptoph  93.6   0.099 2.5E-06   32.3   4.0   34    3-36      3-36  (377)
398 PRK08849 2-octaprenyl-3-methyl  93.6    0.12   3E-06   31.8   4.3   35    1-35      1-35  (384)
399 PRK08374 homoserine dehydrogen  93.6    0.65 1.7E-05   26.3  11.0  142    1-183     1-149 (316)
400 cd05212 NAD_bind_m-THF_DH_Cycl  93.6     0.4   1E-05   27.8   7.0   94    4-133    29-123 (140)
401 pfam00670 AdoHcyase_NAD S-aden  93.5    0.67 1.7E-05   26.2   8.3   91    4-108    24-115 (162)
402 cd05313 NAD_bind_2_Glu_DH NAD(  93.5    0.68 1.7E-05   26.1  10.9  113    3-125    38-174 (254)
403 pfam03059 NAS Nicotianamine sy  93.5    0.68 1.7E-05   26.1   8.4   20   81-100   209-228 (277)
404 COG0300 DltE Short-chain dehyd  93.5    0.68 1.7E-05   26.1   8.9   85    3-102     6-91  (265)
405 pfam01266 DAO FAD dependent ox  93.5    0.11 2.8E-06   32.0   4.0   32    5-36      1-32  (309)
406 COG0039 Mdh Malate/lactate deh  93.4    0.31 7.9E-06   28.7   6.3  103    5-112     2-125 (313)
407 PRK07060 short chain dehydroge  93.4    0.37 9.4E-06   28.1   6.6   38   10-47     17-54  (245)
408 PRK02318 mannitol-1-phosphate   93.3    0.72 1.8E-05   25.9  10.5   41    6-46      3-44  (381)
409 cd01484 E1-2_like Ubiquitin ac  93.3     0.4   1E-05   27.9   6.6  125    5-134     1-129 (234)
410 COG2242 CobL Precorrin-6B meth  93.3    0.73 1.9E-05   25.9  10.2  117   10-133    44-165 (187)
411 PRK12744 short chain dehydroge  93.3    0.72 1.8E-05   26.0   7.9   80    6-103    10-97  (257)
412 PRK08416 7-alpha-hydroxysteroi  93.2    0.74 1.9E-05   25.9   8.7   79   10-103    16-95  (260)
413 pfam03720 UDPG_MGDP_dh_C UDP-g  93.2    0.53 1.3E-05   26.9   7.2   81   13-106    17-97  (99)
414 PRK12859 3-ketoacyl-(acyl-carr  93.2    0.75 1.9E-05   25.8  10.0   82    6-103     9-104 (257)
415 TIGR02352 thiamin_ThiO glycine  93.2    0.14 3.5E-06   31.2   4.2   36    6-41      1-36  (357)
416 PRK09880 L-idonate 5-dehydroge  93.2    0.75 1.9E-05   25.8  11.3   33    6-38    173-206 (343)
417 KOG3124 consensus               93.1    0.11 2.8E-06   32.0   3.5  162    5-181     2-174 (267)
418 PRK09126 hypothetical protein;  93.1    0.15 3.8E-06   31.0   4.2   37    1-37      1-37  (392)
419 PRK08220 2,3-dihydroxybenzoate  93.1    0.78   2E-05   25.7   8.6   74    6-103    10-85  (253)
420 PRK05086 malate dehydrogenase;  93.0    0.58 1.5E-05   26.7   7.1  102    5-112     2-125 (312)
421 PRK06125 short chain dehydroge  93.0    0.79   2E-05   25.7   8.9   38   10-47     15-52  (259)
422 PRK08300 acetaldehyde dehydrog  93.0     0.8   2E-05   25.6   8.4  124    1-163     2-143 (298)
423 TIGR00465 ilvC ketol-acid redu  93.0    0.46 1.2E-05   27.4   6.6   98    3-103     3-103 (344)
424 cd01338 MDH_choloroplast_like   93.0     0.8 2.1E-05   25.6  10.0  105    4-113     3-136 (322)
425 COG4221 Short-chain alcohol de  93.0    0.81 2.1E-05   25.6   9.0   72   13-102    17-88  (246)
426 PRK09072 short chain dehydroge  92.9    0.82 2.1E-05   25.5   9.2   80    5-103     7-87  (262)
427 TIGR01316 gltA glutamate synth  92.8    0.18 4.5E-06   30.5   4.2  143    2-161   141-306 (462)
428 PRK08017 short chain dehydroge  92.8    0.86 2.2E-05   25.4  10.3   79    1-102     1-81  (256)
429 TIGR01850 argC N-acetyl-gamma-  92.7     0.5 1.3E-05   27.2   6.4  211    5-226     2-234 (361)
430 PRK06701 short chain dehydroge  92.7    0.87 2.2E-05   25.4   8.6   81    6-102    47-130 (289)
431 KOG2653 consensus               92.7    0.71 1.8E-05   26.0   7.2  101  321-427   187-288 (487)
432 TIGR01983 UbiG ubiquinone bios  92.7    0.88 2.2E-05   25.3   9.1   97    6-106    86-198 (275)
433 TIGR01763 MalateDH_bact malate  92.7    0.88 2.3E-05   25.3   7.7  102    5-113     3-129 (308)
434 PRK06847 hypothetical protein;  92.6    0.13 3.4E-06   31.3   3.4   37    1-37      1-38  (375)
435 PRK07069 short chain dehydroge  92.6     0.9 2.3E-05   25.2   9.9   78   10-103     7-87  (251)
436 PRK08177 short chain dehydroge  92.6     0.9 2.3E-05   25.2   8.9   39    6-44      4-43  (225)
437 KOG1201 consensus               92.6     0.9 2.3E-05   25.2   7.7   39    8-46     43-82  (300)
438 PRK05442 malate dehydrogenase;  92.6     0.9 2.3E-05   25.2   9.9  109    1-114     1-139 (325)
439 PRK11728 hypothetical protein;  92.6   0.096 2.4E-06   32.4   2.6   36    1-37      1-38  (400)
440 TIGR02992 ectoine_eutC ectoine  92.5    0.24   6E-06   29.5   4.6   92    5-104   131-225 (326)
441 KOG3007 consensus               92.5    0.82 2.1E-05   25.5   7.3  113    6-127   141-260 (333)
442 PRK11036 putative metallothion  92.5    0.94 2.4E-05   25.1   9.8  145    8-164    48-201 (256)
443 pfam04016 DUF364 Domain of unk  92.5    0.94 2.4E-05   25.1   8.5  104    4-127   112-215 (229)
444 COG2227 UbiG 2-polyprenyl-3-me  92.4    0.94 2.4E-05   25.1   9.7   90   11-103    66-161 (243)
445 PRK06196 oxidoreductase; Provi  92.4    0.95 2.4E-05   25.1   9.0   69   13-101    37-105 (316)
446 cd05290 LDH_3 A subgroup of L-  92.4    0.95 2.4E-05   25.1  11.8   68    5-76      1-76  (307)
447 PRK08628 short chain dehydroge  92.4    0.96 2.4E-05   25.1   8.8   81    6-103     9-91  (258)
448 PRK06444 prephenate dehydrogen  92.4    0.96 2.4E-05   25.0   9.3  103    7-159     4-112 (197)
449 TIGR01809 Shik-DH-AROM shikima  92.3    0.42 1.1E-05   27.7   5.6   86    8-94    135-224 (291)
450 PRK12771 putative glutamate sy  92.2    0.23   6E-06   29.6   4.3   34    4-37    138-171 (560)
451 PRK13984 putative oxidoreducta  92.2    0.21 5.5E-06   29.8   4.0   34    4-37    284-317 (604)
452 PRK11908 NAD-dependent epimera  92.2       1 2.6E-05   24.9   8.9   71    1-76      1-76  (347)
453 PRK06475 salicylate hydroxylas  92.2    0.19 4.7E-06   30.3   3.7   36    2-37      1-36  (400)
454 PRK07208 hypothetical protein;  92.1    0.26 6.5E-06   29.3   4.3  187    1-245     1-193 (474)
455 TIGR03201 dearomat_had 6-hydro  92.0       1 2.7E-05   24.8  15.8   21  258-278   172-192 (349)
456 PRK13771 putative alcohol dehy  91.9     1.1 2.7E-05   24.7  13.1   19  260-278   171-189 (332)
457 PRK00377 cbiT cobalt-precorrin  91.9     1.1 2.8E-05   24.6  13.0  135   10-148    50-197 (198)
458 PRK12810 gltD glutamate syntha  91.8     0.3 7.6E-06   28.8   4.4   33    4-36    144-176 (472)
459 pfam00743 FMO-like Flavin-bind  91.8    0.27 6.8E-06   29.1   4.1   34    5-38      3-36  (532)
460 PRK07856 short chain dehydroge  91.7    0.71 1.8E-05   26.0   6.3   73    6-103    10-84  (254)
461 PRK06505 enoyl-(acyl carrier p  91.7     1.1 2.9E-05   24.5  10.2   80    6-102    10-92  (271)
462 PRK08013 hypothetical protein;  91.7    0.28 7.1E-06   29.0   4.1   36    1-36      1-36  (400)
463 PRK03815 murD UDP-N-acetylmura  91.7     1.1 2.9E-05   24.5   9.5  105    5-121     2-115 (401)
464 PRK12809 putative oxidoreducta  91.7    0.26 6.5E-06   29.3   3.9   33    4-36    311-343 (639)
465 COG1233 Phytoene dehydrogenase  91.6    0.34 8.8E-06   28.3   4.6   36    1-36      1-36  (487)
466 PRK12831 putative oxidoreducta  91.6     0.3 7.6E-06   28.8   4.2   33    4-36    141-173 (464)
467 PRK05868 hypothetical protein;  91.4    0.22 5.6E-06   29.7   3.4   35    1-37      1-35  (372)
468 PRK08303 short chain dehydroge  91.4     1.2 3.1E-05   24.3   8.4   91    5-102     9-102 (305)
469 PRK08278 short chain dehydroge  91.4     1.2 3.1E-05   24.3   8.7   88    5-103     7-98  (273)
470 PRK06185 hypothetical protein;  91.3    0.26 6.6E-06   29.2   3.7   37    1-37      4-40  (409)
471 PRK05884 short chain dehydroge  91.3     1.2 3.1E-05   24.2   8.3   36   10-45      8-43  (223)
472 PRK08664 aspartate-semialdehyd  91.3     1.2 3.2E-05   24.2   8.6  161    1-181     1-183 (350)
473 pfam04321 RmlD_sub_bind RmlD s  91.2     1.3 3.2E-05   24.2   8.1   95    8-128     3-98  (284)
474 PRK06813 homoserine dehydrogen  91.1       1 2.6E-05   24.9   6.5  103    1-127     1-121 (341)
475 PRK11749 putative oxidoreducta  91.1    0.38 9.7E-06   28.0   4.4   34    4-37    141-174 (460)
476 PRK06171 sorbitol-6-phosphate   91.1     1.3 3.3E-05   24.1   7.2   73    6-103    11-85  (266)
477 PRK12769 putative oxidoreducta  91.1    0.33 8.4E-06   28.5   4.0   34    4-37    328-361 (654)
478 PTZ00023 glyceraldehyde-3-phos  91.0    0.43 1.1E-05   27.6   4.6  165    1-197     1-177 (337)
479 COG0665 DadA Glycine/D-amino a  91.0    0.42 1.1E-05   27.7   4.5   36    1-36      2-37  (387)
480 PRK08415 enoyl-(acyl carrier p  90.9     1.3 3.4E-05   24.0  11.2   81    5-102     6-90  (274)
481 PRK08850 2-octaprenyl-6-methox  90.9    0.42 1.1E-05   27.7   4.4   35    1-35      2-36  (405)
482 PRK12814 putative NADPH-depend  90.9     0.4   1E-05   27.9   4.3   33    4-36    194-226 (652)
483 PRK13535 erythrose 4-phosphate  90.9    0.33 8.3E-06   28.5   3.9  164    5-198     3-180 (336)
484 PRK09853 putative selenate red  90.9     1.3 3.4E-05   24.0  11.9   33    4-36    551-583 (1032)
485 pfam01494 FAD_binding_3 FAD bi  90.9    0.28 7.2E-06   29.0   3.5   34    4-37      2-35  (349)
486 pfam08659 KR KR domain. This e  90.8     1.3 3.3E-05   24.1   6.8   80   10-102     8-88  (181)
487 PRK08163 salicylate hydroxylas  90.8    0.34 8.8E-06   28.3   3.9   37    1-37      1-38  (396)
488 PRK05854 short chain dehydroge  90.8     1.4 3.5E-05   23.9   8.6   76   13-102    25-100 (314)
489 COG1810 Uncharacterized protei  90.8     1.4 3.5E-05   23.9   9.6  131    1-162     1-134 (224)
490 TIGR01317 GOGAT_sm_gam glutama  90.8    0.37 9.5E-06   28.0   4.0   31    5-35    153-183 (517)
491 COG0026 PurK Phosphoribosylami  90.8    0.46 1.2E-05   27.4   4.5   36    4-39      2-37  (375)
492 cd00704 MDH Malate dehydrogena  90.7     1.4 3.5E-05   23.9  12.5  105    5-114     2-135 (323)
493 PRK07533 enoyl-(acyl carrier p  90.7     1.4 3.5E-05   23.9   9.4   79    6-101     9-90  (254)
494 PRK06617 2-octaprenyl-6-methox  90.7    0.41 1.1E-05   27.7   4.2   34    1-36      1-34  (374)
495 PRK08642 fabG 3-ketoacyl-(acyl  90.7     1.4 3.6E-05   23.8   9.9   79    6-103     9-90  (254)
496 PRK05599 hypothetical protein;  90.6     1.4 3.6E-05   23.8   8.1   80    6-101     3-83  (246)
497 PRK08020 ubiF 2-octaprenyl-3-m  90.6    0.43 1.1E-05   27.6   4.2   36    1-36      1-38  (391)
498 PRK01368 murD UDP-N-acetylmura  90.6     1.4 3.6E-05   23.8   9.6  121    3-131     6-140 (450)
499 PRK12748 3-ketoacyl-(acyl-carr  90.5     1.5 3.7E-05   23.7   8.8   96    1-101     3-101 (257)
500 PRK06935 2-deoxy-D-gluconate 3  90.4     1.5 3.8E-05   23.6   8.1   75   10-101    23-97  (258)

No 1  
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating; InterPro: IPR006113   6-Phosphogluconate dehydrogenase (1.1.1.44 from EC) (6PGD) is an oxidative carboxylase that catalyses the decarboxylating reduction of 6-phosphogluconate into ribulose 5-phosphate in the presence of NADP. This reaction is a component of the hexose mono-phosphate shunt and pentose phosphate pathways (PPP) , . Prokaryotic and eukaryotic 6PGD are proteins of about 470 amino acids whose sequence are highly conserved . The protein is a homodimer in which the monomers act independently : each contains a large, mainly alpha-helical domain and a smaller beta-alpha-beta domain, containing a mixed parallel and anti-parallel 6-stranded beta sheet . NADP is bound in a cleft in the small domain, the substrate binding in an adjacent pocket .    This model does not specify whether the cofactor is NADP only, NAD only, or both.; GO: 0004616 phosphogluconate dehydrogenase (decarboxylating) activity, 0050661 NADP binding, 0006098 pentose-phosphate shunt.
Probab=100.00  E-value=0  Score=1413.98  Aligned_cols=465  Identities=46%  Similarity=0.805  Sum_probs=455.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH--
Q ss_conf             056981571116889999978985999739989999999712211278403289899986057788999976990699--
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV--   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v--   82 (475)
                      +||||||+|||+|+|+|+.++||+|+|||||++||++|+++. ..++++.+++|++|||++|++||+||+||.+|++|  
T Consensus         1 diGviGLAVMG~NLaLN~~d~GF~V~VyNRt~~Ktd~fl~~~-~~gk~i~g~~~ieeFV~~Le~PRKImLMVkAG~pVda   79 (480)
T TIGR00873         1 DIGVIGLAVMGSNLALNMADHGFTVAVYNRTPEKTDEFLKER-AKGKKIVGAYSIEEFVQSLERPRKIMLMVKAGAPVDA   79 (480)
T ss_pred             CCCEEEECHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCC-CCCCCCCCCCCHHHHHHHCCCCCEEEEEEECCCCCCH
T ss_conf             951586041357899988746982799726847999998603-7888533432679999850688728887753885377


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             99999997207899899967986578999999999847994306754676000356843788454899988899999875
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSIS  162 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~ia  162 (475)
                      |+||++|+|+|++||||||+|||+|+||+||.++|+++||+||++||||||+|||+|||||+||++++|+.++|||++||
T Consensus        80 D~~I~~L~P~LE~GDiIIDGGNS~Y~DT~RR~~eL~~~Gi~FvG~GvSGGEeGAl~GPSiMPGG~~~Ay~~~~PIl~~IA  159 (480)
T TIGR00873        80 DAVINSLLPLLEKGDIIIDGGNSHYKDTERRYKELKAKGILFVGVGVSGGEEGALKGPSIMPGGSAEAYPLVAPILQKIA  159 (480)
T ss_pred             HHHHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             89999964435899888758878846657899999864981673013245302137887788879878999967887655


Q ss_pred             CCCC---CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             0156---7861898569874678988776787888999899999999642899789999998606884430799999999
Q gi|254780716|r  163 AKYQ---NSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI  239 (475)
Q Consensus       163 ak~~---~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~i  239 (475)
                      ||++   |+|||.|+||.||||||||||||||||+||+|||+|.|||++++|++++|+.||.+||+++|+|||||||++|
T Consensus       160 Akv~dPdg~PCC~wiG~~GAGHyVKMVHNGIEYGDMQLI~EAY~~lK~~L~L~~~~i~~vF~~WN~g~L~SYLIeIT~~I  239 (480)
T TIGR00873       160 AKVDDPDGEPCCTWIGPDGAGHYVKMVHNGIEYGDMQLIAEAYDILKEGLGLSNEEIAEVFTEWNNGELDSYLIEITADI  239 (480)
T ss_pred             HHCCCCCCCCCEEEECCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             42168532942243786798430532576711777989999999998651888889999985523777642688999998


Q ss_pred             HHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCCCC--CH
Q ss_conf             97405679995200102333658716778988775178885146777888775005779998752487-7666645--27
Q gi|254780716|r  240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNP-SSHFPLK--CF  316 (475)
Q Consensus       240 l~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~-~~~~~~~--~~  316 (475)
                      |++||+.||+||||+|+|.|+||||||||++.|||+|||+|.|.+|||||++|+.|++|.++++.++. +......  ++
T Consensus       240 L~~kD~~TG~pLvd~ILD~AgQKGTGkWT~~~ALd~G~P~tlI~EsVfAR~lSs~K~~R~~A~~~l~g~p~~~~~~~~D~  319 (480)
T TIGR00873       240 LAKKDEDTGKPLVDKILDTAGQKGTGKWTAIDALDLGVPLTLITESVFARYLSSLKEERVAASKLLSGDPLAEEKALQDK  319 (480)
T ss_pred             HHCCCCCCCCCEEHHEECCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH
T ss_conf             62135002751231100334688674157667653389820799999999884128999999973488965677863466


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHH
Q ss_conf             88999999999999999999999999961101456679889999851894685378999999987088852000798999
Q gi|254780716|r  317 DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSIS  396 (475)
Q Consensus       317 ~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~  396 (475)
                      +.||++||+|||+|+||||||||+||++||++|+|+||+++||.+||+||||||.||+.|++||+++|+|.||+++|+|.
T Consensus       320 ~~fi~~vr~ALY~sKI~SYAQGF~ll~~aS~~yGWdLnlg~IAliWRGGCIIRs~FL~~I~~Af~~~P~l~nLl~a~YF~  399 (480)
T TIGR00873       320 EEFIEDVRQALYASKIVSYAQGFMLLKEASEEYGWDLNLGEIALIWRGGCIIRSAFLDKIKKAFAANPNLANLLLAPYFK  399 (480)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             88999999998877799899989999999987288998135887763244256687678899987187730014576799


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEE-----EECCCCC--CCCCCCC
Q ss_conf             99995247699999999983998479999999998621788758999987610457322-----4248987--6356566
Q gi|254780716|r  397 EKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF-----DRKDKIS--EPHGPWQ  469 (475)
Q Consensus       397 ~~i~~~~~~lr~vv~~~i~~gip~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~-----~r~D~~g--~~H~~W~  469 (475)
                      +.+.+.+++||+||+.|++.|||+|||||||+|||+||+.+||+||+||||||||||||     ||+|+|+  .|||+|+
T Consensus       400 ~~l~~~~~gwR~vv~~A~~~GIP~Pafs~ALsfyDgYrta~LPaNL~QAQRDYFGAHTYr~lPeeR~D~prGEfFHT~W~  479 (480)
T TIGR00873       400 DALKDAQSGWRRVVAKAIELGIPVPAFSAALSFYDGYRTARLPANLLQAQRDYFGAHTYRVLPEERTDKPRGEFFHTNWT  479 (480)
T ss_pred             HHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEECCCCC
T ss_conf             99986215188999999853023578999999987665510157778675432012201116543678998854035778


Q ss_pred             C
Q ss_conf             3
Q gi|254780716|r  470 K  470 (475)
Q Consensus       470 ~  470 (475)
                      +
T Consensus       480 ~  480 (480)
T TIGR00873       480 G  480 (480)
T ss_pred             C
T ss_conf             9


No 2  
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=1219.07  Aligned_cols=468  Identities=41%  Similarity=0.736  Sum_probs=453.0

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             98805698157111688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      .|++|||||||+||.+||+||+++||+|+||||+++++++++++.+.....+.++.+++||++++++||+|++|||+|++
T Consensus         4 ~~~~IGiIGLGvMG~nmA~Nl~~~G~~V~vynrt~~k~~~~~~~~~~~~~~i~~~~sl~e~v~sl~~pr~Iilmv~aG~~   83 (474)
T PTZ00142          4 GESDIGLIGLAVMGQNLSLNMYSRGFKVSVYNRTTEKVEEFMKKAKEGNKFVKGYHSLEELVNSLKRPRRVMLLIKAGEA   83 (474)
T ss_pred             CCCCEEEEEEHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCEEEEEECCCHH
T ss_conf             76746687363867999999997898799977987999999985322467764667899999737999989998269825


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             99999999720789989996798657899999999984799430675467600035684378845489998889999987
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSI  161 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~i  161 (475)
                      ||+|+++|+|+|++||||||+||++|+||+||+++|+++||+|+|||||||++||++||||||||++++|++++|+|+++
T Consensus        84 Vd~vi~~L~~~L~~GDIIID~GNs~~~dt~rr~~~l~~kgI~fld~GVSGGe~GAr~GpsiMvGG~~~a~~~v~Pileai  163 (474)
T PTZ00142         84 VDEFIDNILPHLEKGDIIIDGGNEWYNNSERRIKLCKEKGILYIGMGVSGGEEGARYGPSLMPGGNPYAYDHVKDIFQAC  163 (474)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHCCCEECCCCCHHHHHHHHHHHHHH
T ss_conf             99999999850889998987998886579999999985799186478884357773398213588688999876899997


Q ss_pred             HCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             50156786189856987467898877678788899989999999964289978999999860688443079999999997
Q gi|254780716|r  162 SAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS  241 (475)
Q Consensus       162 aak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~  241 (475)
                      |+|++++|||.|+||.||||||||||||||||+||+|||+|++||++++++++++++||+.||+++++|||||||++||+
T Consensus       164 aak~~~~~c~~~~G~~GaGH~vKMVHNGIEY~~mq~iaE~y~il~~~~~~~~~~i~~vf~~Wn~g~l~syLieIt~~il~  243 (474)
T PTZ00142        164 SAKVGDSPCCDYVGPGSSGHYVKMVHNGIEYGDMQLISEAYKLMKHILGMSNLELSEVFNKWNEGILDSYLIEITADILA  243 (474)
T ss_pred             HCCCCCCCCEEEECCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             16169998710368987103100103540389999999999999873599989999999998376534799999999997


Q ss_pred             HC-CCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC--CCCCCHHH
Q ss_conf             40-5679995200102333658716778988775178885146777888775005779998752487766--66452788
Q gi|254780716|r  242 SS-DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSH--FPLKCFDS  318 (475)
Q Consensus       242 ~k-~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~~~--~~~~~~~~  318 (475)
                      +| |+.+|.|+||+|+|+|+|||||+||+++|+++|||+|+|++||+||++|++|++|++++++++.+..  ....+.+.
T Consensus       244 ~~~~~~~~~~~ld~I~d~a~~kGTG~Wt~~~al~lgvp~p~i~~av~aR~lS~~k~~R~~~s~~~~~~~~~~~~~~~~~~  323 (474)
T PTZ00142        244 KKKDELPNNHLVDKILDIAGQKGTGKWTAIEALDRGIPVPLIAESVDARCISALKEERVKASTHLTGPEANKKFTGDKEK  323 (474)
T ss_pred             HCCCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCHHH
T ss_conf             52368789824132005556887369899999980999279999999999753599999999743899754556555888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             99999999999999999999999996110145667988999985189468537899999998708885200079899999
Q gi|254780716|r  319 FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEK  398 (475)
Q Consensus       319 ~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~~~  398 (475)
                      ++++|++|+|||+||+|+|||+||+++|++|+|++|+++|+++||+||||||.||++|.++|+++|++.|||+++.|.+.
T Consensus       324 ~~~~l~~Aly~s~i~syaQGf~li~~as~~~~W~l~l~~ia~iWr~GCIIrs~lL~~i~~a~~~~~~l~nLl~~~~f~~~  403 (474)
T PTZ00142        324 FEEDLLQALYACKIISYAQGFFLMKEASKEFGWNLNLGEIALIWRGGCIIRSVFLGEISNAFKKNPQLDNLFLDPKFADV  403 (474)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHCCCCCHHHHCCHHHHHH
T ss_conf             99999999999999999999999999989850488889999987458763379899999998639981111137999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCC
Q ss_conf             99524769999999998399847999999999862178875899998761045732242489876356566
Q gi|254780716|r  399 VKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ  469 (475)
Q Consensus       399 i~~~~~~lr~vv~~~i~~gip~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D~~g~~H~~W~  469 (475)
                      +++++++||+||..|+++|||+|++||||+|||++|++++|+|||||||||||+|||||+|++|.||++|+
T Consensus       404 l~~~~~~lR~vV~~a~~~gIp~PalssaL~Y~d~~~~~~lpanLIQAQRD~FGaHty~R~D~~g~fH~~Ws  474 (474)
T PTZ00142        404 LKNKQPSWRKVVSMATLNGIPTPAFSASLAYYQMYRSQNLPANLVQAQRDYFGAHTYQRLDDPGNYHTNWT  474 (474)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEECCCCCCCCCCCC
T ss_conf             99988999999999997599778999999999996368865999999987424677144899998599999


No 3  
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]
Probab=100.00  E-value=0  Score=1224.68  Aligned_cols=473  Identities=47%  Similarity=0.806  Sum_probs=462.8

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             99880569815711168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      |++.+||+||||+||+|+|+|++++||+|+||||+++|+++|+++.+ ..+++.++.|++|||+++++||.|++||.+|.
T Consensus         1 ~~~~~iGviGLaVMG~NLaLNi~~~G~~VavyNRt~~ktd~f~~~~~-~~k~i~~~~sieefV~~Le~PRkI~lMVkAG~   79 (473)
T COG0362           1 MMKADIGVIGLAVMGSNLALNIADHGYTVAVYNRTTEKTDEFLAERA-KGKNIVPAYSIEEFVASLEKPRKILLMVKAGT   79 (473)
T ss_pred             CCCCCCCEEEHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHHCCCCEEEEEEECCC
T ss_conf             98661005731030277888887449669998087788999998275-68864566859999987158846999982699


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             99999999972078998999679865789999999998479943067546760003568437884548999888999998
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
                      +||+++++|+|+|++|||+||+||++|+||+||.++|+++|++|+++|||||++||++|||+|+||++++|+.++|+|++
T Consensus        80 ~VD~~I~~L~p~Le~gDIiIDGGNs~y~DT~RR~~eL~~~Gi~FvG~GVSGGEeGA~~GPSiMpGG~~eay~~v~pil~~  159 (473)
T COG0362          80 PVDAVIEQLLPLLEKGDIIIDGGNSHYKDTIRRNKELSEKGILFVGMGVSGGEEGARHGPSIMPGGQKEAYELVAPILTK  159 (473)
T ss_pred             CHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             27899999875257889898688767820789999988638848951666652100249876999998899999999999


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             75015678618985698746789887767878889998999999996428997899999986068844307999999999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL  240 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il  240 (475)
                      ||||++++|||.|+||.|+||||||||||||||+||+|||+|.+||++++++++||++||++||+++|+|||+|||++||
T Consensus       160 IaAk~~g~pCc~~iG~~GAGHfVKmVHNGIEYgDMQlIaE~Y~ilk~~lgls~~ei~~vF~~WN~geL~SYLIeIT~~IL  239 (473)
T COG0362         160 IAAKVDGEPCCTWIGPDGAGHFVKMVHNGIEYGDMQLIAEAYDILKDGLGLSAEEIAEVFEEWNKGELDSYLIEITADIL  239 (473)
T ss_pred             HHHHCCCCCCEEEECCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             87533999852537899977522101457148889999999999997549998999999998626760479999999998


Q ss_pred             HHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHH
Q ss_conf             74056799952001023336587167789887751788851467778887750057799987524877666645278899
Q gi|254780716|r  241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFV  320 (475)
Q Consensus       241 ~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~~~~~~~~~~~~i  320 (475)
                      ++||++++.||+|+|+|+|+|||||+||+++|+++|+|+|.|.+||+||++|+.|++|+.+++.++.++.....+++.|+
T Consensus       240 ~~kD~~~~kplvd~ILD~AgQKGTGkWt~~~AldlGvP~t~I~eaVfAR~lSs~K~eR~~Ask~l~~~~~~~~~dk~~fi  319 (473)
T COG0362         240 RKKDEEGGKPLVDKILDKAGQKGTGKWTVISALDLGVPLTLITEAVFARYLSSLKDERVAASKVLAGPKLGEPGDKEEFI  319 (473)
T ss_pred             HHCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHH
T ss_conf             64086668736999988734787654139879971998089999999999987589999998642899888887889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             99999999999999999999999611014566798899998518946853789999999870888520007989999999
Q gi|254780716|r  321 KDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVK  400 (475)
Q Consensus       321 ~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~~~i~  400 (475)
                      ++|++|+|+++|+||||||.+|++||++|+|++++++|+++||+||||||.||+.|.++|.++|++.||+++|+|.+.+.
T Consensus       320 ~~vr~ALy~sKI~sYAQGF~~l~~AS~e~gW~l~~~~iA~iWR~GCIIRs~FL~~I~~af~~~p~l~nLl~~pyF~~~~~  399 (473)
T COG0362         320 EDVRQALYASKIVSYAQGFALLRAASKEYGWDLNLGEIALIWRGGCIIRSKFLDKITDAFDENPELANLLLAPYFKSILE  399 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCEEHHHHHHHHHHHHHCCCCHHHHHCCHHHHHHHH
T ss_conf             99999999999999999999999999973999987899999826633429999999999863953354533799999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCC
Q ss_conf             52476999999999839984799999999986217887589999876104573224248987635656635456
Q gi|254780716|r  401 KTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE  474 (475)
Q Consensus       401 ~~~~~lr~vv~~~i~~gip~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D~~g~~H~~W~~~~~~  474 (475)
                      +.+++||++|+.+++.|||+|++||||+|||+||+.++|+|||||||||||||||+|+|++|.||++|++.+.+
T Consensus       400 ~~~~~~R~vV~~a~~~giP~P~~ssalsy~Dsyr~~~lpaNLiQAQRDyFGAHtyeR~D~~~~fHt~W~~~~~~  473 (473)
T COG0362         400 EYQQSLRRVVAYAVEAGIPVPAFSSALSYYDSYRTARLPANLIQAQRDYFGAHTYERTDKEGFFHTNWTGGGGN  473 (473)
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             88889999999998649983478989999887533236389999988761334313358887623576577899


No 4  
>PRK09287 6-phosphogluconate dehydrogenase; Validated
Probab=100.00  E-value=0  Score=1201.32  Aligned_cols=458  Identities=47%  Similarity=0.790  Sum_probs=447.4

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             11688999997898599973998999999971221127840328989998605778899997699069999999997207
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLL   93 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l   93 (475)
                      ||.|||+||+++||+|+||||+++++++++++++ ...++.++.+++||++++++||+|++|||+|++||+|+++|+|.|
T Consensus         1 MG~nlAlNl~~~G~~V~vynRt~~k~~~~~~~~~-~~~~~~~~~~l~e~v~sl~~PR~IilmV~aG~~vD~vI~~L~~~L   79 (459)
T PRK09287          1 MGKNLALNIASNGYTVAVYNRTPEKTDEFLAEEA-KGKKIVPAYTLEEFVASLEKPRKILLMVKAGAPVDAVIEQLLPLL   79 (459)
T ss_pred             CCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCC-CCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             9689999999789858997398899999998148-767850358999999736788879998168842999999998508


Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCC-CCCEEE
Q ss_conf             8998999679865789999999998479943067546760003568437884548999888999998750156-786189
Q gi|254780716|r   94 SPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQ-NSPCCA  172 (475)
Q Consensus        94 ~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaak~~-~~~cv~  172 (475)
                      ++||||||+||++|+||+||.++|+++||+|+|||||||++||++||||||||++++|++++|+|+++|+|++ +.|||.
T Consensus        80 ~~gDIiIDgGNS~y~dT~rR~~~l~~kgI~Flg~GVSGGe~GAr~GpSiM~GG~~~a~~~v~pile~iaak~~~g~pC~~  159 (459)
T PRK09287         80 EKGDIIIDGGNSNYTDTIRREKELAEKGIHFIGMGVSGGEEGALHGPSIMPGGQKEAYELVAPILEKIAAKVEDGEPCVT  159 (459)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHCCCEEECCCCCCCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             89998987999764337999999997599064578888745675397216789888999999999997520589997415


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCH
Q ss_conf             85698746789887767878889998999999996428997899999986068844307999999999740567999520
Q gi|254780716|r  173 LLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPII  252 (475)
Q Consensus       173 y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g~~li  252 (475)
                      |+||.||||||||||||||||+||+|||+|++||++++++++||++||++||+++++|||||||++||++||+++|.|+|
T Consensus       160 ~~G~~gaGHfvKMVHNGIEY~~MQ~iaE~y~~lk~~~~~~~~ei~~vF~~wn~g~l~SyLieIT~~il~~kd~~~g~~lv  239 (459)
T PRK09287        160 YIGPDGAGHYVKMVHNGIEYGDMQLIAEAYDLLKDGLGLSAEEIADVFAEWNKGELNSYLIEITADILRQKDEETGKPLV  239 (459)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             58999852288998701557889999999999987418998999999999846862269999999999851777798352


Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             01023336587167789887751788851467778887750057799987524877666645278899999999999999
Q gi|254780716|r  253 DVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTI  332 (475)
Q Consensus       253 d~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~~~~~~~~~~~~i~~L~~a~~~~~i  332 (475)
                      |+|+|+|+|||||+||+++|+++|||+|+|++||+||++|++|++|++++++++.+......+.+.++++|++|+|||+|
T Consensus       240 d~I~D~a~qkGTG~Wt~~~al~lgvp~p~I~~Av~aR~~S~~k~~R~~~~~~~~~~~~~~~~~~~~~i~~l~~Aly~ski  319 (459)
T PRK09287        240 DVILDKAGQKGTGKWTSQSALDLGVPLTLITEAVFARYLSSLKDQRVAASKLLSGPVAPFEGDKAEFIEDLRQALYASKI  319 (459)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             33125445787168799999980999289999999999853489999998643899765556788999999999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999611014566798899998518946853789999999870888520007989999999524769999999
Q gi|254780716|r  333 LSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVT  412 (475)
Q Consensus       333 ~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~~~i~~~~~~lr~vv~~  412 (475)
                      |||+|||+||+++|++|+|++|+++|+++||+||||||.||++|.++|+++|++.|||+++.|.+.+++++++||+||..
T Consensus       320 ~sYaQGf~li~~as~~~~W~l~l~~ia~iWr~GCIIRs~~L~~i~~af~~~~~l~nLl~~~~f~~~l~~~~~~lR~vV~~  399 (459)
T PRK09287        320 VSYAQGFALLRAASEEYGWDLNLGEIARIWRGGCIIRAQFLQKITDAYEKNPDLANLLLDPYFKDILKEYQDALRRVVAT  399 (459)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCEEEHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999985568888999998606877538889999999961998411013799999999988999999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             998399847999999999862178875899998761045732242489876356566354
Q gi|254780716|r  413 CTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS  472 (475)
Q Consensus       413 ~i~~gip~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D~~g~~H~~W~~~~  472 (475)
                      |+++|||+|+|||||+|||++|++++|+|||||||||||+|||+|+|++|.||++|++++
T Consensus       400 ai~~gip~PalssaL~Y~d~~r~~~lpanLIQAQRDyFGaHty~r~D~~g~fH~~W~~~~  459 (459)
T PRK09287        400 AVEAGIPVPAFSSALSYYDSYRTARLPANLIQAQRDYFGAHTYERTDKEGGFHTEWSEEG  459 (459)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEECCCCCCCCCCCCCCC
T ss_conf             997599778999999999986168875999999998624677256899998178899997


No 5  
>KOG2653 consensus
Probab=100.00  E-value=0  Score=1114.28  Aligned_cols=472  Identities=42%  Similarity=0.740  Sum_probs=455.2

Q ss_pred             CCC---CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998---80569815711168899999789859997399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQ---ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k---~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |.+   .+||+|||++||+|+++|++++||.|.+|||+.+|+++|+++.++ ..++.++.|++|||.++++||+|+++|.
T Consensus         1 m~q~~~~digLiGLaVMGqnLiLN~~d~Gf~v~~yNRT~skvD~flaneak-~~~i~ga~S~ed~v~klk~PR~iillvk   79 (487)
T KOG2653           1 MSQTPKADIGLIGLAVMGQNLILNIADKGFTVCAYNRTTSKVDEFLANEAK-GTKIIGAYSLEDFVSKLKKPRVIILLVK   79 (487)
T ss_pred             CCCCCCCCEEEHHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHC-CCCCCCCCCHHHHHHHCCCCCEEEEEEE
T ss_conf             997764410001166502455200104683589864614768899986524-9812586888999976378748999960


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             90699999999972078998999679865789999999998479943067546760003568437884548999888999
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENI  157 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~pi  157 (475)
                      +|++||..+++|.|+|++||||||+||++|+||.||.++++++|+-|++||||||++|||.|||+|+||++++|..+++|
T Consensus        80 AG~pVD~~I~~L~p~LekgDiIIDGGNs~y~dT~RR~~el~k~GilfvG~GVSGGEEGAR~GPSlMpGg~~~Awp~ik~i  159 (487)
T KOG2653          80 AGAPVDQFIEELVPYLEKGDIIIDGGNSEYQDTERRCRELAKKGILFVGSGVSGGEEGARYGPSLMPGGSKEAWPHIKDI  159 (487)
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             79818999999986447898898488654764378899999668569844766764222248866889896787878999


Q ss_pred             HHHHHCCC-CCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             99875015-67861898569874678988776787888999899999999642899789999998606884430799999
Q gi|254780716|r  158 LLSISAKY-QNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT  236 (475)
Q Consensus       158 L~~iaak~-~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~  236 (475)
                      |+.+|+++ +++|||.|+|+.||||||||||||||||+||+|||+|++||+.++++++||+++|++||++++.|||+|||
T Consensus       160 fq~iaakv~~~epCc~wvG~~GaGhfVKMVHNGIEYGDMqLI~EaY~vlk~~~gls~~eia~vF~~WN~geleSfLieIT  239 (487)
T KOG2653         160 FQKIAAKVSDGEPCCDWVGEGGAGHFVKMVHNGIEYGDMQLICEAYDVLKSVLGLSNDEIAEVFDDWNKGELESFLIEIT  239 (487)
T ss_pred             HHHHHHHHCCCCCCEEEECCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             99998885399988354468887630145326743113899999999999845866788999997643331668999986


Q ss_pred             HHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC--CC
Q ss_conf             9999740567999520010233365871677898877517888514677788877500577999875248776666--45
Q gi|254780716|r  237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFP--LK  314 (475)
Q Consensus       237 ~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~~~~~--~~  314 (475)
                      ++||+.+|+ .|.||+|+|.|+++|||||+||++.|+|+|+|+|.|.+||++|++|..|++|+.+++.++.+....  ..
T Consensus       240 ~dIlk~~d~-~G~~lv~kI~D~aGqKGTGkwt~~~Ale~g~Pv~lI~eavfaRclS~lKdeR~~ask~L~gp~~~~~~~~  318 (487)
T KOG2653         240 ADILKFKDE-DGKPLVDKILDKAGQKGTGKWTVISALELGVPVTLIGEAVFARCLSALKDERVRASKVLKGPGVKRDMGD  318 (487)
T ss_pred             HHHHCEECC-CCCCHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH
T ss_conf             887600056-7871689998641687762899998998189717999999999998877888889875569997544455


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             27889999999999999999999999999611014566798899998518946853789999999870888520007989
Q gi|254780716|r  315 CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPS  394 (475)
Q Consensus       315 ~~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~  394 (475)
                      ++..|++++++|+|+++||||+|||+||++++++|+|++|+++|+++||+||||||.||+.|.++|.++|+|+||+++++
T Consensus       319 ~k~~~~dd~r~alYaskiiSyaQGfmLlr~aa~e~gW~ln~~~iAlmWrgGCIIRsvfL~~I~~a~~~~p~l~nll~d~f  398 (487)
T KOG2653         319 DKKQFLDDIRQALYASKIISYAQGFMLLREAAKEKGWKLNNGGIALMWRGGCIIRSVFLDRIKKAYQRNPDLANLLLDPF  398 (487)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCEEEEHHHHHHHHHHHHCCCCHHHHCCCHH
T ss_conf             68999999999999999999998899999999971998771689999738807627889999998752942664106889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCC-CCCCCCCCCCC
Q ss_conf             99999952476999999999839984799999999986217887589999876104573224248987-63565663545
Q gi|254780716|r  395 ISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKIS-EPHGPWQKVST  473 (475)
Q Consensus       395 ~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D~~g-~~H~~W~~~~~  473 (475)
                      |.+.+.+.+.+||++|..++..|||+|++|+||+|||+||++++|+||+||||||||||||++++++| .+|++|++.+.
T Consensus       399 F~~~v~~~q~~wr~vV~~a~~~gIptP~~st~Lafydgyr~e~lpaNllQAqRDYFGAHtye~l~~~~~~~HtnWtg~gg  478 (487)
T KOG2653         399 FAKAVEEAQDSWRRVVALAVEAGIPTPAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTYELLGEPGKAIHTNWTGHGG  478 (487)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCEEEECCCCCCEEEEEECCCCC
T ss_conf             99999999999999999998518897057778998710123017477999988862301266537776435532105577


Q ss_pred             C
Q ss_conf             6
Q gi|254780716|r  474 E  474 (475)
Q Consensus       474 ~  474 (475)
                      .
T Consensus       479 ~  479 (487)
T KOG2653         479 N  479 (487)
T ss_pred             C
T ss_conf             6


No 6  
>pfam00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain. This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each.
Probab=100.00  E-value=0  Score=790.37  Aligned_cols=289  Identities=43%  Similarity=0.757  Sum_probs=280.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCC
Q ss_conf             67898877678788899989999999964289978999999860688443079999999997405679995200102333
Q gi|254780716|r  180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKA  259 (475)
Q Consensus       180 Gh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g~~lid~i~d~~  259 (475)
                      ||||||||||||||+||+|||+|++||++++++++||++||++||+|+++|||||||++||++||+ +|.|++|+|+|+|
T Consensus         1 GH~vKMvHNgIEY~~mq~iaE~y~~l~~~~~~~~~~i~~vf~~wn~g~l~syLieit~~il~~kd~-~~~~~~d~I~D~A   79 (290)
T pfam00393         1 GHYVKMVHNGIEYGDMQLIAEAYDLLKTVLGLSNDEIADVFEEWNKGELDSYLIEITADILRKKDE-DGKPLVDKILDKA   79 (290)
T ss_pred             CCCCCEEECHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCC-CCCCCHHHHCCCC
T ss_conf             985161115098999999999999999853999999999999980786330799999999985488-9990425541543


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65871677898877517888514677788877500577999875248776-66645278899999999999999999999
Q gi|254780716|r  260 SQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQG  338 (475)
Q Consensus       260 ~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~~-~~~~~~~~~~i~~L~~a~~~~~i~syaQG  338 (475)
                      +|||||+||+++|+++|||+|+|++||+||++|++|++|+++++.++.+. .....+.+.++++|++|+||+++|||+||
T Consensus        80 ~qKGTG~Wt~~~al~lgvp~p~i~~Av~aR~lS~~k~~R~~~s~~~~~~~~~~~~~~~~~~i~~L~~Aly~s~i~syaQG  159 (290)
T pfam00393        80 GQKGTGKWTVQSALELGVPVPLITEAVFARYLSSLKEERVAASKVLSGPKAAKDKGDKAEFIEDVRQALYASKIVSYAQG  159 (290)
T ss_pred             CCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             57884688999999809992799999999998612277789888628996455654378999999999999999999999


Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999611014566798899998518946853789999999870888520007989999999524769999999998399
Q gi|254780716|r  339 FWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY  418 (475)
Q Consensus       339 f~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~~~i~~~~~~lr~vv~~~i~~gi  418 (475)
                      |+||+++|++|+|++|+++|+++||+||||||.||++|.++|+++|++.|||+++.|.+.+++++++||+||..|+++||
T Consensus       160 f~li~~as~~~~W~lnl~~Ia~iWr~GCIIRs~lL~~i~~a~~~~~~l~nLl~~~~f~~~l~~~~~~lR~vV~~ai~~gi  239 (290)
T pfam00393       160 FMLLRAASKEYGWNLNLGEIARIWRGGCIIRAQFLDKIKDAYEKNPDLPNLLLDPYFKKEIKEYQQSWRRVVAIAVEAGI  239 (290)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCCEEEHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999982778888999998558866549989999999854997312013599999999999999999999998599


Q ss_pred             CHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCC
Q ss_conf             847999999999862178875899998761045732242489876356566
Q gi|254780716|r  419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ  469 (475)
Q Consensus       419 p~P~lsssL~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D~~g~~H~~W~  469 (475)
                      |+|++||||+|||+++++++|+|||||||||||+|||||+|++|.||++|+
T Consensus       240 P~PalSsaL~Y~d~~~~~~lpanLIQAQRDyFGaHtyeR~D~~g~fH~~W~  290 (290)
T pfam00393       240 PVPAFSSALSYYDSYRTERLPANLIQAQRDYFGAHTYERTDKEGFFHTNWT  290 (290)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCC
T ss_conf             838899999999985247883899999998722677257899988289999


No 7  
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=100.00  E-value=0  Score=628.53  Aligned_cols=276  Identities=35%  Similarity=0.607  Sum_probs=260.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +|||||||+||.+||+||+++||+|+||||++++++++.+++      ..++.+++|+++++++||+||+|||++++|++
T Consensus         2 kIGfIGLG~MG~~mA~nL~~~G~~V~v~dr~~~~~~~~~~~g------a~~~~s~~e~~~~~d~prvI~l~lp~~~~Vd~   75 (301)
T PRK09599          2 QLGMIGLGRMGGNMARRLLRGGHEVVGYDRNPEAVEALAAEG------ATGAASLEELVAKLPAPRVVWLMVPAGEITDS   75 (301)
T ss_pred             EEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCC------CEECCCHHHHHHHCCCCCEEEEECCCCHHHHH
T ss_conf             799983458799999999968990799769999999999859------94329999999707888779998179703899


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             99999720789989996798657899999999984799430675467600035684378845489998889999987501
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK  164 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaak  164 (475)
                      |++++.+.|++|+||||+||++|++|++++++++++|++|+|||||||+.||++|+++||||++++|++++|+|++||++
T Consensus        76 Vi~~l~~~l~~g~iiID~sts~~~~t~~~a~~l~~~gi~flDapVSGG~~gA~~GlsiMvGG~~~~~e~~~Pil~aia~~  155 (301)
T PRK09599         76 TIDELAPLLEAGDIVIDGGNSYYKDDIRRAELLAEKGIHFVDVGTSGGVWGLERGYCLMIGGDKEAVERLEPIFKALAPR  155 (301)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHCCCEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             99999962789988870899983889999999998599454476678877885586133069899999989999998334


Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHC
Q ss_conf             567861898569874678988776787888999899999999642899789999998606884-4307999999999740
Q gi|254780716|r  165 YQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSSS  243 (475)
Q Consensus       165 ~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~k  243 (475)
                      +.  +|+.|+||.|||||||||||||||++||+|||+|++|++. +++. ++.+||+.||+|+ ++|||+|||+++|+++
T Consensus       156 ~~--~~~~~~G~~GaGh~vKmVhNgIey~~mq~iaE~~~ll~~~-~~~~-d~~~v~~~w~~g~~~~S~L~ei~~~~l~~~  231 (301)
T PRK09599        156 AE--DGYLHAGPVGAGHFVKMVHNGIEYGMMQAYAEGFELLEAS-RFDL-DLAAVAEVWRRGSVIRSWLLDLTADALAED  231 (301)
T ss_pred             CC--CCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCC-CHHHHHHHHHCCCCHHHHHHHHHHHHHHCC
T ss_conf             57--7804578988238999999999999999999999999866-7887-899999998568821138999999997118


Q ss_pred             CCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             56799952001023336587167789887751788851467778887750057
Q gi|254780716|r  244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD  296 (475)
Q Consensus       244 ~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~  296 (475)
                            +.+|.|.|++++||||+||+++|+++|||+|+|++||++|+.|..++
T Consensus       232 ------~~ld~i~~~~~~~gtG~wt~~~a~~lgvp~p~i~~a~~aR~~S~~~~  278 (301)
T PRK09599        232 ------PKLDEISGYVADSGEGRWTVEAAIELGVPAPVIAAALFARFRSRQED  278 (301)
T ss_pred             ------CCHHHHCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             ------85422146126787189999999985998589999999999846676


No 8  
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=100.00  E-value=0  Score=606.35  Aligned_cols=275  Identities=34%  Similarity=0.608  Sum_probs=259.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +|||||||+||.+||+||+++||+|++|||++++++.+.+.+      +.++.+++|++++++.||+||+|||++++|++
T Consensus         2 kIGfIGLG~MG~~mA~nL~~~G~~V~v~d~~~~~~~~~~~~g------~~~~~s~~e~~~~l~~~~vI~~~vp~g~~v~~   75 (298)
T PRK12490          2 KLGLIGLGKMGGNMAERLREDGHEVVGYDVNQEAVDVAGKLG------ITARHSLEELVSKLEAPRAIWVMVPAGEVTES   75 (298)
T ss_pred             EEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCC------CEECCCHHHHHHHCCCCCEEEEECCCCHHHHH
T ss_conf             799983467689999999977994899849989999999869------95428999999737899889997689455999


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             99999720789989996798657899999999984799430675467600035684378845489998889999987501
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK  164 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaak  164 (475)
                      |++++.+.|++|++|||+||++|+++++++++++++|++|+|||||||+.||++|+|+|+||++++|++++|+|++|+++
T Consensus        76 vi~~l~~~L~~g~iiID~sts~~~~t~~~~~~l~~~gi~flDapVSGG~~GA~~GlsiMvGG~~~~~~~~~pil~~ia~~  155 (298)
T PRK12490         76 VLKDLYPLLSPGDIVIDGGNSRYKDDLRRAEELAERGIHYVDCGTSGGVWGLRNGYCLMVGGDKEIYDRLEPVFDALAPE  155 (298)
T ss_pred             HHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHCCCEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             99968852699988852887899999999999997599030553578878996698685189999999999999996674


Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHC
Q ss_conf             567861898569874678988776787888999899999999642899789999998606884-4307999999999740
Q gi|254780716|r  165 YQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSSS  243 (475)
Q Consensus       165 ~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~k  243 (475)
                      ..    +.|+||.|||||||||||+|||++||++||+|++|++. +++. ++.+||+.||+|. ++|||+|||+++|.. 
T Consensus       156 ~~----~~~~G~~GsGh~vKmvnN~Iey~~mq~iaEa~~l~~~~-~~~~-d~~~v~~~w~~G~~~~S~L~ei~~~~l~~-  228 (298)
T PRK12490        156 NG----YVHAGPVGSGHFLKMVHNGIEYGMMQAYAEGFELLDKS-DFDF-DVEDVARVWANGSVIRSWLLDLTVKALAE-  228 (298)
T ss_pred             CC----CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCC-CHHHHHHHHHCCCHHHHHHHHHHHHHHCC-
T ss_conf             58----57208987538899999999999999999999999867-9988-89999999957762666999999998545-


Q ss_pred             CCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             567999520010233365871677898877517888514677788877500577
Q gi|254780716|r  244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE  297 (475)
Q Consensus       244 ~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~  297 (475)
                           +|.+|.|+|.+++||||+||+++|+++|||+|+|++||++|+.|..++.
T Consensus       229 -----~~~l~~i~~~~~~~Gtg~wt~~~A~~lgvp~P~i~~Al~~R~~S~~~~~  277 (298)
T PRK12490        229 -----DPKLSGIKGYMNDSGEGRWTVEEAIELAVAAPVIAASLFMRFASQEDDS  277 (298)
T ss_pred             -----CCCHHHCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             -----9974332663368895199999999839991699999999998657886


No 9  
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849   This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues. Among complete genomes, it is found is found in Bacillus subtilis and Mycobacterium tuberculosis, both of which also contain Gnd, and in Aquifex aeolicus. .
Probab=100.00  E-value=0  Score=599.50  Aligned_cols=322  Identities=33%  Similarity=0.602  Sum_probs=286.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             056981571116889999978985999739989999999-7122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-KKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~-~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +||+||||.||.|++++|.+.||+|++||++++.++++. +..      ...+.++.|+.+.|..||+||+|||++.+|+
T Consensus         3 tlglIGLGrMG~ni~~rl~~rgh~~vgYd~~q~av~~~kG~d~------~~gv~nl~E~~~~l~~Pr~vWvMVPhgnivd   76 (341)
T TIGR00872         3 TLGLIGLGRMGANIAKRLADRGHEVVGYDRDQAAVEELKGEDR------AEGVANLKELLKRLSAPRVVWVMVPHGNIVD   76 (341)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCC------CCCCHHHHHHHHCCCCCCEEEEECCCCHHHH
T ss_conf             2443133467899999985279469985388799999720113------4300124788841799958998628736799


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHC
Q ss_conf             99999972078998999679865789999999998479943067546760003568437884548999888999998750
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISA  163 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaa  163 (475)
                      +|++.|.|.|++||+|||+|||+|+|++||+++++++||+|||||+|||..|+++|.|||+|||.|+|++++|+|+++|.
T Consensus        77 aVl~~l~p~L~kGD~vIdgGNsyYkds~Rry~~lke~gih~LD~GtSGG~~G~~~G~cfMiGGD~eaf~~~EplF~tvaP  156 (341)
T TIGR00872        77 AVLRELAPLLEKGDIVIDGGNSYYKDSLRRYKELKEKGIHYLDVGTSGGVLGKERGYCFMIGGDEEAFKKAEPLFKTVAP  156 (341)
T ss_pred             HHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCEEEECCCHHHHHHHCHHHHHCCC
T ss_conf             99997666764088898278651233478887688718756534545772304464147751847999762214432066


Q ss_pred             CCC--------------CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCCC
Q ss_conf             156--------------786189856987467898877678788899989999999964-28997899999986068844
Q gi|254780716|r  164 KYQ--------------NSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSKWDTGKL  228 (475)
Q Consensus       164 k~~--------------~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~w~~~~~  228 (475)
                      .+.              .+..+.|+|++|||||+||||||||||||.+|||+|++|+++ .+          .+-++++.
T Consensus       157 GvaaaPrtPGrdGd~A~ee~GYly~G~~GsGHF~KMvHNGIEYG~MaaiaEGfe~L~nsdvG----------trvqhGda  226 (341)
T TIGR00872       157 GVAAAPRTPGRDGDVAVEEKGYLYLGEAGSGHFVKMVHNGIEYGMMAAIAEGFEVLKNSDVG----------TRVQHGDA  226 (341)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCC----------CCEECCCC
T ss_conf             52137888788776062567615545878766302222451388899998778987524655----------50003754


Q ss_pred             CHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             30799999999974056799952001023336587167789887751788851467778887750057799987524877
Q gi|254780716|r  229 SSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPS  308 (475)
Q Consensus       229 ~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~~~~~~  308 (475)
                                       ++                             .|.|                            
T Consensus       227 -----------------et-----------------------------aPlP----------------------------  232 (341)
T TIGR00872       227 -----------------ET-----------------------------APLP----------------------------  232 (341)
T ss_pred             -----------------CC-----------------------------CCCC----------------------------
T ss_conf             -----------------46-----------------------------7887----------------------------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCC
Q ss_conf             66664527889999999999999999999999999611014566798899998518946853789999999870888520
Q gi|254780716|r  309 SHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTN  388 (475)
Q Consensus       309 ~~~~~~~~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~  388 (475)
                        +                                  .+-|.||+|+++||+||+.|++||||||+++.+||.++++|+ 
T Consensus       233 --n----------------------------------PeCyqfDfD~~eVArVw~~GSVIrSwL~dLt~~Af~~~~dL~-  275 (341)
T TIGR00872       233 --N----------------------------------PECYQFDFDLEEVARVWRRGSVIRSWLLDLTAKAFEESADLE-  275 (341)
T ss_pred             --C----------------------------------CCCCCCCCCHHHHHHHHCCCCEEEHHHHHHHHHHHHCCCCCC-
T ss_conf             --7----------------------------------877777687488999870898641268889999975078821-


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHHHCCCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             007989999999524769999999998399847999999-99986217887589999876104573224248
Q gi|254780716|r  389 LLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAAL-SYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD  459 (475)
Q Consensus       389 Ll~~~~~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL-~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D  459 (475)
                           .|...+++..++ ||+|..|++.++|+||++.|| ..|.|...+.+..+.+.|+|..||.|..+..|
T Consensus       276 -----~~~G~v~dSGEG-rWtv~~a~dlg~p~PVia~sl~~Rf~Sr~~D~F~nKvlaalR~eFGgHa~kkk~  341 (341)
T TIGR00872       276 -----EVEGIVEDSGEG-RWTVKEAVDLGVPIPVIATSLYERFASREKDDFKNKVLAALRKEFGGHAEKKKD  341 (341)
T ss_pred             -----CEEEEECCCCCC-HHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCCCCCC
T ss_conf             -----322367027872-789999886278824899999987402345663552443104442755677889


No 10 
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]
Probab=100.00  E-value=0  Score=561.48  Aligned_cols=274  Identities=38%  Similarity=0.644  Sum_probs=256.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +||+||||.||.||++||.+.|++|++||++++.++++.+++      ++++.|+.+|++.|..||+||+|||++.+|++
T Consensus         2 ~iGmiGLGrMG~n~v~rl~~~ghdvV~yD~n~~av~~~~~~g------a~~a~sl~el~~~L~~pr~vWlMvPag~it~~   75 (300)
T COG1023           2 QIGMIGLGRMGANLVRRLLDGGHDVVGYDVNQTAVEELKDEG------ATGAASLDELVAKLSAPRIVWLMVPAGDITDA   75 (300)
T ss_pred             CCEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCC------CCCCCCHHHHHHHCCCCCEEEEECCCCCCHHH
T ss_conf             011540005269999999838972899738889999998657------75436799999746987479997337773689


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             99999720789989996798657899999999984799430675467600035684378845489998889999987501
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK  164 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~iaak  164 (475)
                      |++.|.|.|++||+|||+|||+|+|+.||+++++++||+|+|||+|||+.|++.|.|+|+||++++|++++|+|+++|..
T Consensus        76 vi~~la~~L~~GDivIDGGNS~y~Ds~rr~~~l~~kgi~flD~GTSGG~~G~~~G~~lMiGG~~~a~~~~~pif~~lA~g  155 (300)
T COG1023          76 VIDDLAPLLSAGDIVIDGGNSNYKDSLRRAKLLAEKGIHFLDVGTSGGVWGAERGYCLMIGGDEEAVERLEPIFKALAPG  155 (300)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHCCCEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             99998853678888987886325778999998876597178346777722553572388538689999988999862768


Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHH
Q ss_conf             56786189856987467898877678788899989999999964-2899789999998606884-430799999999974
Q gi|254780716|r  165 YQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSS  242 (475)
Q Consensus       165 ~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~  242 (475)
                      -   ..+.||||+|||||||||||||||||||+|||+|+||+++ +.++.+++++|   ||+|. ++||||++|++.|++
T Consensus       156 e---~Gyl~~Gp~GsGHfvKMVHNGIEYGmM~a~aEGfelL~~s~fD~D~~~VA~v---W~hGSVIrSWLldLt~~Af~~  229 (300)
T COG1023         156 E---DGYLYCGPSGSGHFVKMVHNGIEYGMMQAIAEGFELLKNSPFDYDLEAVAEV---WNHGSVIRSWLLDLTAEAFKK  229 (300)
T ss_pred             C---CCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHH---HHCCCHHHHHHHHHHHHHHHH
T ss_conf             6---7630016887623289985108999999999899998718888777999999---827645999999999999854


Q ss_pred             CCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             056799952001023336587167789887751788851467778887750057
Q gi|254780716|r  243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD  296 (475)
Q Consensus       243 k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~  296 (475)
                      .      +-+|.|.+.+.+.|+|+||+++|+|+|||+|+|+.|++.||.|...+
T Consensus       230 d------~~L~q~~g~v~dSGEGrWTv~~aldlgvpaPVia~al~~Rf~S~~~d  277 (300)
T COG1023         230 D------PDLDQISGRVSDSGEGRWTVEEALDLGVPAPVIALALMMRFRSRQDD  277 (300)
T ss_pred             C------CCHHHHCCEECCCCCCEEEHHHHHHCCCCCHHHHHHHHHHHHCCCHH
T ss_conf             8------88777617634588750666877763898159999999997503224


No 11 
>PRK11559 garR tartronate semialdehyde reductase; Provisional
Probab=100.00  E-value=1.4e-45  Score=356.66  Aligned_cols=254  Identities=22%  Similarity=0.347  Sum_probs=219.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +|||||||+||.+||+||+++||+|.||||+++++++|.+.++      ..+.|++|++...+   +||+|||++++|++
T Consensus         3 kIgfIGlG~MG~~ma~~L~~~G~~v~v~dr~~~~~~~l~~~Ga------~~~~s~~e~~~~~d---vvi~~l~~~~~v~~   73 (295)
T PRK11559          3 KVGFIGLGIMGKPMSKNLLKAGYSLVVYDRNPEAIADVIAAGA------ETASTAKAIAEQCD---VIITMLPNSPHVKE   73 (295)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC------CCCCCHHHHHHCCC---EEEEECCCCCCHHH
T ss_conf             8999840576999999999789958999299999999998599------20399999984388---78996689810776


Q ss_pred             HH---HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHHHHH
Q ss_conf             99---999720789989996798657899999999984799430675467600035684-37884548999888999998
Q gi|254780716|r   85 LI---DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        85 vi---~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~piL~~  160 (475)
                      |+   +++++.+.+|+++||+||++|.++++++++++++|++|+|||||||+.+|++|. ++|+||++++|++++|+|+.
T Consensus        74 v~~g~~gi~~~~~~g~iiid~sT~~p~~~~~~a~~~~~~g~~~lDaPVsGg~~~A~~G~L~~mvgG~~~~~~~~~piL~~  153 (295)
T PRK11559         74 VALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIEMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKA  153 (295)
T ss_pred             HHHCCCCCHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHCCCEEEECCCHHHHHHHHHHHHC
T ss_conf             63077660113899988998999999999999999996598389424768868898488149967988999999999942


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             75015678618985698746789887767878889998999999996428997899999986068844307999999999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL  240 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il  240 (475)
                      |+.+      +.|+|+.|+||.+||+||.+.++.+++++|++.+.++ .+++++.+.+++   +.+..+|+.++.....+
T Consensus       154 ~~~~------i~~~G~~G~g~~~Kl~nN~l~~~~~~a~aEal~la~k-~Gld~~~~~~vl---~~~~~~S~~~~~~~p~~  223 (295)
T PRK11559        154 MAGS------VVHTGEIGAGNVTKLANQVIVALNIAAMSEALTLATK-AGVNPDLVYQAI---RGGLAGSTVLDAKAPMV  223 (295)
T ss_pred             CCCC------EEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHH---HCCCCCCHHHHHHCCHH
T ss_conf             6556------0342894589999999999999999999999999998-599999999999---73765787886016012


Q ss_pred             HHCCCCCCCCCHHH-CCCCCCCCCHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             74056799952001-0233365871677898877517888514677
Q gi|254780716|r  241 SSSDTITGMPIIDV-ICDKASQKGTGIRSIIEGHKLSSSMTITETA  285 (475)
Q Consensus       241 ~~k~~~~g~~lid~-i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~a  285 (475)
                      ...|-..+ +-++. .+|       -.-..+.|-++|+|.|+...+
T Consensus       224 l~~d~~~~-f~l~l~~KD-------l~l~~~~a~~~g~~lp~~~~~  261 (295)
T PRK11559        224 MDRNFKPG-FRIDLHIKD-------LANALDTSHGVGAQLPLTAAV  261 (295)
T ss_pred             HCCCCCCC-CCHHHHHHH-------HHHHHHHHHHCCCCCHHHHHH
T ss_conf             23799998-858999989-------999999999709998499999


No 12 
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548   3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway.    In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators .    3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterised 3-hydroxyisobutyrate dehydrogenase from rat liver  with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31).    This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate . HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase. ; GO: 0008442 3-hydroxyisobutyrate dehydrogenase activity, 0051287 NAD binding.
Probab=100.00  E-value=0  Score=360.62  Aligned_cols=199  Identities=22%  Similarity=0.362  Sum_probs=189.3

Q ss_pred             EEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHH-
Q ss_conf             9815711168899999789859997399899999997122112784032898999860577889999769906999999-
Q gi|254780716|r    8 IIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLI-   86 (475)
Q Consensus         8 iIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi-   86 (475)
                      ||||||||.|||+||+|+||+|.+||+.++.++++++.|.      ..+.|+.|.++..|   +||+|||++++|.+|+ 
T Consensus         1 FIGLGNMGgPMA~NL~KAGH~v~~FDL~p~av~~~v~aG~------~~A~S~~~a~~~Ad---~vITMLPAg~HV~sVY~   71 (290)
T TIGR01692         1 FIGLGNMGGPMAANLLKAGHAVRVFDLSPKAVEELVEAGA------QAAASAAEAAEGAD---VVITMLPAGKHVISVYS   71 (290)
T ss_pred             CCCCCCCCHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCH------HCCCCHHHHHCCCC---EEEECCCCCHHHHHHHH
T ss_conf             9788888227999986118725775178899999996002------20545798845588---68634886034899983


Q ss_pred             --HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHHHHHHHC
Q ss_conf             --999720789989996798657899999999984799430675467600035684-37884548999888999998750
Q gi|254780716|r   87 --DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENILLSISA  163 (475)
Q Consensus        87 --~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~piL~~iaa  163 (475)
                        ++|++...++..+|||||++|+.+++.+++++++|..|+|+|||||.-||+.|. +|||||.++.|++++|+|+.|+.
T Consensus        72 gd~gIL~~~~K~~LlIDcSTIDpdsAr~~A~~Aa~~G~~f~DAPVSGG~GgA~AGTLtFmVGG~a~~F~~~~p~L~~Mg~  151 (290)
T TIGR01692        72 GDDGILAKVAKGSLLIDCSTIDPDSARKVAELAAAHGLVFVDAPVSGGVGGARAGTLTFMVGGEAEEFARARPVLEPMGR  151 (290)
T ss_pred             CCHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCC
T ss_conf             31334113678896332456786789999999998187210367775356520122305643765357889999853666


Q ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             15678618985698746789887767878889998999999996428997899999986
Q gi|254780716|r  164 KYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSK  222 (475)
Q Consensus       164 k~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~  222 (475)
                      +      +.|||..|+||-.|+|||+|....|-..||++.|--+ ++++++.+.+|.+.
T Consensus       152 ~------~~HcG~~GAGQ~AKICNNmlLGIsM~GtaEA~~Lg~k-lGLdp~~L~~i~~~  203 (290)
T TIGR01692       152 N------IVHCGDHGAGQAAKICNNMLLGISMIGTAEAMALGEK-LGLDPKVLFEIANT  203 (290)
T ss_pred             C------EEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHH
T ss_conf             5------6866888875157899889999989999999999986-17888899999730


No 13 
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]
Probab=100.00  E-value=1.7e-44  Score=347.47  Aligned_cols=255  Identities=24%  Similarity=0.386  Sum_probs=220.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH-HHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             05698157111688999997898599973998999999-97122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVF-IKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l-~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +|||||||+||.+||.||+++||+|.||||++++..++ .+.++      ..+.++.|.+...+   +||+|||++++|+
T Consensus         2 kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga------~~a~s~~eaa~~aD---vVitmv~~~~~V~   72 (286)
T COG2084           2 KIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGA------TVAASPAEAAAEAD---VVITMLPDDAAVR   72 (286)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC------EECCCHHHHHHHCC---EEEEECCCHHHHH
T ss_conf             07998573525999999997798789980885665689997298------00388999996199---8999617989999


Q ss_pred             HHH---HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHHHH
Q ss_conf             999---999720789989996798657899999999984799430675467600035684-3788454899988899999
Q gi|254780716|r   84 QLI---DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENILL  159 (475)
Q Consensus        84 ~vi---~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~piL~  159 (475)
                      +|+   +++.+.+++|.++|||||++|..+++.++.++++|++|+|+|||||+.+|.+|. ++|+||++++|++++|+|+
T Consensus        73 ~V~~g~~g~~~~~~~G~i~IDmSTisp~~a~~~a~~~~~~G~~~lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~  152 (286)
T COG2084          73 AVLFGENGLLEGLKPGAIVIDMSTISPETARELAAALAAKGLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLE  152 (286)
T ss_pred             HHHHCCCCHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCHHHHHCCEEEEECCCHHHHHHHHHHHH
T ss_conf             99818533533378997899878999899999999999669868946765883123207169994799999998899999


Q ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             87501567861898569874678988776787888999899999999642899789999998606884430799999999
Q gi|254780716|r  160 SISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI  239 (475)
Q Consensus       160 ~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~i  239 (475)
                      +++.+      +.|+||.|+||.+|||||.+--+.|++++|++.+.++ .+++++.+.++.   .++..+||.++.....
T Consensus       153 ~~g~~------i~~~G~~G~G~~~Kl~nn~l~~~~~~a~aEAl~la~k-~Gld~~~~~~vi---~~~~~~s~~~e~~~~~  222 (286)
T COG2084         153 AMGKN------IVHVGPVGAGQAAKLANNILLAGNIAALAEALALAEK-AGLDPDVVLEVI---SGGAAGSWILENYGPR  222 (286)
T ss_pred             HHCCC------EEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHH---HCCCCCCHHHHHHCCH
T ss_conf             86075------6987898705999999999999999999999999998-097989999998---5355689488861404


Q ss_pred             HHHCCCCCCCCCHHH-CCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             974056799952001-02333658716778988775178885146777
Q gi|254780716|r  240 LSSSDTITGMPIIDV-ICDKASQKGTGIRSIIEGHKLSSSMTITETAI  286 (475)
Q Consensus       240 l~~k~~~~g~~lid~-i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av  286 (475)
                      .-+.+...+ +-++. .+|       -.-...+|-++++|.|....+.
T Consensus       223 m~~~~~~p~-F~v~~~~KD-------l~la~~~A~~~g~~lP~~~~~~  262 (286)
T COG2084         223 MLEGDFSPG-FAVDLMLKD-------LGLALDAAKELGAPLPLTALAA  262 (286)
T ss_pred             HHCCCCCCC-HHHHHHHHH-------HHHHHHHHHHCCCCCCHHHHHH
T ss_conf             426899963-268988867-------9999999996389982799999


No 14 
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; InterPro: IPR006398   These sequences represent 2-hydroxy-3-oxopropionate reductase (1.1.1.60 from EC), also called tartronate semialdehyde reductase. It follows glyoxylate carboligase and precedes glycerate kinase in D-glycerate pathway of glyoxylate degradation. The eventual product, 3-phosphoglycerate, is an intermediate of glycolysis and is readily metabolized. Tartronic semialdehyde, the substrate of this enzyme, may also come from other pathways, such as D-glucarate catabolism , .; GO: 0008679 2-hydroxy-3-oxopropionate reductase activity, 0046487 glyoxylate metabolic process.
Probab=100.00  E-value=1.6e-42  Score=333.01  Aligned_cols=252  Identities=24%  Similarity=0.382  Sum_probs=221.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      ++||||||.||.||+.||+++||+|+|+++++++.++++..|+      ..+.|.++.+..+|   +|++|||+.++|++
T Consensus         1 KvgfIGLGIMG~PMs~NL~kAGyql~v~t~~~e~~d~l~aaGa------~~a~ta~~~~e~~D---vi~~MvP~sPqVee   71 (291)
T TIGR01505         1 KVGFIGLGIMGKPMSKNLLKAGYQLVVATLEQEVLDELLAAGA------ESAETAKEVVEDAD---VIVTMVPDSPQVEE   71 (291)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC------HHHHHHHHHHHHCC---EEEEECCCCCCEEE
T ss_conf             9045635877865789997549468883077048999986173------22899999997489---79984387697015


Q ss_pred             HH---HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHHHHH
Q ss_conf             99---999720789989996798657899999999984799430675467600035684-37884548999888999998
Q gi|254780716|r   85 LI---DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        85 vi---~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~piL~~  160 (475)
                      |.   ++++...++|.++||||...|..|++.+++++++|++++|+||||||.||+.|. |+|||||+..|++++|+|++
T Consensus        72 va~GenGi~e~ak~G~~lvDMSSI~P~~s~~~a~a~k~kGid~LDAPVSGGE~gAiegtLSiMVGGd~A~Fd~~kpL~ea  151 (291)
T TIGR01505        72 VAFGENGILEAAKKGKVLVDMSSIAPLESKELAKAVKEKGIDVLDAPVSGGEIGAIEGTLSIMVGGDKAVFDKVKPLLEA  151 (291)
T ss_pred             EEECCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             65568752125688877887056782668999999997288452077789871001243658764861106766699997


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             75015678618985698746789887767878889998999999996428997899999986068844307999999999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL  240 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il  240 (475)
                      ++..      |+|+|+.|+|+.+|.-|--|-=-..|+++|+.-++.++ +-+++.+.++   .+.|.-.|-.|+...+-+
T Consensus       152 lgk~------ivl~G~~G~Gqt~K~ANQ~IVAlNI~A~sEAl~fa~Ka-Gvdp~~v~qa---l~GGlAgStvL~~k~~~~  221 (291)
T TIGR01505       152 LGKS------IVLVGENGDGQTVKVANQVIVALNIEAVSEALVFAEKA-GVDPKLVLQA---LRGGLAGSTVLEVKKERV  221 (291)
T ss_pred             HCCC------EEEECCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHH---HCCCCCCHHHHHHCCCCC
T ss_conf             2695------89878889974040544788888699999999998752-8899999998---618650102331126321


Q ss_pred             HHCCCCCCCCCHHH-CCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             74056799952001-02333658716778988775178885146
Q gi|254780716|r  241 SSSDTITGMPIIDV-ICDKASQKGTGIRSIIEGHKLSSSMTITE  283 (475)
Q Consensus       241 ~~k~~~~g~~lid~-i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~  283 (475)
                      -+++.+.| +-||. ++|-.       -..+.|-.++...|.-+
T Consensus       222 ~~R~FkPG-FrIdLH~KDl~-------~ald~a~~vga~LP~tA  257 (291)
T TIGR01505       222 LDRDFKPG-FRIDLHQKDLA-------LALDAAKAVGAALPVTA  257 (291)
T ss_pred             CCCCCCCC-CEEHHHHHHHH-------HHHHHHHHHHHHCCHHH
T ss_conf             25788798-53053165589-------99999899886367168


No 15 
>KOG0409 consensus
Probab=100.00  E-value=1.2e-40  Score=319.10  Aligned_cols=259  Identities=21%  Similarity=0.316  Sum_probs=216.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +++|||||||+||.+|+.||+++||+|+||||+.+++++|.+.|+      ..+++|.|+++..+   +||+|||+..+|
T Consensus        35 ~~~iGFIGLG~MG~~M~~nLik~G~kVtV~dr~~~k~~~f~~~Ga------~v~~sPaeVae~sD---vvitmv~~~~~v  105 (327)
T KOG0409          35 KTRIGFIGLGNMGSAMVSNLIKAGYKVTVYDRTKDKCKEFQEAGA------RVANSPAEVAEDSD---VVITMVPNPKDV  105 (327)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCH------HHHCCHHHHHHHCC---EEEEECCCHHHH
T ss_conf             551357743411189999999759879999586788789997050------14079799986368---899976880766


Q ss_pred             HHHHH---HHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHH
Q ss_conf             99999---997207899899-96798657899999999984799430675467600035684-37884548999888999
Q gi|254780716|r   83 DQLID---KLKPLLSPEDIL-LDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENI  157 (475)
Q Consensus        83 ~~vi~---~l~~~l~~g~ii-ID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~pi  157 (475)
                      ++|+.   +++..+++|... ||+||++|..+.++++.++.+|.+|+|+|||||..+|+.|. +||+|||++.|+.+.|+
T Consensus       106 ~~v~~g~~Gvl~g~~~g~~~~vDmSTidp~~s~ei~~~i~~~~~~~vDAPVSGg~~~A~~G~LtimagGde~~~~~~~~~  185 (327)
T KOG0409         106 KDVLLGKSGVLSGIRPGKKATVDMSTIDPDTSLEIAKAISNKGGRFVDAPVSGGVKGAEEGTLTIMAGGDEALFEAASPV  185 (327)
T ss_pred             HHHHCCCCCCEEECCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHCCEEEEEECCCHHHHHHHHHH
T ss_conf             88840778623521588834776244687889999999974798698566667701333372899946869999988999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             99875015678618985698746789887767878889998999999996428997899999986068844307999999
Q gi|254780716|r  158 LLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA  237 (475)
Q Consensus       158 L~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~  237 (475)
                      |+.|+.+      ++|+|..|+|+.+|||||.+....|-.+||+..+-.+ .+++...+.+|++.   |..-|+.++.-.
T Consensus       186 ~~~mGk~------~~~~G~~GnG~~~Kl~nnm~~g~~M~g~aEal~la~r-~GLd~~~l~eiln~---G~~~S~~~~~~~  255 (327)
T KOG0409         186 FKLMGKN------VVFLGGVGNGQAAKLCNNMLLGSSMVGLAEALALADR-LGLDAKKLLEILNT---GRCWSSMFYNPV  255 (327)
T ss_pred             HHHHCCE------EEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHC---CCCCCHHHHCCC
T ss_conf             9973251------8983465751788999999999999999999999998-08989999999735---775667775758


Q ss_pred             HHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             99974056799952001023336587167789887751788851467778
Q gi|254780716|r  238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIF  287 (475)
Q Consensus       238 ~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~  287 (475)
                      .-..+.+-..+-++--..+|       -.-...+|-+.++|.|..+.|-.
T Consensus       256 p~m~k~dy~p~f~~~~m~KD-------Lgla~~~a~~~~~~~P~~slA~q  298 (327)
T KOG0409         256 PGMLKGDYNPGFALKLMVKD-------LGLALNAAESVKVPMPLGSLAHQ  298 (327)
T ss_pred             CHHHCCCCCCCCHHHHHHHH-------HHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             60103778986148999988-------89999766404898846789999


No 16 
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=100.00  E-value=2.6e-36  Score=287.22  Aligned_cols=159  Identities=38%  Similarity=0.637  Sum_probs=150.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             99880569815711168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      |++  |||||||+||.+||+||+++||+|++|||++++++++.+++      +..+.+++|+++.++   +|++|||+++
T Consensus         1 M~~--Ig~IGlG~MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g------~~~~~s~~e~~~~~d---vIi~~l~~~~   69 (163)
T pfam03446         1 MAK--IGFIGLGVMGSPMALNLLKAGYTVTVYNRTPEKVEELVAEG------AVAAASPAEAAASAD---VVITMVPAGA   69 (163)
T ss_pred             CCE--EEEEEEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC------CEECCCHHHHHHCCC---EEEEECCCHH
T ss_conf             988--99983679899999999977996999979788779999839------955399999986199---9999258714


Q ss_pred             HHHHHHH---HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHH
Q ss_conf             9999999---99720789989996798657899999999984799430675467600035684-3788454899988899
Q gi|254780716|r   81 PVDQLID---KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVEN  156 (475)
Q Consensus        81 ~v~~vi~---~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~p  156 (475)
                      ++++|+.   ++++.+.+|+++||+||++|+++++++++++++|++|+|||||||+.+|++|. ++|+||++++|++++|
T Consensus        70 ~v~~V~~~~~gl~~~~~~g~iiid~sT~~p~~~~~~~~~~~~~g~~~lDaPVsGg~~~A~~G~L~~m~gG~~~~~~~~~p  149 (163)
T pfam03446        70 AVDAVIFGEDGLLPGLKPGDIIIDGSTISPDDTRRLAKELKEKGIRFLDAPVSGGEEGAEAGTLSIMVGGDEEAFERVKP  149 (163)
T ss_pred             HHHEEECCCCCHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCEEEEECCCHHHHHHHHH
T ss_conf             54022026313323135898898679899999999999875303443478776898999448879997589999999999


Q ss_pred             HHHHHHCCCCCCCEEEEECC
Q ss_conf             99987501567861898569
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGP  176 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~  176 (475)
                      +|++++.+      ++|+||
T Consensus       150 ~l~~~~~~------~~~~GP  163 (163)
T pfam03446       150 ILEAMGAC------VTYIGP  163 (163)
T ss_pred             HHHHHCCC------CEEECC
T ss_conf             99997394------889592


No 17 
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]
Probab=99.85  E-value=2.4e-21  Score=176.88  Aligned_cols=133  Identities=26%  Similarity=0.460  Sum_probs=119.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             78899999999999999999999999996110145667988999985189468537899999998708885200079899
Q gi|254780716|r  316 FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSI  395 (475)
Q Consensus       316 ~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~  395 (475)
                      ..-|++.+++.+-.+++.+|++||++|+++.    |++|+++|+++||.|++||||||++..++|+++++|      +.|
T Consensus       167 sGHfvKMVHNGIEYGmM~a~aEGfelL~~s~----fD~D~~~VA~vW~hGSVIrSWLldLt~~Af~~d~~L------~q~  236 (300)
T COG1023         167 SGHFVKMVHNGIEYGMMQAIAEGFELLKNSP----FDYDLEAVAEVWNHGSVIRSWLLDLTAEAFKKDPDL------DQI  236 (300)
T ss_pred             CCHHHHHHHCCHHHHHHHHHHHHHHHHHHCC----CCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCH------HHH
T ss_conf             6232899851089999999998999987188----887779999998276459999999999998548887------776


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH-HHHHHCCCCCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             999995247699999999983998479999999-9986217887589999876104573224248
Q gi|254780716|r  396 SEKVKKTIPSLRRIVVTCTENGYPVPSLSAALS-YFDTFIHDRGTANLIQAQRDFFGSHGFDRKD  459 (475)
Q Consensus       396 ~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL~-y~~~~~~~~~~~nliqaqRD~FGaH~~~r~D  459 (475)
                      ...+.+..++ ||+|..+++.|+|+|+++.||. .|-+.....+..+++.|+|+.||+|..++++
T Consensus       237 ~g~v~dSGEG-rWTv~~aldlgvpaPVia~al~~Rf~S~~~d~f~~kvlaalR~~FGgH~vk~k~  300 (300)
T COG1023         237 SGRVSDSGEG-RWTVEEALDLGVPAPVIALALMMRFRSRQDDTFAGKVLAALRNEFGGHAVKKKN  300 (300)
T ss_pred             CCEECCCCCC-EEEHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             1763458875-066687776389815999999999750322467889999999874775544679


No 18 
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=99.67  E-value=1.8e-15  Score=133.64  Aligned_cols=133  Identities=31%  Similarity=0.490  Sum_probs=117.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             27889999999999999999999999999611014566798899998518946853789999999870888520007989
Q gi|254780716|r  315 CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPS  394 (475)
Q Consensus       315 ~~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~  394 (475)
                      ....+++.+++.+.++.+...+++|+|++.    .++++|+.+|+++|+.|++|+|+|++...++|.+++.++.      
T Consensus       167 GaGh~vKmVhNgIey~~mq~iaE~~~ll~~----~~~~~d~~~v~~~w~~g~~~~S~L~ei~~~~l~~~~~ld~------  236 (301)
T PRK09599        167 GAGHFVKMVHNGIEYGMMQAYAEGFELLEA----SRFDLDLAAVAEVWRRGSVIRSWLLDLTADALAEDPKLDE------  236 (301)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHH------
T ss_conf             823899999999999999999999999986----6788789999999856882113899999999711885422------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHHHCCCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             999999524769999999998399847999999-9998621788758999987610457322424
Q gi|254780716|r  395 ISEKVKKTIPSLRRIVVTCTENGYPVPSLSAAL-SYFDTFIHDRGTANLIQAQRDFFGSHGFDRK  458 (475)
Q Consensus       395 ~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL-~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~  458 (475)
                      +.+...++.++ ||++..+++.|+|+|++++|| +.|.+...+....+++.|+|+-||+|.+++.
T Consensus       237 i~~~~~~~gtG-~wt~~~a~~lgvp~p~i~~a~~aR~~S~~~~~~~~k~~sa~r~~fg~h~~~~~  300 (301)
T PRK09599        237 ISGYVADSGEG-RWTVEAAIELGVPAPVIAAALFARFRSRQEDSFADKVLAALRNGFGGHAVKKK  300 (301)
T ss_pred             HCCCCCCCCCH-HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             14612678718-99999999859985899999999998466765056599998876289876678


No 19 
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=99.65  E-value=2.8e-15  Score=132.21  Aligned_cols=133  Identities=27%  Similarity=0.450  Sum_probs=117.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             27889999999999999999999999999611014566798899998518946853789999999870888520007989
Q gi|254780716|r  315 CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPS  394 (475)
Q Consensus       315 ~~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~  394 (475)
                      ....+++.+++.+.++.+..++.+|++++++    +.++|+.++++.|+.|++++||||+...+++.+++.++      .
T Consensus       165 GsGh~vKmvnN~Iey~~mq~iaEa~~l~~~~----~~~~d~~~v~~~w~~G~~~~S~L~ei~~~~l~~~~~l~------~  234 (298)
T PRK12490        165 GSGHFLKMVHNGIEYGMMQAYAEGFELLDKS----DFDFDVEDVARVWANGSVIRSWLLDLTVKALAEDPKLS------G  234 (298)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHH------H
T ss_conf             7538899999999999999999999999867----99888999999995776266699999999854599743------3


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHHHCCCCCHHHHHHHHHHCCCCCEEEEC
Q ss_conf             999999524769999999998399847999999-9998621788758999987610457322424
Q gi|254780716|r  395 ISEKVKKTIPSLRRIVVTCTENGYPVPSLSAAL-SYFDTFIHDRGTANLIQAQRDFFGSHGFDRK  458 (475)
Q Consensus       395 ~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL-~y~~~~~~~~~~~nliqaqRD~FGaH~~~r~  458 (475)
                      |...+.++.+. ||++..+.+.|+|+|++++|| ++|.+...+.+..+++.|+|+.||+|.++|+
T Consensus       235 i~~~~~~~Gtg-~wt~~~A~~lgvp~P~i~~Al~~R~~S~~~~~f~~k~~sa~r~~fggh~~~~k  298 (298)
T PRK12490        235 IKGYMNDSGEG-RWTVEEAIELAVAAPVIAASLFMRFASQEDDSFHMKVVSALRNQFGGHAVVKK  298 (298)
T ss_pred             CCCCCCCCCCH-HHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             26633688951-99999999839991699999999998657886078899999876288777889


No 20 
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=99.57  E-value=5.9e-12  Score=107.65  Aligned_cols=208  Identities=17%  Similarity=0.181  Sum_probs=151.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--------------CCCCCEECCCHHHHHHHCCCCC
Q ss_conf             05698157111688999997898599973998999999971221--------------1278403289899986057788
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG--------------LSQKVIVTKNLEQMVEAVCKPR   70 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~--------------~~~~~~~~~s~~e~v~~l~~pr   70 (475)
                      +|++||||-.|.++|.-|+++|++|.+||.++++++.+.+....              ...++....+.++.+   ..++
T Consensus         2 kI~ViGlGyVGl~~a~~lA~~G~~V~g~D~d~~~i~~l~~g~~p~~E~gl~~ll~~~~~~~~l~~ttd~~~~i---~~~d   78 (411)
T TIGR03026         2 KIAVIGLGYVGLPLAALLADLGHEVTGVDIDQEKVDKLNKGKSPIYEPGLDELLAKALAAGRLRATTDYEDAI---RDAD   78 (411)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCEEEECCHHHHH---HHCC
T ss_conf             7999897877999999999489948999899999999977989978989899999998639979987889987---2099


Q ss_pred             EEEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC--------CCCEECCCCC---
Q ss_conf             999976990---------69999999997207899899967986578999999999847--------9943067546---
Q gi|254780716|r   71 KILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK--------GIYFIGIGVS---  130 (475)
Q Consensus        71 ~Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k--------gi~fid~pVS---  130 (475)
                      ++|+|||.+         ..++++++.+.+.++++++||--||..|..|++....+.++        .+++.-+|=-   
T Consensus        79 ii~I~V~TP~~~~g~~d~s~l~~a~~~i~~~l~~~~lvii~STV~pGTt~~i~~~ile~~~~~~~g~df~v~~~PEfl~e  158 (411)
T TIGR03026        79 VIIICVPTPLKEDGSPDLSYVESAAETIAKHLRKGATVVLESTVPPGTTEEVVKPILERASGLKLGEDFYLAYNPEFLRE  158 (411)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEHHHHHHHHHHHCCCCCCCCEEEEECCCCCCC
T ss_conf             99997689866688721389999999999766899989995786868104899998877404666885479968354687


Q ss_pred             CCC-CCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             760-0035684378845489998889999987501567861898569874678988776787888999899999999642
Q gi|254780716|r  131 GGV-KGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSL  209 (475)
Q Consensus       131 GG~-~gA~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~  209 (475)
                      |.. ..-++-+-+..|.+++.-+.++.+++.+..+.     ...+-..-+.-++|.+.|.--.--...+-|...++.+ .
T Consensus       159 G~a~~d~~~~~riV~G~~~~~~~~~~~ly~~~~~~~-----~i~~~~~~~AEl~K~~~N~~~a~~Isf~Nela~lce~-~  232 (411)
T TIGR03026       159 GNAVHDLLNPDRIVGGETEEAGEAVAELYAPIIEDG-----PVLVTSIETAEMIKLAENTFRAVKIAFANELARICEA-L  232 (411)
T ss_pred             CCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHCCCC-----EEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-H
T ss_conf             472234236985999684999999999999746598-----4982588999999999999999889999999999998-5


Q ss_pred             CCCHHHHHHHHH
Q ss_conf             899789999998
Q gi|254780716|r  210 NKNPLEISHLFS  221 (475)
Q Consensus       210 ~~~~~~i~~vf~  221 (475)
                      +.+..++.+...
T Consensus       233 gid~~eV~~a~~  244 (411)
T TIGR03026       233 GIDVYEVIEAAG  244 (411)
T ss_pred             CCCHHHHHHHHC
T ss_conf             689999997617


No 21 
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=99.53  E-value=2.1e-11  Score=103.60  Aligned_cols=209  Identities=18%  Similarity=0.240  Sum_probs=148.5

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHH------------HCCC
Q ss_conf             9988056981571116889999978985999739989999999712211278403289899986------------0577
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE------------AVCK   68 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~------------~l~~   68 (475)
                      |+..+|++||||-.|.++|.-|+++|++|.+||.++++++.+.+ |...    ..-..+++++.            ..+.
T Consensus         1 m~~kkI~ViGlGYVGL~~a~~lA~~G~~Vig~D~d~~kv~~l~~-g~~p----~~Ep~l~~ll~~~~~~~~l~~t~~~~~   75 (415)
T PRK11064          1 MSFETISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINR-GEIH----IVEPDLDMVVKAAVEGGYLRATTTPVP   75 (415)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHC-CCCC----CCCCCHHHHHHHHHHCCCCEEECCHHH
T ss_conf             99887999886877899999999688948999899999999978-6899----889898999999986598365257467


Q ss_pred             CCEEEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC--CCCE-------ECCCCC
Q ss_conf             88999976990---------69999999997207899899967986578999999999847--9943-------067546
Q gi|254780716|r   69 PRKILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK--GIYF-------IGIGVS  130 (475)
Q Consensus        69 pr~Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k--gi~f-------id~pVS  130 (475)
                      .+++|+|||.+         ..++++++.+.+.++++++||--||+.|..|++..+.+.+.  ++.|       -|-.+.
T Consensus        76 ad~iiI~V~TP~~~~~~~Dls~i~~a~~~I~~~l~~~~lVIi~STVppGTt~~i~~~l~~~~~~l~~~~~~~~~~d~~v~  155 (415)
T PRK11064         76 ADAFLIAVPTPFKGDHEPDLSYVEAAAKSIAPVLKKGDLVILESTSPVGATEQMAEWLAEARPDLTFPQQAGEQADINIA  155 (415)
T ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCHHHCCCCCCEEEE
T ss_conf             89999988999789997202018889999997526886799637899971999999999855676512222667763798


Q ss_pred             CCCCCCCCCCE--------EEEEC-CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76000356843--------78845-4899988899999875015678618985698746789887767878889998999
Q gi|254780716|r  131 GGVKGARSGAS--------LMVGG-NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADI  201 (475)
Q Consensus       131 GG~~gA~~G~s--------lMvGG-~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~  201 (475)
                      -.|+--+.|.+        -.+|| +++..+.+..+++.+...    + + .+-..-++-++|++-|.--+-....+-|.
T Consensus       156 ~~PErl~eG~a~~d~~~~~rVIgg~~~~~~~~~~~ly~~~~~~----~-~-~~t~~~~AEl~K~~~N~~ra~~Isf~NEl  229 (415)
T PRK11064        156 YCPERVLPGQVMVELIKNDRVIGGMTPVCSARASELYKIFLEG----E-C-VVTNSRTAEMCKLTENSFRDVNIAFANEL  229 (415)
T ss_pred             ECCCCCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHCC----C-E-EECCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5855046775421114687257347889999999999997479----8-8-94378998887776788999999999999


Q ss_pred             HHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999642899789999998
Q gi|254780716|r  202 YGILRDSLNKNPLEISHLFS  221 (475)
Q Consensus       202 ~~~l~~~~~~~~~~i~~vf~  221 (475)
                      ..++.+ .+.+..|+.+...
T Consensus       230 a~lce~-~gid~~evi~~~~  248 (415)
T PRK11064        230 SLICDD-QGINVWELIRLAN  248 (415)
T ss_pred             HHHHHH-CCCCHHHHHHHHC
T ss_conf             999998-0999999999728


No 22 
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849   This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues. Among complete genomes, it is found is found in Bacillus subtilis and Mycobacterium tuberculosis, both of which also contain Gnd, and in Aquifex aeolicus. .
Probab=99.48  E-value=5.2e-14  Score=122.81  Aligned_cols=81  Identities=20%  Similarity=0.409  Sum_probs=71.4

Q ss_pred             HCCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             42899789999998606884-43079999999997405679995200102333658716778988775178885146777
Q gi|254780716|r  208 SLNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAI  286 (475)
Q Consensus       208 ~~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av  286 (475)
                      -+.+|..|+|+|   |++|+ ++||||++|...|++.-      -||.|...+++.|+|+||+++|+|+|+|+|+|+.|+
T Consensus       238 qfDfD~~eVArV---w~~GSVIrSwL~dLt~~Af~~~~------dL~~~~G~v~dSGEGrWtv~~a~dlg~p~PVia~sl  308 (341)
T TIGR00872       238 QFDFDLEEVARV---WRRGSVIRSWLLDLTAKAFEESA------DLEEVEGIVEDSGEGRWTVKEAVDLGVPIPVIATSL  308 (341)
T ss_pred             CCCCCHHHHHHH---HCCCCEEEHHHHHHHHHHHHCCC------CCCCEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHH
T ss_conf             776874889998---70898641268889999975078------821322367027872789999886278824899999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             88877500577
Q gi|254780716|r  287 FARNLSLYRDE  297 (475)
Q Consensus       287 ~aR~~S~~k~~  297 (475)
                      ..||.|..++.
T Consensus       309 ~~Rf~Sr~~D~  319 (341)
T TIGR00872       309 YERFASREKDD  319 (341)
T ss_pred             HHHHCCCCCCC
T ss_conf             98740234566


No 23 
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=99.42  E-value=2.4e-10  Score=95.78  Aligned_cols=255  Identities=19%  Similarity=0.234  Sum_probs=173.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---------------CCCCCCEECCCHHHHHHHCCC
Q ss_conf             80569815711168899999789859997399899999997122---------------112784032898999860577
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS---------------GLSQKVIVTKNLEQMVEAVCK   68 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~---------------~~~~~~~~~~s~~e~v~~l~~   68 (475)
                      ..||+||||-+|.|+|.-++++|++|.+||.++.+++.+.. |.               .....++...++++    ++.
T Consensus        10 ~~I~ViGLGYVGLPlA~~fA~~G~~ViG~DIn~~~Vd~ln~-G~~~i~e~~~~~~v~~~v~~g~lraTtd~~~----l~~   84 (436)
T COG0677          10 ATIGVIGLGYVGLPLAAAFASAGFKVIGVDINQKKVDKLNR-GESYIEEPDLDEVVKEAVESGKLRATTDPEE----LKE   84 (436)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHC-CCCEEECCCHHHHHHHHHHCCCCEEECCHHH----CCC
T ss_conf             28999824644578899998769955757578899888757-8642546868899999986397157568556----254


Q ss_pred             CCEEEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH--CCCCE-ECCCCCCCCCCC
Q ss_conf             88999976990---------6999999999720789989996798657899999999984--79943-067546760003
Q gi|254780716|r   69 PRKILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE--KGIYF-IGIGVSGGVKGA  136 (475)
Q Consensus        69 pr~Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~--kgi~f-id~pVSGG~~gA  136 (475)
                      ++++++|||.+         ..|.+....+.+.|++|++||-=||+.|..|.+...-+.+  -|..| -|-.+--.|+..
T Consensus        85 ~dv~iI~VPTPl~~~~~pDls~v~~aa~sIa~~L~kG~LVIlEST~~PGTTe~v~~plle~~sgL~~~~Df~laysPERv  164 (436)
T COG0677          85 CDVFIICVPTPLKKYREPDLSYVESAARSIAPVLKKGDLVILESTTPPGTTEEVVKPLLEERSGLKFGEDFYLAYSPERV  164 (436)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCCCC
T ss_conf             88899993577678999884899999999997567788899964789985788899998506897656404686073321


Q ss_pred             CCCC--------EEEEEC-CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5684--------378845-4899988899999875015678618985698746789887767878889998999999996
Q gi|254780716|r  137 RSGA--------SLMVGG-NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRD  207 (475)
Q Consensus       137 ~~G~--------slMvGG-~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~  207 (475)
                      .-|.        .=.+|| +++.-+.+.-+.+.+-.+      +..+-..-..-++|+.-|----...-+.-|-- +.-+
T Consensus       165 ~PG~~~~el~~~~kVIgG~tp~~~e~a~~lY~~iv~~------~~~vts~~tAEm~Kl~EN~fRdVNIALaNEla-li~~  237 (436)
T COG0677         165 LPGNVLKELVNNPKVIGGVTPKCAELAAALYKTIVEG------VIPVTSARTAEMVKLTENTFRDVNIALANELA-LICN  237 (436)
T ss_pred             CCCCHHHHHHCCCCEEECCCHHHHHHHHHHHHHHEEE------EEECCCHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHH
T ss_conf             8986002020178235368889999999999986177------99757747999999886334677899999999-9999


Q ss_pred             HCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCH--H--HCCCCCCCCCHHHHHHHHHHHHCCCCCHH
Q ss_conf             428997899999986068844307999999999740567999520--0--10233365871677898877517888514
Q gi|254780716|r  208 SLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPII--D--VICDKASQKGTGIRSIIEGHKLSSSMTIT  282 (475)
Q Consensus       208 ~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g~~li--d--~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i  282 (475)
                      .+|.+--   ++++..|+...  |      ++++- ..--|.+.|  |  .+..++...|.-..-...|=+.+-..|--
T Consensus       238 ~~GIdvw---evIeaAnt~P~--~------~~~~P-GpGvGGHCIpvDP~fl~~ka~~yg~~~rlI~tAreIN~~mP~~  304 (436)
T COG0677         238 AMGIDVW---EVIEAANTKPR--V------NIFYP-GPGVGGHCIPVDPYFLTWKAPEYGLPARLIRTAREINDSMPRH  304 (436)
T ss_pred             HHCCCHH---HHHHHHCCCCC--E------EECCC-CCCCCCCCCCCCCHHEEECCCCCCCCHHHHHHHHHHHCCCCHH
T ss_conf             8298699---99998614981--3------20489-9998876356571540421600277628999998875458789


No 24 
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=99.42  E-value=6.1e-11  Score=100.22  Aligned_cols=158  Identities=20%  Similarity=0.270  Sum_probs=118.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997898--5999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +|.|||||.||..+|+.|.++|.  .|++||++++..+...+.+...    ..+.++.+.   +..+++|++|+|-. .+
T Consensus         8 ~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id----~~~~~~~e~---~~~~DlIilatPv~-~~   79 (307)
T PRK07502          8 RVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARARELGLGD----RVTTSAAEA---VKGADLVILCVPVG-AS   79 (307)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCC----HHCCCHHHH---HCCCCEEEEECCHH-HH
T ss_conf             68999278799999999985499857999849999999999869975----112777664---04589799917899-99


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC----CC----CCC-CEEEE---ECCHH
Q ss_conf             999999972078998999679865789999999998479943067-5467600----03----568-43788---45489
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK----GA----RSG-ASLMV---GGNEK  149 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~----gA----~~G-~slMv---GG~~~  149 (475)
                      .+++..+.+.++++.+|.|.|.+--.-.... +..-..+++|++. |+.|.+.    .|    -.| +.+.+   +.+++
T Consensus        80 ~~vl~~l~~~l~~~~ivTDvgSvK~~I~~~~-~~~~~~~~~FVg~HPmAGsE~sG~~~A~~~LF~~~~~iltp~~~~~~~  158 (307)
T PRK07502         80 GAVAAEIAPHLKPGAIVTDVGSVKASVIAAM-APHLPEGVHFIPGHPLAGTEHSGPDAGFAELFENRWCILTPPEGTDPA  158 (307)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCHHHHHHHH-HHHCCCCCCEECCCCCCCCCCCCCCHHHHHHHCCCEEEEECCCCCCHH
T ss_conf             9999999855589968996632118999999-985677783672688767887551010014743870899679999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCC
Q ss_conf             9988899999875015678618985698
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSPCCALLGPD  177 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~cv~y~G~~  177 (475)
                      ++++++.+++.++++      +..+-+.
T Consensus       159 ~~~~v~~lw~~lGa~------v~~m~~~  180 (307)
T PRK07502        159 AVARLRAFWRALGAR------VEEMDPE  180 (307)
T ss_pred             HHHHHHHHHHHCCCE------EEEECHH
T ss_conf             999999999963987------9994645


No 25 
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=99.39  E-value=6.1e-11  Score=100.21  Aligned_cols=162  Identities=19%  Similarity=0.230  Sum_probs=118.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+|+|||||.||..+|+.|.+.|++|++||++++..+...+.+...    ....+++    .++.+++|++|+|- ..+.
T Consensus         2 mkI~IiGlGLIGgSla~al~~~~~~V~g~d~~~~~~~~A~~~g~id----~~~~~~~----~~~~aDliila~Pv-~~~~   72 (280)
T PRK07417          2 MNIGIVGLGLIGGSLGLDLRSLGHTVYGVSRRESTCERAIERGLVD----EASTDLS----LLKDCDLVILALPI-GLLL   72 (280)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCC----EECCCHH----HHCCCCEEEECCCH-HHHH
T ss_conf             7899993185799999999968997999979999999999869975----2027874----60579989987974-7789


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC----CCC----CC-CEEEE---ECCHHH
Q ss_conf             99999972078998999679865789999999998479943067-5467600----035----68-43788---454899
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK----GAR----SG-ASLMV---GGNEKA  150 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~----gA~----~G-~slMv---GG~~~~  150 (475)
                      +++.++.+.++++.+|.|.|.+--.-    .+.+.+..-+|++. |+.|.+.    .|.    .| +.+++   +.++++
T Consensus        73 ~~~~~~~~~l~~~~iitDv~SvK~~i----~~~~~~~~~~fVg~HPMAGsE~sG~~~a~~dLF~~~~~il~p~~~~~~~~  148 (280)
T PRK07417         73 PPSEELIPALPPEAIVTDVGSVKEPI----VEAWEKLHPRFVGSHPMAGTAESGVEAGQRGLFKNRPWVLTPTENTDLAA  148 (280)
T ss_pred             HHHHHHHHHCCCCCEEEECHHHHHHH----HHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCEEEEECCCCCCHHH
T ss_conf             99999986478984899652230789----99998607986236980768887712034667507539985688899999


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHH
Q ss_conf             9888999998750156786189856987467898
Q gi|254780716|r  151 YNRVENILLSISAKYQNSPCCALLGPDGSGHFVK  184 (475)
Q Consensus       151 ~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vK  184 (475)
                      ++.++.+++.++++      +..+-+.-.=..+=
T Consensus       149 ~~~~~~l~~~lGa~------~~~m~~~eHD~~~A  176 (280)
T PRK07417        149 LATVEELAVSLGSK------IYTADPAEHDRAVA  176 (280)
T ss_pred             HHHHHHHHHHCCCE------EEECCCCCHHHHHH
T ss_conf             99999999984999------99999857669999


No 26 
>PRK08507 prephenate dehydrogenase; Validated
Probab=99.35  E-value=1.9e-09  Score=89.23  Aligned_cols=162  Identities=20%  Similarity=0.271  Sum_probs=114.5

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997898--5999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +|+|||+|.||..+|+.|.++|.  .|++||++++..+...+.+..     ....+.++    +..+++|++|+|- ..+
T Consensus         2 ~I~IiGlGLiGgSla~alk~~~~~~~V~g~d~~~~~~~~A~~~g~i-----d~~~~~~~----i~~aDlVila~Pv-~~~   71 (275)
T PRK08507          2 KIGIIGLGLMGGSLGLALKENKLISCVYGYDHNEEHEKDALDLGLV-----DEIVEFEE----IKECDVIFLAIPV-DAI   71 (275)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCC-----CCCCCHHH----CCCCCEEEEECCH-HHH
T ss_conf             8999900878999999999509986799995999999999986998-----61067312----3657989991769-999


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC----CC----CCC-CEEEE---ECCHH
Q ss_conf             999999972078998999679865789999999998479943067-5467600----03----568-43788---45489
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK----GA----RSG-ASLMV---GGNEK  149 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~----gA----~~G-~slMv---GG~~~  149 (475)
                      .+++.++.+ +.++.+|.|.|.+-..-.....+   ...-+|++. |+.|.+.    .|    -.| +.+++   ..+++
T Consensus        72 ~~~l~~l~~-l~~~~iitDv~SvK~~i~~~~~~---~~~~~fVg~HPmAGsE~sG~~~a~~~LF~~~~~il~p~~~~~~~  147 (275)
T PRK08507         72 IEILQKLLD-IKENTTIIDLGSTKAKIIESIPK---SIRKNFIAAHPMTGTEFSGPKAAFKGLYKGAVVVLCDLEKSGEK  147 (275)
T ss_pred             HHHHHHHHH-CCCCCEEEECCCHHHHHHHHHHH---HCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCHH
T ss_conf             999999860-46788898343128999999986---25688443499788875445441077853985999688889799


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHH
Q ss_conf             9988899999875015678618985698746789887
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMI  186 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMV  186 (475)
                      .++.++.+++.+.++      +..+-|.-.=.++-.+
T Consensus       148 ~~~~~~~l~~~lGa~------~~~~~~~~HD~~~A~~  178 (275)
T PRK08507        148 HQERAKEIFSGIGMK------IVFMDSKEHDHHAAYI  178 (275)
T ss_pred             HHHHHHHHHHHCCCE------EEECCCHHHHHHHHHH
T ss_conf             999999999981997------8874823368999999


No 27 
>PRK08655 prephenate dehydrogenase; Provisional
Probab=99.30  E-value=5.6e-09  Score=85.70  Aligned_cols=212  Identities=17%  Similarity=0.273  Sum_probs=142.0

Q ss_pred             EEEEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             05698-15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .|++| |-|.||+=+|+.|...||+|.++.|+.++.++..++..     +..+.+..+++   +..++|+++||- ..+.
T Consensus         2 kI~IIGG~G~MG~~Fa~~f~~sGyeV~I~gRd~~k~~~va~~LG-----v~~~~~~~e~~---~~advVIvsVPI-~~T~   72 (441)
T PRK08655          2 KISIIGGTGGLGKWFARFLKDKGYEVIVWGRDPKKGKEVAKELG-----VEYASDNIDAA---KDGDIVIVSVPI-NVTE   72 (441)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHC-----CCCCCCHHHHH---HCCCEEEEECCH-HHHH
T ss_conf             79999479817799999998679889998157313567888738-----62224478897---249999998488-9999


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCCCCCCCCE-EEE--EC-CHHHHHHHHHHH
Q ss_conf             99999972078998999679865789999999998479943067-54676000356843-788--45-489998889999
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVKGARSGAS-LMV--GG-NEKAYNRVENIL  158 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~gA~~G~s-lMv--GG-~~~~~~~~~piL  158 (475)
                      +|+.++.|.|.++.+++|.+..--.-.... .+....++.+++. |+-|-..+...|.. +++  .| +.+-|..+..+|
T Consensus        73 ~VI~~laP~l~~~~lL~DitSvK~~p~~aM-l~~~~~~~~viglHPMFGP~v~sl~gQvVVvcP~~~~~~~~~~~l~~~l  151 (441)
T PRK08655         73 DVIREVAPHVKEGSLLMDVTSVKERPVEAM-KEFAPEGVEILPTHPMFGPRTPSLRGQVVILTPTEKRSNPWFPKVRNFL  151 (441)
T ss_pred             HHHHHHHCCCCCCCEEEECCCCCHHHHHHH-HHHCCCCCCEECCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             999997424899969998310417799999-9756578877454888799986657888999638987717799999999


Q ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             98750156786189856987467898877678788899989999999964289978999999860688443079999999
Q gi|254780716|r  159 LSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE  238 (475)
Q Consensus       159 ~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~  238 (475)
                      +.-+++      +..+-|.-.-..+-.| -|.-.  +..++=+.++-+  ++.+.+++.+.     .++...-.|.+...
T Consensus       152 ~~~Ga~------v~~~tpeEHDr~MavV-Q~LtH--F~~i~~G~~L~~--~~vDi~~~l~f-----sSPiYrL~L~mvGR  215 (441)
T PRK08655        152 EEEGAR------VIITTPEEHDRIMSVV-QGLTH--FAYISIGSTLKR--LGIDIKESRKF-----ASPIYELMIDIIAR  215 (441)
T ss_pred             HHCCCE------EEECCHHHHHHHHHHH-HHHHH--HHHHHHHHHHHH--HCCCHHHHHHH-----CCCHHHHHHHHHHH
T ss_conf             977988------9994889986760999-99999--999999999988--19999999753-----79089999999999


Q ss_pred             HHHH
Q ss_conf             9974
Q gi|254780716|r  239 ILSS  242 (475)
Q Consensus       239 il~~  242 (475)
                      ++.+
T Consensus       216 l~aQ  219 (441)
T PRK08655        216 ILGQ  219 (441)
T ss_pred             HHCC
T ss_conf             8626


No 28 
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed
Probab=99.27  E-value=7.2e-08  Score=77.56  Aligned_cols=241  Identities=17%  Similarity=0.223  Sum_probs=139.8

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC----EEEEEECCH-HHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             998805698157111688999997898----599973998-999999971221127840328989998605778899997
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF----RLAVYNKDF-ELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~----~V~vydr~~-~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      |+|  |||||.|+||.+|+.-|+++|.    ++.++++++ ++.+.+.+...     ...+.+.++++...   ++|+++
T Consensus         1 M~k--I~fIG~GnMg~Aii~Gll~~~~~~~~~i~v~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~---dvIila   70 (275)
T PRK06928          1 MEK--IGFIGYGSMADMIATKLLETEVITPEEIILYSRSENEHFKQLYDKYP-----TVALASNEELFTKC---DHSFIC   70 (275)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHCC-----CEEECCHHHHHHHC---CEEEEE
T ss_conf             988--99986789999999999978999963699978993899999998749-----53637779998549---989999


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEE---CCHHHHH
Q ss_conf             6990699999999972078998999679865789999999998479943067546760003568437884---5489998
Q gi|254780716|r   76 VTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVG---GNEKAYN  152 (475)
Q Consensus        76 vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvG---G~~~~~~  152 (475)
                      |+. +++.+|++++.+.+.++.+||-.-..-.-+..+  +....+=++.  ||-  .+.....|.+....   -+++.-+
T Consensus        71 VKP-~~~~~vl~~i~~~~~~~~~iISi~AGi~i~~l~--~~~~~~vvRv--MPN--tpa~vg~Gvt~~~~~~~~~~~~~~  143 (275)
T PRK06928         71 VPP-LAVLPLMKDCAPVLTPDRHVVSIAAGVSLDDLL--EITPGQVSRL--IPS--LTSAVGVGTSLVAHAETVAEENKS  143 (275)
T ss_pred             ECH-HHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHH--HHCCCCEEEE--ECC--CCHHHCCCEEEEECCCCCCHHHHH
T ss_conf             785-879999999765327996899956999899999--7579983797--137--327767842899628989999999


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECC---------CCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             889999987501567861898569---------8746-789887767878889998999999996428997899999986
Q gi|254780716|r  153 RVENILLSISAKYQNSPCCALLGP---------DGSG-HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSK  222 (475)
Q Consensus       153 ~~~piL~~iaak~~~~~cv~y~G~---------~GsG-h~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~  222 (475)
                      .++.+|+.++.       +.++-+         +||| -|+        |-.++.++++-  .+. .+++.++-.++.  
T Consensus       144 ~v~~lf~~~G~-------v~~v~E~~~d~~TalsGSGPAyv--------~~~~eal~~a~--v~~-~gl~~~~A~~l~--  203 (275)
T PRK06928        144 RLEELLSAFSH-------VMTIREENMDIASNLTSSSPGFI--------AAIFEEFAEAA--VRN-SSLSDEEAFQFL--  203 (275)
T ss_pred             HHHHHHHHCCC-------EEEECHHHHHHHHHHHCCHHHHH--------HHHHHHHHHHH--HHH-CCCCHHHHHHHH--
T ss_conf             99999985797-------13305899889998836399999--------99999999999--996-799999999999--


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             0688443079999999997405679995200102333658716778988775178885146777888775
Q gi|254780716|r  223 WDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS  292 (475)
Q Consensus       223 w~~~~~~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S  292 (475)
                             ...+.=++..+...    +.+.-+.+..+....||.-- ...+|+.+  .+-|...+..+..-
T Consensus       204 -------~~t~~Gaa~ll~~~----~~~~~~L~~~V~SPgGTT~a-Gl~~Le~~--~~~~~~~~~~aa~k  259 (275)
T PRK06928        204 -------NFALAGTGKLLVEK----DYTFAGTIDRVATKGGITAE-GAEVIQAQ--LPQFFDELLDRTQK  259 (275)
T ss_pred             -------HHHHHHHHHHHHHC----CCCHHHHHHHCCCCCCHHHH-HHHHHHHH--HHHHHHHHHHHHHH
T ss_conf             -------99999999999863----97999999818798806999-99999864--49999999999999


No 29 
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=99.26  E-value=7.3e-10  Score=92.24  Aligned_cols=163  Identities=18%  Similarity=0.268  Sum_probs=114.7

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ...|+|+|+|.||+-+|+-|.++|+.|.+|+++.+......+...    ++....+...+..+....++|+++||- .++
T Consensus         3 ~~~v~IvG~GliG~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~l----gv~d~~~~~~~~~~~~~aDlVivavPi-~~~   77 (279)
T COG0287           3 SMKVGIVGLGLMGGSLARALKEAGLVVRIIGRDRSAATLKAALEL----GVIDELTVAGLAEAAAEADLVIVAVPI-EAT   77 (279)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHC----CCCHHHCCCHHHHHCCCCCEEEEECCH-HHH
T ss_conf             648999877467799999999769847997247746778776635----853010011555413569989995778-899


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCC--CCCCCCC-EE-EEEC--CHHHHHHHH
Q ss_conf             999999972078998999679865789999999998479943067-546760--0035684-37-8845--489998889
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGV--KGARSGA-SL-MVGG--NEKAYNRVE  155 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~--~gA~~G~-sl-MvGG--~~~~~~~~~  155 (475)
                      .+++.++.|.+++|.+|.|.|++--.-.....+...+.. +|++. |+-|++  .+-..+. .+ +++.  +++.+++++
T Consensus        78 ~~~l~~l~~~l~~g~iv~Dv~S~K~~v~~a~~~~~~~~~-~~vg~HPM~G~~~~~~lf~~~~~vltp~~~~~~~~~~~~~  156 (279)
T COG0287          78 EEVLKELAPHLKKGAIVTDVGSVKSSVVEAMEKYLPGDV-RFVGGHPMFGPEADAGLFENAVVVLTPSEGTEKEWVEEVK  156 (279)
T ss_pred             HHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHCCCCC-EEEECCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             999998630379998897364201789999997466777-0782189998743112337967999479998789999999


Q ss_pred             HHHHHHHCCCCCCCEEEEECCC
Q ss_conf             9999875015678618985698
Q gi|254780716|r  156 NILLSISAKYQNSPCCALLGPD  177 (475)
Q Consensus       156 piL~~iaak~~~~~cv~y~G~~  177 (475)
                      .++++..++      +.++-+.
T Consensus       157 ~~~~~~ga~------~v~~~~e  172 (279)
T COG0287         157 RLWEALGAR------LVEMDAE  172 (279)
T ss_pred             HHHHHCCCE------EEECCHH
T ss_conf             999974988------9986888


No 30 
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed
Probab=99.24  E-value=9.5e-08  Score=76.67  Aligned_cols=246  Identities=15%  Similarity=0.156  Sum_probs=139.1

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC----EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             998805698157111688999997898----5999739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF----RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~----~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |+| +|||||.|+||.+|+.-|+++|+    ++.++||++++.+.+.++.     ++..+.+..+.++.   +++|+++|
T Consensus         1 M~k-kI~fIG~GnMg~Aii~Gl~~~~~~~~~~i~~~~~~~~~~~~~~~~~-----~~~~~~~~~e~~~~---~Dii~LaV   71 (272)
T PRK12491          1 MNK-QIGFIGCGNMGIAMIGGMINKNIVSPDQIICSDLNVSNLKNASDKY-----GITITTNNNEVANS---ADILILSI   71 (272)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHC-----CCEEECCHHHHHHH---CCEEEEEE
T ss_conf             998-6999856799999999999788989676999697999999999971-----97886687999731---99999995


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCCEEC-CCCCCCCCCCCCCCEEEEEC---CHHHH
Q ss_conf             99069999999997207899899967-986578999999999847994306-75467600035684378845---48999
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIYFIG-IGVSGGVKGARSGASLMVGG---NEKAY  151 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~fid-~pVSGG~~gA~~G~slMvGG---~~~~~  151 (475)
                      +. +.+.+|+.++.+.+.++.+||-. .....+   .+.+.+ ..+...+- ||=  .+.--..|.+.+..+   +++..
T Consensus        72 KP-~~~~~vl~~l~~~~~~~~lviSi~AGi~i~---~l~~~l-~~~~~vvR~MPN--~~a~v~~g~t~i~~~~~~~~~~~  144 (272)
T PRK12491         72 KP-DLYSSVINQIKDQIKNDVIVVTIAAGKSIK---STENEF-DRKLKVIRVMPN--TPVLVGEGMSALCFNEMVTEKDI  144 (272)
T ss_pred             CH-HHHHHHHHHHHHHCCCCCEEEEEECCCCHH---HHHHHH-CCCCCEEEECCC--HHHHHCCCCEEEECCCCCCHHHH
T ss_conf             77-899999999865526991899984899989---999981-899857997897--69996369657834998999999


Q ss_pred             HHHHHHHHHHHCCC-CCCCEE-EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             88899999875015-678618-9856987467898877678788899989999999964289978999999860688443
Q gi|254780716|r  152 NRVENILLSISAKY-QNSPCC-ALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS  229 (475)
Q Consensus       152 ~~~~piL~~iaak~-~~~~cv-~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~  229 (475)
                      +.++.+|+.++.-. .++..+ ....=+|||-       +--|-.++.+.++-  .  ..+++.++-.++..        
T Consensus       145 ~~v~~lf~~~G~~~~~~E~~~d~~TalsGSgP-------Ay~~~~~eal~~a~--v--~~Gl~~~~A~~l~~--------  205 (272)
T PRK12491        145 KEVLNIFNIFGQTEVVNEKLMDVVTSISGSSP-------AYVYMFIEAMADAA--V--LGGMPRKQAYKFAA--------  205 (272)
T ss_pred             HHHHHHHHCCCEEEEECCCCHHHHHHHHCCHH-------HHHHHHHHHHHHHH--H--HCCCCHHHHHHHHH--------
T ss_conf             99999972476499963531101457834759-------99999999999999--9--84989999999999--------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             0799999999974056799952001023336587167789887751788851467778
Q gi|254780716|r  230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIF  287 (475)
Q Consensus       230 syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~  287 (475)
                       .++.=+++.+.+.    +...-+.+..+....||. -.....|+.+-=-..|..|+.
T Consensus       206 -~~~~G~~~ll~~~----~~~p~~L~~~V~SpgGtT-~aGl~~Le~~g~~~~i~~Ai~  257 (272)
T PRK12491        206 -QAVLGSAKMVLET----GIHPGELKDMVCSPGGTT-IEAVATLEEKGLRTAIISAMK  257 (272)
T ss_pred             -HHHHHHHHHHHHC----CCCHHHHHHHCCCCCHHH-HHHHHHHHHCCHHHHHHHHHH
T ss_conf             -9999999999864----999999998278997879-999999998882999999999


No 31 
>PRK07680 late competence protein ComER; Validated
Probab=99.22  E-value=1.2e-07  Score=75.79  Aligned_cols=257  Identities=19%  Similarity=0.205  Sum_probs=142.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC----EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             05698157111688999997898----59997399899999997122112784032898999860577889999769906
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF----RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~----~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      +|||||.|+||.+|++.|++.|.    ++.++||++++...+.+...    ++..+.+..+.+...   ++|+++|.. +
T Consensus         2 kI~fIG~GnMg~Aii~gl~~~~~~~~~~i~i~~r~~~~~~~l~~~~~----~i~~~~~~~~~~~~~---dvIiLaVKP-q   73 (273)
T PRK07680          2 NIGFIGTGNMGTILIEAFLESRAVKPSCLTITNRTPAKAYHIKEKYP----SIHVAKTIEEVIEQS---ELIFICVKP-L   73 (273)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCC----CEEEECCHHHHHHCC---CEEEEECCH-H
T ss_conf             89998769999999999997799894569998899899999998769----908868889998409---989996488-8


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEE---ECCHHHHHHHHH
Q ss_conf             999999999720789989996798-6578999999999847994306754676000356843788---454899988899
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGN-SHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMV---GGNEKAYNRVEN  156 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~st-s~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMv---GG~~~~~~~~~p  156 (475)
                      ++.+|+.++.+.+.++.+||-.-- ...+   ++.+.+..+-++.+  |-  .+.....|.+.+.   .-+++..+.++.
T Consensus        74 ~~~~vl~~i~~~~~~~~~iISi~AGisi~---~l~~~~~~~vvR~M--PN--~~~~~~~G~t~~~~~~~~~~~~~~~v~~  146 (273)
T PRK07680         74 DIYPLLKKLAPHFSDEKCLVSITSPISPE---QLETLVPCQVARII--PS--ITNRALSGASLVTFGNNCSEEWQQKLLR  146 (273)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHH---HHHHHCCCCCEEEE--CC--CCHHHCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             89999999886347884899955888899---99974799815886--78--8602143327997589999999999999


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             999875015678618985698746789887767878--889998999999996428997899999986068844307999
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEY--ANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK  234 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey--~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~  234 (475)
                      +|+.++.-       .++-+.----+.=+.=-|--|  -.++.+.++-  .++ .|++.++-.++..+         .+.
T Consensus       147 lf~~~G~~-------~~i~E~~~d~~talsGSGPAy~~~~~eal~~a~--v~~-~Gl~~~~A~~l~~~---------t~~  207 (273)
T PRK07680        147 LFKNISTP-------LVIEEDITRVASDIVSCGPAFFSYLLQRFINAA--VDK-TNITKEEATTLVTE---------MVV  207 (273)
T ss_pred             HHHHCCEE-------EEECHHHHHHHHHHHCCCHHHHHHHHHHHHHHH--HHH-CCCCHHHHHHHHHH---------HHH
T ss_conf             99738779-------998578876788861684899999999999999--998-59999999999999---------999


Q ss_pred             HHHHHHHHCCCCCCCCCHHHCCCC-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999740567999520010233-365871677898877517888514677788877500577999875
Q gi|254780716|r  235 ITAEILSSSDTITGMPIIDVICDK-ASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS  303 (475)
Q Consensus       235 i~~~il~~k~~~~g~~lid~i~d~-~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~k~~R~~~~~  303 (475)
                      =+++.+...    +.. ...+.|. +...|| +-.....||-+  ++-+....+.|..-.+++.-.+.++
T Consensus       208 G~a~ll~~~----~~~-~~~L~~~V~SPgGt-T~~gl~~Le~~--~~~~f~~a~~~a~~r~~e~~~~~~~  269 (273)
T PRK07680        208 GLGKLLEKG----LYT-LPTLQEKVCVKGGV-TGEGIRVLEEH--VGDMFHKLFERTHEKFDEDLEKVKQ  269 (273)
T ss_pred             HHHHHHHCC----CCC-HHHHHHCCCCCCHH-HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999827----989-89999807899725-99999999972--5999999999999999999999999


No 32 
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=99.20  E-value=8.8e-08  Score=76.92  Aligned_cols=243  Identities=15%  Similarity=0.179  Sum_probs=138.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC---CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             99880569815711168899999789---859997399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG---FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G---~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |++ +|||||.|+||++|+.-|+++|   +++.++||++++.+.+.++.     ++..+.+..+.++..   ++|+++|+
T Consensus         1 mm~-kI~~IG~G~Mg~Aii~gl~~~~~~~~~i~v~~r~~~~~~~l~~~~-----~v~~~~~~~~~~~~~---diIiLaVK   71 (267)
T PRK11880          1 MMK-KIGFIGGGNMASAIIGGLLASGVPAKDIIVSDPSPEKRAALAEEY-----GVRAATDNQEAAQEA---DVVVLAVK   71 (267)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHH-----CCEEECCHHHHHHCC---CEEEEEEC
T ss_conf             998-799986689999999999977989452899779999999999973-----967857869887219---99999728


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCCEE-CCCCCCCCCCCCCCCEEEEEC---CHHHHH
Q ss_conf             9069999999997207899899967-98657899999999984799430-675467600035684378845---489998
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIYFI-GIGVSGGVKGARSGASLMVGG---NEKAYN  152 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~fi-d~pVSGG~~gA~~G~slMvGG---~~~~~~  152 (475)
                      . +.+++|++++.+.++  .+||-. .....+.   +.+.+. .....+ -||-  .+.-...|.+.+..+   +++..+
T Consensus        72 P-~~~~~vl~~l~~~~~--~~iISv~AGi~i~~---l~~~l~-~~~~ivR~MPN--~~~~v~~G~t~i~~~~~~~~~~~~  142 (267)
T PRK11880         72 P-QVMEDVLSELKGSLD--KLVVSIAAGITLAR---LERALG-ADLPVVRAMPN--TPALVGAGMTALCANALVSEEQRA  142 (267)
T ss_pred             H-HHHHHHHHHHHHHHC--CEEEEECCCCCHHH---HHHHHC-CCCHHHHCCCC--HHHHHCCCCEEEECCCCCCHHHHH
T ss_conf             7-899999999876508--78999169999999---998863-68703420874--899970786466259999999999


Q ss_pred             HHHHHHHHHHCCC--CCCCEE-EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             8899999875015--678618-9856987467898877678788899989999999964289978999999860688443
Q gi|254780716|r  153 RVENILLSISAKY--QNSPCC-ALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS  229 (475)
Q Consensus       153 ~~~piL~~iaak~--~~~~cv-~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~  229 (475)
                      .++.+|+.++.-.  +++..+ ...+=+|||-       +--|-.++++.++-  .+  .|++.++-.++-         
T Consensus       143 ~v~~lf~~~G~~~~v~~E~~~d~~TalsGsGP-------Ay~~~~~eal~~a~--v~--~Gl~~~~A~~l~---------  202 (267)
T PRK11880        143 FALELLSAVGEVVWVDDESQMDAVTAVSGSGP-------AYVFLFIEALADAG--VK--LGLPRETARKLA---------  202 (267)
T ss_pred             HHHHHHHHCCCEEEECCHHCCCHHHHHHCCCH-------HHHHHHHHHHHHHH--HH--CCCCHHHHHHHH---------
T ss_conf             99999972586799884210221134517717-------99999999999999--98--699799999999---------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             079999999997405679995200102333658716778988775178885146777
Q gi|254780716|r  230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAI  286 (475)
Q Consensus       230 syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av  286 (475)
                      ..++.=++..+.+.    +.+ .+.+.|.+..+|--.-....+|+-+-=-..+..|+
T Consensus       203 ~qt~~G~a~ll~~~----~~~-p~~L~~~V~SpgGtT~~gl~~Le~~g~~~~i~~Ai  254 (267)
T PRK11880        203 AQTVLGAAKLLLES----GEH-PAELRDNVTSPGGTTIAALRVLEEGGFRAAVIEAV  254 (267)
T ss_pred             HHHHHHHHHHHHHC----CCC-HHHHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             99999999999872----999-99999836799653999999999888499999999


No 33 
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=99.17  E-value=1.5e-09  Score=90.02  Aligned_cols=113  Identities=16%  Similarity=0.203  Sum_probs=89.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC-------------CCCCCEECCCHHHHHHHCCCCCE
Q ss_conf             05698157111688999997898599973998999999971221-------------12784032898999860577889
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG-------------LSQKVIVTKNLEQMVEAVCKPRK   71 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~-------------~~~~~~~~~s~~e~v~~l~~pr~   71 (475)
                      +|+|||||-.|.++|..|+++|++|.+||.++++++.+.+....             ...+.....+..+.+   ..+++
T Consensus         2 kI~ViGlGyVGl~~a~~la~~G~~V~g~D~d~~~v~~ln~g~~p~~E~~l~~~l~~~~~~~~~~~~~~~~~i---~~~d~   78 (185)
T pfam03721         2 RIAVIGLGYVGLPTAVCLAEIGHDVVGVDINQSKIDKLNNGKIPIYEPGLEELLKANVSGRLRFTTDVAEAI---KEADV   78 (185)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCEEEECCHHHHH---HHCCE
T ss_conf             799989787489999999948993999979989999986268974675889999873408969987879988---44989


Q ss_pred             EEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             99976990---------69999999997207899899967986578999999999847
Q gi|254780716|r   72 ILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK  120 (475)
Q Consensus        72 Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k  120 (475)
                      ||+|||.+         ..+.+++..+.+.+++++++|--||..|-.+++..+.+.++
T Consensus        79 i~I~VpTP~~~~~~~d~s~l~~~~~~i~~~l~~~~liii~STVppGtt~~~~~~l~~~  136 (185)
T pfam03721        79 IFIAVPTPSKKGGAPDLTYVESAARTIGPVLKKGKVVVVKSTVPPGTTEEVVKPILEK  136 (185)
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             9997368765576766359999999997446799899991899988689999999997


No 34 
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed
Probab=99.16  E-value=2.7e-07  Score=73.30  Aligned_cols=249  Identities=14%  Similarity=0.134  Sum_probs=143.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC----EEEEEECCHH-HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             998805698157111688999997898----5999739989-99999971221127840328989998605778899997
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF----RLAVYNKDFE-LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~----~V~vydr~~~-~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      |+..+|||||.|+||.+|+..|.+.++    ++.+++|+.+ +.+.+.++.     .+..+.+..+.++.   +++|+++
T Consensus         1 m~mm~I~fIG~GnMg~Aii~gl~~~~~~~~~~i~v~~r~~~~~~~~l~~~~-----~v~~~~~~~~~~~~---~diI~La   72 (279)
T PRK07679          1 MSIQNISFLGAGSIAEAIIGGLLHANVVKGEQITVSNRSNETRLQELHQKY-----GVKGTHNKKELLTD---ANILFLA   72 (279)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHH-----CCEEECCHHHHHHH---CCEEEEE
T ss_conf             997889998768999999999997879997579997898499999999971-----96663777999844---9999995


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE-CCCCCCCCCCCCCCCEEEE-E--CCHHHH
Q ss_conf             69906999999999720789989996798657899999999984799430-6754676000356843788-4--548999
Q gi|254780716|r   76 VTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI-GIGVSGGVKGARSGASLMV-G--GNEKAY  151 (475)
Q Consensus        76 vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi-d~pVSGG~~gA~~G~slMv-G--G~~~~~  151 (475)
                      |+. +.+.+|+..+.+.+.++.+||-.-..-.  ..++.+.+. .+...+ -||=  .+..-..|.+.+. +  -+++..
T Consensus        73 VKP-~~~~~v~~~i~~~~~~~~~iISi~AGi~--~~~l~~~l~-~~~~ivR~MPN--~~~~vg~g~t~i~~~~~~~~~~~  146 (279)
T PRK07679         73 MKP-KDVAEALTPFKEYIHNNVLIISLLAGVS--THSIRNLLQ-KDVPIIRAMPN--TSAAILKSATAISPSKHATAEHI  146 (279)
T ss_pred             CCH-HHHHHHHHHHHHHCCCCCEEEEECCCCC--HHHHHHHCC-CCCCEEEECCC--HHHHHHCCCEEECCCCCCCHHHH
T ss_conf             278-9999999998754589929999747888--999997529-99857983597--67885057735527999999999


Q ss_pred             HHHHHHHHHHHCCC-CCCCEE-EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             88899999875015-678618-9856987467898877678788899989999999964289978999999860688443
Q gi|254780716|r  152 NRVENILLSISAKY-QNSPCC-ALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS  229 (475)
Q Consensus       152 ~~~~piL~~iaak~-~~~~cv-~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~  229 (475)
                      +.++.+|+.++.-. -++..+ ...+=+|||-       +--|-.++++.++-  .  ..|++.++-.+.         -
T Consensus       147 ~~v~~lf~~~G~~~~v~E~~~d~~TalsGSgP-------Af~~~~~eal~~a~--~--~~Gl~~~~A~~l---------~  206 (279)
T PRK07679        147 QTAKALFETIGLVSVVEEEDMHAVTALSGSGP-------AYIYYVVEAMEEAA--K--KIGLKEDVAKSL---------I  206 (279)
T ss_pred             HHHHHHHHHCCEEEEECHHHCCCHHHEECCHH-------HHHHHHHHHHHHHH--H--HCCCCHHHHHHH---------H
T ss_conf             99999996178599954333032100016648-------99999999999999--9--839999999999---------9


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             07999999999740567999520010233365871677898877517888514677788
Q gi|254780716|r  230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFA  288 (475)
Q Consensus       230 syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~a  288 (475)
                      ..++.=+++.+...+.     -.+.+.|.+..+|=-.+.....|+.+-=-.++..|+.+
T Consensus       207 ~~t~~G~a~ll~~~~~-----~p~~L~~~V~SpgGtT~~gl~~Le~~~~~~~i~~Av~a  260 (279)
T PRK07679        207 LQTMIGAAEMLKASEK-----HPSILRKEITSPGGTTEAGIEVLQEHKFQQALISCITQ  260 (279)
T ss_pred             HHHHHHHHHHHHHCCC-----CHHHHHHHCCCCCHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             9999999999984699-----99999984689946599999999988819999999999


No 35 
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=99.12  E-value=5.6e-08  Score=78.34  Aligned_cols=193  Identities=16%  Similarity=0.192  Sum_probs=130.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH---HHHC-----------CCCCCCCEECCCHHHHHHHC
Q ss_conf             998805698157111688999997898599973998999999---9712-----------21127840328989998605
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVF---IKKI-----------SGLSQKVIVTKNLEQMVEAV   66 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l---~~~~-----------~~~~~~~~~~~s~~e~v~~l   66 (475)
                      |-| +|++||-|.||..+|..++.+||+|.+||++++..+.+   ++..           .....++..+.+++|.++  
T Consensus         1 MIk-kVAVIGAGvMGsGwAa~FA~aG~~V~L~Dp~peA~~ki~~~l~~a~~al~~L~~~~l~~~grL~~~~sL~eAV~--   77 (489)
T PRK07531          1 MIM-KAACIGGGVIGGGWAARFLLNGWDVAVFDPHPEAERIIGEVLANARRALPGLTDAPLPPEGRLSFCASLAEAVA--   77 (489)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCHHHHHC--
T ss_conf             976-79998718868999999995799699994887899999999999999877532035564677686388999974--


Q ss_pred             CCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCC----CCEECCCCCCCCCCCCCCCE
Q ss_conf             77889999769906999999-99972078998999679865789999999998479----94306754676000356843
Q gi|254780716|r   67 CKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG----IYFIGIGVSGGVKGARSGAS  141 (475)
Q Consensus        67 ~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kg----i~fid~pVSGG~~gA~~G~s  141 (475)
                       ..+.|+=++|-.-.++.-+ .+|-..+ +.+.||-.+||.+.-|. +.+.++...    .||.-.|--        =|.
T Consensus        78 -dADlVqEaVPE~LdIKq~vf~eLd~~~-~~~aIiASsTSgl~~S~-l~~~~~~peR~iv~HpfNPp~L--------~PL  146 (489)
T PRK07531         78 -GADWIQESVPERLDLKHKVLAEIEAAA-RPDALIGSSTSGFKPSE-LQEGMTHPERIFVAHPFNPVYL--------LPL  146 (489)
T ss_pred             -CCCEEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEECCCCCCHHH-HHHHCCCCCEEEEECCCCCCCC--------CCE
T ss_conf             -799999878566999999999999767-99838985366588999-9865589550688434687344--------762


Q ss_pred             E-EEEC---CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             7-8845---48999888999998750156786189856987467898877678788899989999999964289978999
Q gi|254780716|r  142 L-MVGG---NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEIS  217 (475)
Q Consensus       142 l-MvGG---~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~  217 (475)
                      + .|+|   ++++.+++..+++.++.+      ..++-..=-||-    -|=+.+   -++-|++.+.+.+ --+.++|-
T Consensus       147 VEvV~g~~T~~~~v~~a~~~~~~iG~~------Pv~v~kEi~Gfi----~nRLq~---Al~rEAl~Lv~~G-iat~ediD  212 (489)
T PRK07531        147 VELVGGGKTSPETIERAKEILREIGMK------PVHIAKEIDAHV----GDRLLE---AVWREALWLVKDG-IATTEEID  212 (489)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCE------EEEEEEEHHHHH----HHHHHH---HHHHHHHHHHHCC-CCCHHHHH
T ss_conf             798168888999999999999982984------369700007778----888999---9999999998779-76789887


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780716|r  218 HLFS  221 (475)
Q Consensus       218 ~vf~  221 (475)
                      ++..
T Consensus       213 ~ai~  216 (489)
T PRK07531        213 DAIR  216 (489)
T ss_pred             HHHH
T ss_conf             9998


No 36 
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=99.12  E-value=1.3e-09  Score=90.47  Aligned_cols=140  Identities=24%  Similarity=0.318  Sum_probs=97.5

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--------CCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             0569815711168899999789859997399899999997122--------11278403289899986057788999976
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS--------GLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~--------~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      +|++||-|.||.+||..|+++|++|.+|.|+++.++.+.+...        ...+++....++++.++.   .++|+++|
T Consensus         2 KI~IiGaG~wGtAla~~la~n~~~V~l~~r~~~~~~~i~~~~~n~~~lp~~~l~~~i~~~~dl~~a~~~---adiIiiav   78 (159)
T pfam01210         2 KIAVLGAGSWGTALAKVLARNGHEVRLWGRDEELIEEINTTRENVKYLPGIKLPDNLRATTDLEEAIKG---ADIIVLAV   78 (159)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHCCCCCHHCCCCCCCCCEEECCCHHHHHHC---CCEEEEEC
T ss_conf             899999699999999999987998999990436667788669782104786455530542889999837---98999917


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH-HHHHHHC-CCCEECCCCCC---CCCCCCCCC-EEEEECCHH
Q ss_conf             9906999999999720789989996798657899999-9999847-99430675467---600035684-378845489
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR-SLQLSEK-GIYFIGIGVSG---GVKGARSGA-SLMVGGNEK  149 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~-~~~l~~k-gi~fid~pVSG---G~~gA~~G~-slMvGG~~~  149 (475)
                      |+ ..++++++++.+++.++.++|.++..-..++..+ .+.+++. +..-+ +-+||   ..+-++.-| ++.++++..
T Consensus        79 ps-~~~~~~~~~i~~~~~~~~~iv~~sKGie~~t~~~~s~i~~~~~~~~~~-~vlsGPs~A~Ev~~~~pta~vias~d~  155 (159)
T pfam01210        79 PS-QALREVLKQLKGLLSPGAILVSLTKGIEPGTLKLLSEIIEEELPINPI-AVLSGPSHAEEVALGLPTATVVASEDQ  155 (159)
T ss_pred             CH-HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCE-EEEECCCHHHHHHCCCCCEEEEECCCH
T ss_conf             48-899999999986557655688875144278875299999987899873-999578649999748981899961994


No 37 
>PRK06545 prephenate dehydrogenase; Validated
Probab=99.12  E-value=9.6e-09  Score=84.01  Aligned_cols=165  Identities=18%  Similarity=0.237  Sum_probs=115.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEE--EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             0569815711168899999789859--99739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRL--AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V--~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +|.|||+|.||..+|+-|.+.|..+  ++||++++..+...+.+..  .  ....++++.   +..+++|++|+|-. .+
T Consensus         2 ~V~IiGlGLIGgSlalalk~~g~~~~i~~~d~~~~~l~~A~~~g~i--d--~~~~~~~~~---~~~~DlVvlatPv~-~~   73 (357)
T PRK06545          2 TVLIVGLGLIGGSLALAIKAAGPDVFIIGYDPSGAQLARALGFGVI--D--ELAEDLARA---AAEADLIVLAVPVD-AT   73 (357)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCC--C--EECCCHHHH---CCCCCEEEECCCHH-HH
T ss_conf             7999977878999999998549976999966999999999868997--7--304887671---56799999949999-99


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCC----CCCCC----C-CEEEE---ECCHH
Q ss_conf             999999972078998999679865789999999998479943067-546760----00356----8-43788---45489
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGV----KGARS----G-ASLMV---GGNEK  149 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~----~gA~~----G-~slMv---GG~~~  149 (475)
                      .+++..+. .+.++.+|.|.|.+-- ...+..+.+-.++.+|++. |+.|.+    +.|..    | +.+++   +-+++
T Consensus        74 ~~~l~~l~-~l~~~~ivTDVgSvK~-~I~~~~~~~~~~~~~FVggHPMAGsEksG~~aA~~~LF~~a~~iltP~~~t~~~  151 (357)
T PRK06545         74 AALLAELA-DLAPGVIVTDVGSVKG-AILAEAEALGLKDVRFVGGHPMAGSHKSGVLAAKAHLFENAPWVLTPDDHVDPE  151 (357)
T ss_pred             HHHHHHHH-HCCCCCEEEECCCCHH-HHHHHHHHHCCCCCCEECCCCCCCCCCCCHHHCCHHHHCCCEEEEECCCCCCHH
T ss_conf             99999987-2389978997510079-999999983688886456798264777471226456866981999638999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             998889999987501567861898569874678988
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM  185 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKM  185 (475)
                      ++++++.+++.+.++      +..|-+.-.=..+=+
T Consensus       152 ~~~~v~~l~~~lGa~------~~~m~~~eHD~~vA~  181 (357)
T PRK06545        152 AVAELKDLLSGTGAK------FVVMDAEEHDRATAL  181 (357)
T ss_pred             HHHHHHHHHHHCCCE------EEECCHHHHHHHHHH
T ss_conf             999999999975998------998188998899998


No 38 
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated
Probab=99.11  E-value=1e-08  Score=83.82  Aligned_cols=153  Identities=21%  Similarity=0.310  Sum_probs=107.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--------CCCCCCEECCCHHHHHHHCCCCCEE
Q ss_conf             99880569815711168899999789859997399899999997122--------1127840328989998605778899
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS--------GLSQKVIVTKNLEQMVEAVCKPRKI   72 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~--------~~~~~~~~~~s~~e~v~~l~~pr~I   72 (475)
                      |+|  |++||-|.||.++|..|+++|++|..|-|+++.++.+.+...        ...+++....++++.++.   .++|
T Consensus         1 Mmk--I~ViGaGawGtAlA~~la~n~~~V~lw~r~~~~~~~In~~~~n~~ylp~i~L~~nI~~t~dl~~~l~~---ad~i   75 (325)
T PRK00094          1 MMK--IAVLGAGSWGTALAILLARNGHDVVLWGRDPEHAAEINTDRENPRYLPGIKLPDNLRATSDLAEALAD---ADLI   75 (325)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCHHHHHHC---CCEE
T ss_conf             988--99989899999999999978997899983899999999649886568978589983897899999837---9849


Q ss_pred             EEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHHHHC-CCCEECCCCCCCC----CCCCCCCE-EEEE
Q ss_conf             9976990699999999972078998999679865789999-99999847-9943067546760----00356843-7884
Q gi|254780716|r   73 LMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI-RSLQLSEK-GIYFIGIGVSGGV----KGARSGAS-LMVG  145 (475)
Q Consensus        73 il~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~-~~~~l~~k-gi~fid~pVSGG~----~gA~~G~s-lMvG  145 (475)
                      ++.+|+ +.+.++++++.+++++..++|-++--.-..+.+ ..+.+++. +.+ ..+.+-.||    +-|+.-|+ +.++
T Consensus        76 iiavPs-~~~~~~l~~i~~~i~~~~~li~~tKGle~~t~~~~seii~~~l~~~-~~~~~lsGP~~A~Eva~~~pt~~via  153 (325)
T PRK00094         76 LVAVPS-HAFREVLKQLKPLLRPDAPIVWATKGIEAGTGKLLSEVAEEELPDQ-APLAVLSGPSFAKEVAQGLPTALVIA  153 (325)
T ss_pred             EEECCH-HHHHHHHHHHHHHCCCCCEEEEEECCEECCCCCCHHHHHHHHCCCC-CCEEEEECCCHHHHHHCCCCEEEEEC
T ss_conf             994576-9999999999864689974999765562488751999999973999-86799817742999980898399950


Q ss_pred             C-CHHHHHHHHHHHHH
Q ss_conf             5-48999888999998
Q gi|254780716|r  146 G-NEKAYNRVENILLS  160 (475)
Q Consensus       146 G-~~~~~~~~~piL~~  160 (475)
                      + +.+.-+.++.+|..
T Consensus       154 s~~~~~~~~~~~lf~~  169 (325)
T PRK00094        154 STDEELAKEVQQLFHS  169 (325)
T ss_pred             CCCHHHHHHHHHHHCC
T ss_conf             7999999999999679


No 39 
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=99.09  E-value=8e-08  Score=77.22  Aligned_cols=193  Identities=18%  Similarity=0.224  Sum_probs=126.9

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CCC-------CCCCCEECCCHHHH
Q ss_conf             998805698157111688999997898599973998999999971-----------221-------12784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------ISG-------LSQKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~~-------~~~~~~~~~s~~e~   62 (475)
                      |+-.+|++||.|.||..+|..++.+|++|.+||++++..+...+.           +.-       ....+....++++ 
T Consensus         1 m~i~~VaViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~dl~~-   79 (282)
T PRK05808          1 MSIQKIGVIGAGTMGNGIAQVCAVAGYDVVMVDISDEAVDRGLATITKSLDRLVKKGKMTEADKEAALARITGTTDLDD-   79 (282)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHH-
T ss_conf             9726899989788999999999957993899979989999999999999999997088642669999952636688889-


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCC-CCCCCCC
Q ss_conf             860577889999769906999999-99972078998999679865789999999998----47994306754-6760003
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGV-SGGVKGA  136 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pV-SGG~~gA  136 (475)
                         +..++.|+=+||-.-.+..-+ .+|-+.+.++.|+. ..||...-+ .+++.+.    =-|.||...|- .--++  
T Consensus        80 ---~~~aDlViEav~E~l~iK~~vf~~le~~~~~~~Ila-SnTSsl~is-~la~~~~~p~R~ig~HffnP~~~~~lVE--  152 (282)
T PRK05808         80 ---LKDADLVIEAAVENMDIKKKIFAQLDEIAKPEAILA-TNTSSLSIT-ELAAATKRPDKVIGMHFFNPVPVMKLVE--  152 (282)
T ss_pred             ---HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE-ECCCCCCHH-HHHHHCCCCHHHCCCCCCCCCCCCCEEE--
T ss_conf             ---675999998775634556999999995579984899-758877669-9997729925420556678723371166--


Q ss_pred             CCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             568437884--548999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  137 RSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       137 ~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                           ++.|  -++++.+++..+++.+...      ...+. .-.|.    |-|-|.+   -.+.|++.++..+ --+++
T Consensus       153 -----iv~g~~Ts~~~~~~~~~~~~~lgk~------pV~vk-d~pGF----i~NRl~~---a~~~ea~~lv~eG-va~~~  212 (282)
T PRK05808        153 -----IIRGLATSDATHEAVEALAKKIGKT------PVEVN-NAPGF----VVNRILI---PMINEAIFVLAEG-VATAE  212 (282)
T ss_pred             -----EECCCCCCHHHHHHHHHHHHHCCCE------EEEEC-CCCCH----HHHHHHH---HHHHHHHHHHHCC-CCCHH
T ss_conf             -----7279999999999999999874984------79981-77750----8999999---9999999999839-99999


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254780716|r  215 EISHLFS  221 (475)
Q Consensus       215 ~i~~vf~  221 (475)
                      +|-.++.
T Consensus       213 dID~~~~  219 (282)
T PRK05808        213 DIDEGMK  219 (282)
T ss_pred             HHHHHHH
T ss_conf             9999877


No 40 
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=99.06  E-value=9.6e-08  Score=76.62  Aligned_cols=191  Identities=14%  Similarity=0.203  Sum_probs=128.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC------------------CCCCCCEECCCHHHHHHH
Q ss_conf             80569815711168899999789859997399899999997122------------------112784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS------------------GLSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~------------------~~~~~~~~~~s~~e~v~~   65 (475)
                      ++||+||.|.||..+|..++.+|++|.+||++++..+...+.-.                  .....+..+.++++.   
T Consensus         3 ~~VaViGaG~mG~giA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~l~~~~~~g~~~~~~~~~~~~ri~~~~~l~~a---   79 (308)
T PRK06129          3 GSIAIVGAGLIGRAWAIVFARAGHRVRLWDADPAALAAAPAYIAGRLEDLAAFDLLDGESPDAVLARIRATDSLADA---   79 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCEEECCCHHHH---
T ss_conf             87999777899999999998589938999898899999999999999999976999876599998350722888998---


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC----CCCEECCCCCCCCCCCCCCC
Q ss_conf             577889999769906999999-9997207899899967986578999999999847----99430675467600035684
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK----GIYFIGIGVSGGVKGARSGA  140 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k----gi~fid~pVSGG~~gA~~G~  140 (475)
                      +...+.|+=++|-.-.++.-+ .+|-..+ +.++|+-.+||...-+ .+++.++..    +.||.-.|--        =|
T Consensus        80 l~~adlViEav~E~l~iK~~lf~~le~~~-~~~~IlaSnTSsl~is-~la~~~~~p~R~ig~HffNPp~l--------~p  149 (308)
T PRK06129         80 VADADYVQESAPENLELKRALFAELDALA-PPHAILASSTSALLAS-AFTEHLAGRERCLVAHPINPPYL--------IP  149 (308)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCCHH-HHHHHCCCCCCEEEECCCCCHHC--------CC
T ss_conf             47499999998077999999999999656-9855898455538899-99974598541788777786000--------63


Q ss_pred             EE-EEEC---CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             37-8845---4899988899999875015678618985698746789887767878889998999999996428997899
Q gi|254780716|r  141 SL-MVGG---NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEI  216 (475)
Q Consensus       141 sl-MvGG---~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i  216 (475)
                      .+ .+.|   ++++.+++..+++.+..+      -..+...--|+.+    |-+.+   -.+-|++.++..+ --+.++|
T Consensus       150 LVEIV~g~~Ts~~~v~~~~~~~~~lGk~------PV~v~ke~pGFi~----NRl~~---a~~~EA~~Lv~eG-vas~edI  215 (308)
T PRK06129        150 VVEVVPAPWTAPATVARAHALYRAAGQS------PVRLRREIDGFVL----NRLQG---ALLREAFRLVADG-VASVEDI  215 (308)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHCCCE------EEEEECCCCCHHH----HHHHH---HHHHHHHHHHHCC-CCCHHHH
T ss_conf             1567179998989999999999983998------8999025621589----99999---9999999999859-9899999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780716|r  217 SHLFS  221 (475)
Q Consensus       217 ~~vf~  221 (475)
                      -+++.
T Consensus       216 D~a~~  220 (308)
T PRK06129        216 DAVIR  220 (308)
T ss_pred             HHHHH
T ss_conf             99998


No 41 
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=99.05  E-value=3.6e-07  Score=72.43  Aligned_cols=97  Identities=19%  Similarity=0.298  Sum_probs=76.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC-------CCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             0569815711168899999789859997399899999997122112-------784032898999860577889999769
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS-------QKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~-------~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      +|++||.|.||.-+|..|.+.|++|..+.|.++..+.+.+.|-...       ..+....+++    .+..+++||++++
T Consensus         2 kI~IiGaGaiG~~~a~~L~~ag~~V~li~r~~~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~----~~~~~D~iiv~vK   77 (307)
T PRK06522          2 KIAILGAGAIGGLFGARLAQAGHDVTLVARGATLAEALNENGLRLLEGGEVFVVPVPAADDPA----ELGPQDLVILAVK   77 (307)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCEEEECCCCEEECCCCCCCCHH----HCCCCCEEEEECC
T ss_conf             899999149999999999848998899978888999999689399528976980550348866----7489888999806


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             90699999999972078998999679865
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                      + .++++++..+.|.+.++.+|+-.-|.-
T Consensus        78 s-~~~~~a~~~l~~~l~~~t~iv~lqNG~  105 (307)
T PRK06522         78 A-YQLPAALPDLAPLLGPETVVLFLQNGV  105 (307)
T ss_pred             C-CCHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             6-689999999986459994899961686


No 42 
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent.
Probab=99.03  E-value=4.4e-09  Score=86.50  Aligned_cols=91  Identities=20%  Similarity=0.365  Sum_probs=72.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             05698157111688999997898599-97399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +|||||.|+||.+|+..|+++|+++. +++|++++.+.+.++...   . ....+..|.++   .+++|+++||. +.+.
T Consensus         1 KIg~IG~G~mg~ai~~~l~~~g~~~~~~~~r~~~~~~~~~~~~~~---~-~~~~~~~~~~~---~~DvIilavkp-~~~~   72 (93)
T pfam03807         1 KIGIIGAGNMGEALARGLAAAGHEVIIANSRNPEKAAALAEELGV---G-ATAVSNEEAAE---EADVVILAVKP-EDAP   72 (93)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHCC---C-CCCCCHHHHHH---CCCEEEEEECH-HHHH
T ss_conf             989997009999999999977996127864878999999998199---7-64589999974---49989999799-9999


Q ss_pred             HHHHHHHHCCCCCCEEEECCC
Q ss_conf             999999720789989996798
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~st  104 (475)
                      +|+.++.+.+ ++.++|+..+
T Consensus        73 ~vl~~i~~~~-~~k~vISv~a   92 (93)
T pfam03807        73 EVLAELADLL-KGKLVISITN   92 (93)
T ss_pred             HHHHHHHHHC-CCCEEEEECC
T ss_conf             9999876250-8999998099


No 43 
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=99.01  E-value=1.8e-07  Score=74.69  Aligned_cols=194  Identities=16%  Similarity=0.245  Sum_probs=123.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------HCCCC--------CCCCEECCCHHH
Q ss_conf             99880569815711168899999789859997399899999997-----------12211--------278403289899
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK-----------KISGL--------SQKVIVTKNLEQ   61 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~-----------~~~~~--------~~~~~~~~s~~e   61 (475)
                      |+-.+|++||.|.||..+|.-++.+|++|.+||++++..+...+           .+...        ...+....++++
T Consensus         1 M~i~~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~dl~~   80 (288)
T PRK08293          1 MTIKKVTVAGAGVLGSQIAFQTAFKGFDVTIYDISEEALDAAKRRLAKLADRYVRDLHLTDEAFAAAAKNRITFTTDLAQ   80 (288)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHH
T ss_conf             99578999897889999999999579928999898899999999999999999970599917899999807730589899


Q ss_pred             HHHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCCCCCCCCC
Q ss_conf             9860577889999769906999999-999720789989996798657899999999984----79943067546760003
Q gi|254780716|r   62 MVEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGVSGGVKGA  136 (475)
Q Consensus        62 ~v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pVSGG~~gA  136 (475)
                         +++.++.|+=++|..-.+..-+ .+|-..+.++ .|+-..||...-+. +++.+..    -|.||...|--      
T Consensus        81 ---a~~~aDlViEav~E~l~iK~~lf~~le~~~~~~-~IlaSNTSsl~it~-la~~~~~p~R~ig~HffnP~~~------  149 (288)
T PRK08293         81 ---AVKDADLVIEAVPEDPEIKGDFYEQLAEVAPEK-TIFATNSSTLLPSQ-FADATGRPEKFLALHFANHIWK------  149 (288)
T ss_pred             ---HHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCCHHH-HHHHCCCCHHEEEECCCCCCCC------
T ss_conf             ---846699999978087999999999999746776-69986687676579-9886199223343033588342------


Q ss_pred             CCCCE--EEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             56843--7884--5489998889999987501567861898569874678988776787888999899999999642899
Q gi|254780716|r  137 RSGAS--LMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKN  212 (475)
Q Consensus       137 ~~G~s--lMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~  212 (475)
                        -+.  +..|  -++++++.+..+++.+..+      -..+.+.--|.    |-|-|.   ...+.|++.++..+ .-+
T Consensus       150 --m~LVEiv~g~~Ts~e~~~~~~~~~~~lgk~------pvvv~~d~pGF----i~NRl~---~~~~~Ea~~lv~eG-va~  213 (288)
T PRK08293        150 --NNTAEIMGHPGTDPEVYETVVAFAKAIGMV------PIVLKKEQPGY----ILNSLL---VPFLDAALALWAKG-VAD  213 (288)
T ss_pred             --CCEEEECCCCCCCHHHHHHHHHHHHHCCCE------EEEECCCCCCE----EHHHHH---HHHHHHHHHHHHHC-CCC
T ss_conf             --752644389999999999999999983998------99985776984----099999---99999999999918-999


Q ss_pred             HHHHHHHHH
Q ss_conf             789999998
Q gi|254780716|r  213 PLEISHLFS  221 (475)
Q Consensus       213 ~~~i~~vf~  221 (475)
                      .++|-.++.
T Consensus       214 ~e~ID~a~~  222 (288)
T PRK08293        214 PETIDKTWM  222 (288)
T ss_pred             HHHHHHHCH
T ss_conf             999998670


No 44 
>PRK07660 consensus
Probab=98.99  E-value=2.9e-07  Score=73.12  Aligned_cols=194  Identities=20%  Similarity=0.235  Sum_probs=125.1

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC------------------CCCCCEECCCHHHH
Q ss_conf             998805698157111688999997898599973998999999971221------------------12784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG------------------LSQKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~------------------~~~~~~~~~s~~e~   62 (475)
                      |.-.+|++||.|.||..+|..++.+|++|.+||++++..+...+....                  ....+....+++  
T Consensus         1 M~Ik~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~~~--   78 (283)
T PRK07660          1 MGVQKIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQLDRGLAIITKNLARQVEKGRMKEEEKEATLNRLTVTLDLD--   78 (283)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHH--
T ss_conf             997889998969899999999996698189997988999999999999999998705899899999983587768989--


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHH-HHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCC-CCCCCCC
Q ss_conf             86057788999976990699999-9999720789989996798657899999999984----7994306754-6760003
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQL-IDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGV-SGGVKGA  136 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~v-i~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pV-SGG~~gA  136 (475)
                        .+..++.|+=++|-.-.+..- +.+|-..+.++.| +-..||...-+. ++..+..    -|.||...|- .--.+  
T Consensus        79 --~~~~aDlViEav~E~l~iK~~lf~~l~~~~~~~~I-laSNTS~l~i~~-ia~~~~~p~R~ig~HffnP~~~m~LVE--  152 (283)
T PRK07660         79 --CVKEADLIIEAAVEKMDIKKKIFANLDEIAPEHAI-LATNTSSLPITE-IAAVTKRPEKVIGMHFMNPVPVMKLVE--  152 (283)
T ss_pred             --HHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCE-EEECCCCCCCHH-HHHHCCCCHHCCCCCCCCCCCCCCEEE--
T ss_conf             --97689999987857544429999999964799718-986588887325-566517824304666678856572154--


Q ss_pred             CCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             568437884--548999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  137 RSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       137 ~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                           ++.|  -++++.+++..+++.+...      ...+. .--|.    |-|-|.   ...+.|++.++..+ --+.+
T Consensus       153 -----Iv~g~~T~~~~~~~~~~~~~~lgk~------pV~v~-d~pGF----i~NRl~---~~~~~ea~~lv~eG-va~~e  212 (283)
T PRK07660        153 -----IIRGLATDDAVYETIEDITKKIGKV------PVEVN-DFPGF----VSNRIL---LPMINEAIYTLYEG-VATKE  212 (283)
T ss_pred             -----ECCCCCCCHHHHHHHHHHHHHCCCE------EEEEC-CCCCC----HHHHHH---HHHHHHHHHHHHCC-CCCHH
T ss_conf             -----5699999799999999999875942------79983-78973----279878---99999999999819-99999


Q ss_pred             HHHHHHHH
Q ss_conf             99999986
Q gi|254780716|r  215 EISHLFSK  222 (475)
Q Consensus       215 ~i~~vf~~  222 (475)
                      +|-.++..
T Consensus       213 ~iD~~~~~  220 (283)
T PRK07660        213 AIDEVMKL  220 (283)
T ss_pred             HHHHHHHH
T ss_conf             99998675


No 45 
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed
Probab=98.99  E-value=1.9e-06  Score=67.07  Aligned_cols=141  Identities=13%  Similarity=0.248  Sum_probs=92.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC---EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898---599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF---RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~---~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|||||.|+||.+|++-|++.|+   ++.+++|++++.+.+.++..    .+..+.+-.++++..   ++|+++|+. +.
T Consensus         2 kIgfIG~GnMg~Aii~Gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~----~v~~~~~n~~~~~~~---dvi~LaVKP-~~   73 (255)
T PRK06476          2 RIGFIGTGAITEAMVTGLLSSPADVSEIIVSPRNAQIAARLAARFA----KVRIAKDNQAVVDRS---DVVFLAVRP-QI   73 (255)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCC----CEEEECCHHHHHHHC---CEEEEEECH-HH
T ss_conf             8999864699999999999788992508898989899999998769----559857889998518---878886178-88


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-EECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             999999997207899899967986578999999999847994-3067546760003568437884548999888999998
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
                      +++|++++.  +.++.+||-.--.-  ...++.+.+.. +.. .=-||-  .+..-..|.+.++..+    +.++.+|+.
T Consensus        74 ~~~vl~~l~--~~~~~~vISi~AGi--~i~~l~~~l~~-~~~vvR~MPN--~~~~~g~g~t~i~~~~----~~v~~lf~~  142 (255)
T PRK06476         74 AEEVLRALR--FRPGQTVISVIAAT--TRAALLKWIGA-DVKLVRAIPL--PFVAERKGVTAIYPPD----PFVRALFDA  142 (255)
T ss_pred             HHHHHHHHH--CCCCCEEEEECCCC--CHHHHHHHHCC-CCCEEEECCC--CHHHHCCCCEEECCCH----HHHHHHHHH
T ss_conf             998877620--57897899973787--79999976189-9864885587--0888468862214867----999999983


Q ss_pred             HHCC
Q ss_conf             7501
Q gi|254780716|r  161 ISAK  164 (475)
Q Consensus       161 iaak  164 (475)
                      ++.-
T Consensus       143 ~G~~  146 (255)
T PRK06476        143 LGTA  146 (255)
T ss_pred             CCCE
T ss_conf             8998


No 46 
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=98.98  E-value=3.7e-07  Score=72.34  Aligned_cols=194  Identities=13%  Similarity=0.186  Sum_probs=124.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH--------------CCC-------CCCCCEECCCH
Q ss_conf             998805698157111688999997898599973998999999971--------------221-------12784032898
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK--------------ISG-------LSQKVIVTKNL   59 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~--------------~~~-------~~~~~~~~~s~   59 (475)
                      |.-.+||+||.|.||..+|..++.+|++|.+||++++..+...+.              +.-       ....+....++
T Consensus         1 M~Ik~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~a~~~i~~~~~~l~~l~~~~~~~~~~~~~~~~~i~~~~~~   80 (291)
T PRK06035          1 MDIKVIGVVGSGVMGQGIAQVFARTGYDVTIVDVSEEILKNAMELIESGPYGLRNLVEKGKMSEDEAKAIMARIRTSTSY   80 (291)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCH
T ss_conf             99588999887688999999999589988999899899999999999718999999866899999999998366435888


Q ss_pred             HHHHHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCC-CCCC
Q ss_conf             999860577889999769906999999-999720789989996798657899999999984----7994306754-6760
Q gi|254780716|r   60 EQMVEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGV-SGGV  133 (475)
Q Consensus        60 ~e~v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pV-SGG~  133 (475)
                      +    ++..++.|+=++|-.-.+..-+ .+|-..+.++.|+ -..||...-+. +++.+..    -|.||...|- .--+
T Consensus        81 ~----~~~~aDlViEav~E~l~iK~~lf~~l~~~~~~~~Il-aSNTSsl~is~-ia~~~~~p~R~ig~HffnP~~~~~LV  154 (291)
T PRK06035         81 E----SLSDADFIVEAVPEKLDLKRKVFAELERNVSPETII-ASNTSGIMIAE-IATALERKDRFIGMHWFNPAPVMKLI  154 (291)
T ss_pred             H----HHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEE-EECCCCCCHHH-HHHHCCCCHHEEEECCCCCCCCCCEE
T ss_conf             8----976599999888388999999999999658998379-86088778699-99765994223641126870116336


Q ss_pred             CCCCCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             003568437884--548999888999998750156786189856987467898877678788899989999999964289
Q gi|254780716|r  134 KGARSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNK  211 (475)
Q Consensus       134 ~gA~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~  211 (475)
                      +       ++.|  -++++.+.+..+++.+...      ...+. ..-|.    |-|-|..   ..+.|++.++..+ --
T Consensus       155 E-------Iv~g~~Ts~~~~~~~~~~~~~lgk~------pV~v~-d~pGF----i~NRl~~---~~~~Ea~~lv~eG-va  212 (291)
T PRK06035        155 E-------VVRAALTSEETFNTTVELSKKIGKI------PIEVA-DVPGF----FTTRFIE---GWLLEAIRSFEIG-IA  212 (291)
T ss_pred             E-------ECCCCCCCHHHHHHHHHHHHHCCCE------EEEEC-CCCCC----HHHHHHH---HHHHHHHHHHHCC-CC
T ss_conf             6-------5389999899999999999975984------89965-87742----4998899---9999999999839-99


Q ss_pred             CHHHHHHHHHH
Q ss_conf             97899999986
Q gi|254780716|r  212 NPLEISHLFSK  222 (475)
Q Consensus       212 ~~~~i~~vf~~  222 (475)
                      +.++|-+++..
T Consensus       213 s~edID~~~~~  223 (291)
T PRK06035        213 TIKDIDEMCKL  223 (291)
T ss_pred             CHHHHHHHHHH
T ss_conf             99999998376


No 47 
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.98  E-value=3.5e-07  Score=72.50  Aligned_cols=246  Identities=11%  Similarity=0.148  Sum_probs=147.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--------------CCCCCCEECCCHHHHHHHCCCC
Q ss_conf             80569815711168899999789859997399899999997122--------------1127840328989998605778
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS--------------GLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~--------------~~~~~~~~~~s~~e~v~~l~~p   69 (475)
                      .+|++||.|.||..+|..++.+|++|.+||++++..+.+.+...              ...+.+..+.++++.+   ...
T Consensus         8 k~VaVIGaG~MG~giAa~~a~~G~~V~l~D~~~~a~~~~~~~i~~~~~~l~~~~~~~~~~~~~l~~~~~l~~av---~~a   84 (321)
T PRK07066          8 KTFAAIGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRANVANAWPALERQGLAPGASPARLRFVATIEACV---ADA   84 (321)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHH---CCC
T ss_conf             87999888788899999999479859999698889999999999999999866899631696501468889986---359


Q ss_pred             CEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCCCCCCCCCCCCCEE-E
Q ss_conf             89999769906999999-999720789989996798657899999999984----79943067546760003568437-8
Q gi|254780716|r   70 RKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGVSGGVKGARSGASL-M  143 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pVSGG~~gA~~G~sl-M  143 (475)
                      +.|+=++|-.-.++.-+ .+|-+.+.++ +||-.+||...-+.- +..+..    -+.||.-.|--        =|.+ .
T Consensus        85 D~ViEavpE~l~lK~~lf~~ld~~~~~~-aIiASnTS~l~is~l-~~~~~~peR~i~~HfFNP~~l--------mPLVEV  154 (321)
T PRK07066         85 DFIQESAPEREALKLELHERISRAAKPD-AIIASSTSGLLPTDF-YARATHPERCVVGHPFNPVYL--------LPLVEV  154 (321)
T ss_pred             CEEEECCEECHHHHHHHHHHHHHHCCCC-CEEEECCCCCCHHHH-HHHCCCCCEEEEEEECCCCCC--------CCCEEE
T ss_conf             9899877665999999999999767988-678525765789999-873699702687610587532--------542444


Q ss_pred             EEC---CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             845---48999888999998750156786189856987467898877678788899989999999964289978999999
Q gi|254780716|r  144 VGG---NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLF  220 (475)
Q Consensus       144 vGG---~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf  220 (475)
                      |+|   ++++++++..+++.+..+      -..+-..--|+.    -|-+..   -++-|+++++..+ --+.++|-+++
T Consensus       155 V~g~~Ts~~tv~~a~~~~~~iGk~------PV~v~ke~pGFi----~NRL~~---al~rEA~~Lv~eG-vAs~edID~a~  220 (321)
T PRK07066        155 LGGERTAPEAVDAAMGIYRALGMR------PLHVRKEVPGFI----ADRLLE---ALWREALHLVNEG-VATTGEIDDAI  220 (321)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCE------EEEEECCCCCHH----HHHHHH---HHHHHHHHHHHCC-CCCHHHHHHHH
T ss_conf             289999799999999999981997------889927784259----999999---9999999999818-99999999999


Q ss_pred             H-----HCC-CCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             8-----606-8844307999999999740567999520010233365871677898877517888514677788877500
Q gi|254780716|r  221 S-----KWD-TGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY  294 (475)
Q Consensus       221 ~-----~w~-~~~~~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S~~  294 (475)
                      .     +|. -|....|=|            .+|+-=+...++.-+.-=.--||-     ++  +|.+...+-.|.....
T Consensus       221 ~~G~GlRwa~mGpf~~~~l------------~Gg~~G~~~~l~~~g~~~~~~w~~-----l~--~p~~~~~~~~~~~~~~  281 (321)
T PRK07066        221 RFGAGIRWSFMGTFLTYTL------------AGGDAGMRHFMQQFGPALELPWTK-----LV--APELTDALIDRVVEGT  281 (321)
T ss_pred             HHCCCCCCCCCCHHHHHHH------------CCCHHHHHHHHHHHCCCCCCCCCC-----CC--CCCCCHHHHHHHHHHH
T ss_conf             8089998535272798875------------173889999999808610275323-----69--9888999999999999


Q ss_pred             H
Q ss_conf             5
Q gi|254780716|r  295 R  295 (475)
Q Consensus       295 k  295 (475)
                      +
T Consensus       282 ~  282 (321)
T PRK07066        282 A  282 (321)
T ss_pred             H
T ss_conf             9


No 48 
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.97  E-value=3.8e-07  Score=72.21  Aligned_cols=193  Identities=19%  Similarity=0.273  Sum_probs=124.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC-----------C-------CCCCCCEECCCHHHH
Q ss_conf             9988056981571116889999978985999739989999999712-----------2-------112784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI-----------S-------GLSQKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~-----------~-------~~~~~~~~~~s~~e~   62 (475)
                      |.-.+|++||-|.||..+|..++.+|++|.+||++++..+...+.-           .       .....+....++++ 
T Consensus         2 ~~ik~VaViGAG~MG~giA~~~a~~G~~V~l~D~~~e~~~~~~~~i~~~l~~~~~~~~l~~~~~~~~l~~i~~~~~~~~-   80 (292)
T PRK07530          2 MAIKKVGVIGAGQMGNGIAHVCALAGYDVLLNDVSADRLESGMATINGNLARQVAKGKISEEARAAALARITTATTLDD-   80 (292)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCHHH-
T ss_conf             9988899989669999999999967996899979889999999999999999997068888999999840777689889-


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCC-CCCCCCC
Q ss_conf             860577889999769906999999-99972078998999679865789999999998----47994306754-6760003
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGV-SGGVKGA  136 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pV-SGG~~gA  136 (475)
                         +...+.|+=++|..-.++.-+ .+|-+.++++.|+ -..||...-+. ++..+.    =.|.||...|- .--++  
T Consensus        81 ---~~~aDlViEav~E~l~iK~~lf~~l~~~~~~~~Il-aSNTSsl~is~-la~~~~~p~R~ig~HffnP~~~~~LVE--  153 (292)
T PRK07530         81 ---LADCDLVIEAATEDETVKRKIFAQLCPVLKPEAIL-ASNTSSISITR-LASSTDRPERFIGIHFMNPVPVMKLVE--  153 (292)
T ss_pred             ---HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEE-EECCCCCCCHH-HHHHCCCHHHHCCCCCCCCCCCCCEEE--
T ss_conf             ---66499999888474587898999998626988489-87588875056-666437847643632168702162266--


Q ss_pred             CCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             568437884--548999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  137 RSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       137 ~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                           ++.|  =++++++++..+++.+...      +..+. .--|.    |-|-|.   ...+.|++.++..+ --+.+
T Consensus       154 -----Iv~g~~Ts~~~~~~~~~~~~~lgk~------pvv~~-d~pGF----i~NRl~---~~~~~Ea~~lv~eG-va~~e  213 (292)
T PRK07530        154 -----LIRGIATDEATFEAAKAFVTKLGKT------IAVAE-DFPAF----IVNRIL---LPMINEAIYTLYEG-VGSVE  213 (292)
T ss_pred             -----ECCCCCCCHHHHHHHHHHHHHCCCC------EEEEC-CCCCH----HHHHHH---HHHHHHHHHHHHCC-CCCHH
T ss_conf             -----6389999899999999999974985------08976-76760----999999---99999999999819-99999


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254780716|r  215 EISHLFS  221 (475)
Q Consensus       215 ~i~~vf~  221 (475)
                      +|-.++.
T Consensus       214 ~ID~~~~  220 (292)
T PRK07530        214 AIDTAMK  220 (292)
T ss_pred             HHHHHHH
T ss_conf             9999986


No 49 
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.97  E-value=2.5e-07  Score=73.56  Aligned_cols=191  Identities=20%  Similarity=0.271  Sum_probs=125.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC------------CCCCCEECCCHHHHHHHCCCCCE
Q ss_conf             805698157111688999997898599973998999999971221------------12784032898999860577889
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG------------LSQKVIVTKNLEQMVEAVCKPRK   71 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~------------~~~~~~~~~s~~e~v~~l~~pr~   71 (475)
                      ++|++||.|.||..+|..++.+|++|.+||++++..+...+.-..            ....+....+++    .+..++.
T Consensus         6 k~VaViGAG~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~i~~~~~l~----a~~~aDl   81 (310)
T PRK06130          6 QNLAIIGAGAMGSGIAALFASKGLDVVLIDPMPGALERAAQVIERQLGVYAPGAIAGTLQRIRMDAGLE----AACGADL   81 (310)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHEEECCCHH----HHCCCCE
T ss_conf             889897877999999999985899889997999999999999999865327666999874102137888----9668999


Q ss_pred             EEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCCC-CCCCCCCCCCEEEEE
Q ss_conf             999769906999999-999720789989996798657899999999984----79943067546-760003568437884
Q gi|254780716|r   72 ILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGVS-GGVKGARSGASLMVG  145 (475)
Q Consensus        72 Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pVS-GG~~gA~~G~slMvG  145 (475)
                      |+=++|-.-.+..-+ .+|-..+.++.| +-..||...-+. +++.+..    -|.||.-.|-- --++       ++.|
T Consensus        82 ViEav~E~l~iK~~lf~~le~~~~~~~I-lASNTSsl~is~-ia~~~~~p~R~ig~HffnP~~~m~LVE-------Iv~g  152 (310)
T PRK06130         82 VIEAVPEKLDLKRDIFARLDTLCDPQTI-FATNTSGLSINA-IAQAVTRRERFVGTHFFTPADVIPLVE-------VVRN  152 (310)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCCCCCE-EEECCCCCCCHH-HHHHCCCHHHEEEEEECCCCCCCCCEE-------ECCC
T ss_conf             9988817789999999998606898838-996488776067-888638987815544437767766652-------2378


Q ss_pred             --CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             --5489998889999987501567861898569874678988776787888999899999999642899789999998
Q gi|254780716|r  146 --GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFS  221 (475)
Q Consensus       146 --G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~  221 (475)
                        -++++.+.+..+++.+..+      -..+.+.--|.    |-|-|.+   ..+-|++.++..+ --+.++|-+++.
T Consensus       153 ~~Ts~~~~~~~~~~~~~~gk~------pvvv~kd~pGF----i~NRl~~---~~~~EA~~lv~eG-vas~edID~~~~  216 (310)
T PRK06130        153 DDTSPQTVATVMAMLRSIGKR------PVLVKKDIPGF----IANRIQH---ALAREAISLLEKG-VASAEDIDEVVK  216 (310)
T ss_pred             CCCCHHHHHHHHHHHHHCCCE------EEEECCCCCCC----CHHHHHH---HHHHHHHHHHHCC-CCCHHHHHHHHH
T ss_conf             989899999999999971987------99988665880----1888899---9999999999839-999999999867


No 50 
>PRK09117 consensus
Probab=98.96  E-value=3.6e-07  Score=72.41  Aligned_cols=190  Identities=16%  Similarity=0.197  Sum_probs=124.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CCC-------CCCCCEECCCHHHHHHH
Q ss_conf             805698157111688999997898599973998999999971-----------221-------12784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------ISG-------LSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~~-------~~~~~~~~~s~~e~v~~   65 (475)
                      .+|++||-|.||..+|..++.+|++|.+||++++..+...+.           +..       ....+.+..+++    .
T Consensus         3 ~~VaViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~d~~----a   78 (282)
T PRK09117          3 QTVGIIGAGTMGNGIAQACAVAGLDVVMVDISDAAVQRGLATVAGSLDRLIKKEKLTEADKAAALARIKGSTDYD----A   78 (282)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHH----H
T ss_conf             779998977999999999996799689998988999999999999999999706887788999984065679989----9


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCCC-CCCCCCCCC
Q ss_conf             577889999769906999999-999720789989996798657899999999984----79943067546-760003568
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGVS-GGVKGARSG  139 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pVS-GG~~gA~~G  139 (475)
                      ++.++.|+=+||-.-.+..-+ .+|-+.+.++.| +-..||...-+ ++++.+..    -|.||.-.|-- --++     
T Consensus        79 ~~~aDlViEav~E~l~iK~~lf~~l~~~~~~~~I-laSNTS~l~i~-~ia~~~~~p~R~ig~HffnP~~~~~LVE-----  151 (282)
T PRK09117         79 LKDADLVIEAATENLDLKLKILKQLDALVGPDAI-IATNTSSISIT-KLAAATSRPDRFIGMHFFNPVPMMALVE-----  151 (282)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCE-EEECCCCCCCH-HHHHHCCCHHHCCCCCCCCCCCCCCEEE-----
T ss_conf             7559999987858888889999999865799818-98658767617-7887649846415545568866584488-----


Q ss_pred             CEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             437884--548999888999998750156786189856987467898877678788899989999999964289978999
Q gi|254780716|r  140 ASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEIS  217 (475)
Q Consensus       140 ~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~  217 (475)
                        ++.|  -++++++.+..+.+.+...      ...+.+. -|..    -|-|..   ..+.|++.++..+ --++++|-
T Consensus       152 --iv~g~~Ts~~~~~~~~~~~~~lgk~------pV~vkd~-pGFi----~NRl~~---a~~~ea~~lv~eG-va~~~~ID  214 (282)
T PRK09117        152 --LIRGLQTSDATHAAVEALAKRLGKT------PITVKNS-PGFV----VNRILC---PMINEAIFVLGEG-LATAEDID  214 (282)
T ss_pred             --ECCCCCCCHHHHHHHHHHHHHCCCE------EEEEECC-CCCC----HHHHHH---HHHHHHHHHHHCC-CCCHHHHH
T ss_conf             --6499999899999999999973987------9998167-8810----999999---9999999999849-99999999


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780716|r  218 HLFS  221 (475)
Q Consensus       218 ~vf~  221 (475)
                      .++.
T Consensus       215 ~~~~  218 (282)
T PRK09117        215 EGMK  218 (282)
T ss_pred             HHHH
T ss_conf             8735


No 51 
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.94  E-value=2.4e-07  Score=73.71  Aligned_cols=193  Identities=13%  Similarity=0.205  Sum_probs=124.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC------------------CCCCCEECCCHHHH
Q ss_conf             998805698157111688999997898599973998999999971221------------------12784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG------------------LSQKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~------------------~~~~~~~~~s~~e~   62 (475)
                      |-| +|++||.|.||..+|..++.+|++|.+||++++..+...+.-..                  ....++...++++.
T Consensus         1 mIk-kV~ViGaG~MG~~IA~~~a~~G~~V~l~D~~~e~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~i~~~~dl~~a   79 (289)
T PRK09260          1 MME-KIVVVGAGVMGRGIAYVFASSGFQTTLVDISQEQLASAQQEIESILEDGVALGKVTEAAAQAALARLSYSLDLKEA   79 (289)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCHHHH
T ss_conf             967-6999796887899999999689988999799899999999999999999871799989999999558766888998


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCCC-CCCCCC
Q ss_conf             860577889999769906999999-99972078998999679865789999999998----479943067546-760003
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGVS-GGVKGA  136 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pVS-GG~~gA  136 (475)
                         ++.++.|+=+||-.-.+..-+ .+|-+.+.++.|+. ..||...-+. +++.+.    =-|.||.-.|-- --++  
T Consensus        80 ---~~~aDlViEav~E~l~iK~~v~~~l~~~~~~~~Ila-SNTSsl~is~-ia~~~~~p~R~ig~HffnP~~~~~lVE--  152 (289)
T PRK09260         80 ---VAGADLLIEAVPEKLEIKQAVFETADAHAPAEALIA-TNTSTLSPTE-IASATKRPERVIGMHFFNPVHKMKLVE--  152 (289)
T ss_pred             ---HCCCCEEEECCCCCHHHCHHHHHHHHHCCCCCCEEE-ECCCCCCCHH-HHHHCCCHHHEEEECCCCCHHHHEEEE--
T ss_conf             ---476999998886863236899999860689980898-5588877114-554159846626412477432212356--


Q ss_pred             CCCCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             568437884--548999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  137 RSGASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       137 ~~G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                           ++.|  -++++++.+..+.+.+...      ...+.+ .-|    -|-|-|.+   ..+.|++.++..+ .-+++
T Consensus       153 -----vv~g~~Ts~e~i~~~~~~~~~lgk~------pv~v~d-~pG----Fi~NRl~~---~~~~ea~~lv~eG-va~~~  212 (289)
T PRK09260        153 -----LVRGLETSDETVAVCREVAEQLGKE------TVVVNE-FPG----FVTSRISA---LVGNEAMYMLQEG-VATAE  212 (289)
T ss_pred             -----ECCCCCCCHHHHHHHHHHHHHCCCC------EEEECC-CCC----HHHHHHHH---HHHHHHHHHHHCC-CCCHH
T ss_conf             -----4589999999999999999974984------278568-875----29999899---9999999999819-99999


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254780716|r  215 EISHLFS  221 (475)
Q Consensus       215 ~i~~vf~  221 (475)
                      +|-.++.
T Consensus       213 dID~~~~  219 (289)
T PRK09260        213 DIDKALR  219 (289)
T ss_pred             HHHHHHH
T ss_conf             9999978


No 52 
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed
Probab=98.90  E-value=1.7e-06  Score=67.52  Aligned_cols=149  Identities=21%  Similarity=0.290  Sum_probs=96.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC----EEEEEECC-HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             998805698157111688999997898----59997399-8999999971221127840328989998605778899997
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF----RLAVYNKD-FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~----~V~vydr~-~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      |+|.+|||||.|+||++|+.-|++.+.    ++.+.+++ .++.+.+.++.     ++....+..+.++..   ++|+++
T Consensus         2 ~~~~kI~fIG~GnMg~Aii~gll~~~~~~~~~i~v~~~~~~~~~~~l~~~~-----~i~~~~~~~~~~~~~---d~Iila   73 (245)
T PRK07634          2 LTKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKLDQLQARY-----NVSTTTDWKQHVTSV---DTIVLA   73 (245)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHC-----CCEECCCHHHHHHHC---CEEEEE
T ss_conf             999919998758999999999997799996059996999999999999971-----974227779998559---999999


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE-CCCCCCCCCCCCCCCEEEEEC---CHHHH
Q ss_conf             69906999999999720789989996798657899999999984799430-675467600035684378845---48999
Q gi|254780716|r   76 VTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI-GIGVSGGVKGARSGASLMVGG---NEKAY  151 (475)
Q Consensus        76 vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi-d~pVSGG~~gA~~G~slMvGG---~~~~~  151 (475)
                      |+. ..+.+|+.++.+.++ +.+||-.--.-  ...++.+.+. .+...+ -||=.  +.....|.+.+..+   +++.-
T Consensus        74 vKP-~~~~~vl~~i~~~~~-~~~iISi~AGi--~i~~l~~~l~-~~~~v~R~MPN~--~~~v~~g~t~~~~~~~~~~~~~  146 (245)
T PRK07634         74 MPP-SAHEELLAELSPLLS-NQLVVTVAAGI--GPSYLEERLP-KGTPVAWIMPNT--AAEIGKSISLYTMGQFVNETHQ  146 (245)
T ss_pred             ECC-HHHHHHHHHHHHHHC-CCEEEEEECCC--CHHHHHHHCC-CCCEEEEECCCH--HHHHCCCCEEEECCCCCCHHHH
T ss_conf             891-749999999877606-98899981799--8999998748-997289945857--4897588189853887999999


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             8889999987501
Q gi|254780716|r  152 NRVENILLSISAK  164 (475)
Q Consensus       152 ~~~~piL~~iaak  164 (475)
                      +.++.+|+.++.-
T Consensus       147 ~~v~~lf~~~G~~  159 (245)
T PRK07634        147 ETLQLLLRGIGTS  159 (245)
T ss_pred             HHHHHHHHCCCEE
T ss_conf             9999998628549


No 53 
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Probab=98.87  E-value=4e-07  Score=72.03  Aligned_cols=152  Identities=15%  Similarity=0.138  Sum_probs=101.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---------CCCCCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             880569815711168899999789859997399899999997122---------11278403289899986057788999
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS---------GLSQKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~---------~~~~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      +.+|++||-|.||.++|.-|+++|..|. |-|+++.++++.+...         ....++....++++.++..   ++|+
T Consensus         6 ~~KI~ViGaGawGTALA~~la~n~~~v~-w~r~~~~~~~In~~~~N~kyL~~~i~Lp~~i~~t~dl~~a~~~a---diii   81 (340)
T PRK12439          6 EPKVVVLGGGSWGTTVASICARRGPTLQ-WVRSEETAKDINDNHRNSRYLGNDVVLSDTLRATTDFTEAANCA---DVVV   81 (340)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCHHHHHHCC---CEEE
T ss_conf             9928998969999999999995899899-96899999999982888768998755898728978999998269---9899


Q ss_pred             EECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHHHHCCCCEECCC-CCCC---CCCCCCCC-EEEEE-C
Q ss_conf             976990699999999972078998999679865789999-9999984799430675-4676---00035684-37884-5
Q gi|254780716|r   74 MMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI-RSLQLSEKGIYFIGIG-VSGG---VKGARSGA-SLMVG-G  146 (475)
Q Consensus        74 l~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~-~~~~l~~kgi~fid~p-VSGG---~~gA~~G~-slMvG-G  146 (475)
                      +.||+ +.+.++++++.+.+++..++|.++--.-..+.. ..+.+++.- .--.+. +||-   .+-|+.-| ++.++ -
T Consensus        82 ~avPS-~~~r~~~~~l~~~l~~~~~iv~~sKGie~~t~~~~seii~e~l-~~~~~~vLSGPsfA~Eva~~~pta~viAs~  159 (340)
T PRK12439         82 MGVPS-HGFRGVLTELAKELRPWVPVVSLVKGLEQGTNMRMSQIIEEVL-PGHPAGILAGPNIAREVAEGYAAAAVLAMP  159 (340)
T ss_pred             EECCC-HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHC-CCCCEEEECCCCHHHHHHHCCCCCEEEECC
T ss_conf             93680-8999999999865578875997327502799987999999875-799706863874499997089851366468


Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             48999888999998
Q gi|254780716|r  147 NEKAYNRVENILLS  160 (475)
Q Consensus       147 ~~~~~~~~~piL~~  160 (475)
                      +.+.-++++.+|..
T Consensus       160 ~~~~a~~l~~lf~~  173 (340)
T PRK12439        160 DQHLATRLSALFRT  173 (340)
T ss_pred             CHHHHHHHHHHHCC
T ss_conf             88999999998586


No 54 
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.86  E-value=1.4e-06  Score=68.10  Aligned_cols=191  Identities=15%  Similarity=0.190  Sum_probs=122.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CC-------CCCCCCEECCCHHHHHHH
Q ss_conf             805698157111688999997898599973998999999971-----------22-------112784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------IS-------GLSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~-------~~~~~~~~~~s~~e~v~~   65 (475)
                      .+||+||.|.||..+|..++.+|++|.+||++++..+...+.           +.       .....+..+.++++    
T Consensus         4 ~~VaViGaGtMG~gIA~~~a~aG~~V~l~D~~~~~l~~a~~~i~~~l~~~~~~g~~~~~~~~~~~~ri~~~~~l~~----   79 (503)
T PRK08268          4 ATVAVIGAGAMGAGIAQVAAQAGHTVLLYDARAGAAAAARDGIAATLAKLVEKGKLTAEQAEAALARLRPVEALAD----   79 (503)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCEEECCHHH----
T ss_conf             7899979688999999999938990899979989999999999999999997699998899999847474177889----


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCC-CCCCCCCCCCC
Q ss_conf             577889999769906999999-999720789989996798657899999999984----799430675-46760003568
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIG-VSGGVKGARSG  139 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~p-VSGG~~gA~~G  139 (475)
                      +...+.||=+||-.-.++.-+ .+|-..+.++.|+ -..||...-+ ++++.++.    -|.||...+ +.--++     
T Consensus        80 l~~aDlVIEAV~E~l~~K~~vf~~l~~~~~~~~Il-ASNTSsL~it-~iA~~~~~PeR~iG~HFfnP~~~m~LVE-----  152 (503)
T PRK08268         80 LADCDLVVEAIVERLDVKQALFAQLEAIVSDDCIL-ATNTSSLSIT-AIAAALKHPERVAGLHFFNPVPLMKLVE-----  152 (503)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEE-EECCCCCCHH-HHHHHCCCCCEEEEEEECCCCCCCEEEE-----
T ss_conf             75799999936067899999999998547988579-8417767799-9997469844078877158724460488-----


Q ss_pred             CEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             437884--548999888999998750156786189856987467898877678788899989999999964289978999
Q gi|254780716|r  140 ASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEIS  217 (475)
Q Consensus       140 ~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~  217 (475)
                        ++.|  -++++.+.+..+.+.+...      ...+ +..-|.    |-|-|.   +..+.|++.++..+ --+.++|=
T Consensus       153 --VV~g~~Ts~e~v~~~~~~~~~lGK~------pV~v-~d~pGF----i~NRi~---~~~~~EA~~l~eeG-vA~~e~ID  215 (503)
T PRK08268        153 --VVSGLATDPAVADALYALARRWGHT------PVRA-KDTPGF----IVNHAG---RPYYTEALRVLGEG-VADFATID  215 (503)
T ss_pred             --EECCCCCCHHHHHHHHHHHHHCCCE------EEEE-CCCCCC----CHHHHH---HHHHHHHHHHHHCC-CCCHHHHH
T ss_conf             --8079999999999999999982980------4895-578982----088775---48999999999828-99999999


Q ss_pred             HHHHH
Q ss_conf             99986
Q gi|254780716|r  218 HLFSK  222 (475)
Q Consensus       218 ~vf~~  222 (475)
                      .++..
T Consensus       216 ~a~r~  220 (503)
T PRK08268        216 AILRE  220 (503)
T ss_pred             HHHHH
T ss_conf             99996


No 55 
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]
Probab=98.84  E-value=4.1e-07  Score=71.98  Aligned_cols=150  Identities=22%  Similarity=0.318  Sum_probs=107.5

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC--------CCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             0569815711168899999789859997399899999997122--------11278403289899986057788999976
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS--------GLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~--------~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      +|.+||-|.+|.++|.-|+++|++|..|-|+++-.+++.....        ....++....++++.++   ..++|++-|
T Consensus         3 kI~ViGaGswGTALA~~la~ng~~V~lw~r~~~~~~~i~~~~~N~~yLp~i~lp~~l~at~Dl~~a~~---~ad~iv~av   79 (329)
T COG0240           3 KIAVIGAGSWGTALAKVLARNGHEVRLWGRDEEIVAEINETRENPKYLPGILLPPNLKATTDLAEALD---GADIIVIAV   79 (329)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHH---CCCEEEEEC
T ss_conf             18998178379999999996698469996289999999734767010599628863222468999972---299999978


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHHHH-CCCCEECCCC-CCC---CCCCCCCCE-EEEEC-CH
Q ss_conf             990699999999972078998999679865789999-9999984-7994306754-676---000356843-78845-48
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI-RSLQLSE-KGIYFIGIGV-SGG---VKGARSGAS-LMVGG-NE  148 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~-~~~~l~~-kgi~fid~pV-SGG---~~gA~~G~s-lMvGG-~~  148 (475)
                      |+ +.+.+|+.++.+.+.++.++|-++--.-..+.+ ..+.+++ .+...  ++| ||-   .+-|+.-|| +.+++ +.
T Consensus        80 Ps-~~~r~v~~~l~~~l~~~~~iv~~sKGie~~t~~l~seii~e~l~~~~--~~vLSGPs~A~EVa~g~pta~~vas~d~  156 (329)
T COG0240          80 PS-QALREVLRQLKPLLLKDAIIVSATKGLEPETGRLLSEIIEEELPDNP--IAVLSGPSFAKEVAQGLPTAVVVASNDQ  156 (329)
T ss_pred             CH-HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHCCCCE--EEEEECCCHHHHHHCCCCCEEEEECCCH
T ss_conf             75-78999999876433678749997446558876519999999739981--8999786079998668981799952899


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999888999998
Q gi|254780716|r  149 KAYNRVENILLS  160 (475)
Q Consensus       149 ~~~~~~~piL~~  160 (475)
                      +..++++..|..
T Consensus       157 ~~a~~v~~~f~~  168 (329)
T COG0240         157 EAAEKVQALFSS  168 (329)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999998479


No 56 
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=98.81  E-value=2.8e-06  Score=65.83  Aligned_cols=98  Identities=15%  Similarity=0.243  Sum_probs=74.8

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC----CC-------CEECCCHHHHHHHCCCC
Q ss_conf             99880569815711168899999789859997399899999997122112----78-------40328989998605778
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS----QK-------VIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~----~~-------~~~~~s~~e~v~~l~~p   69 (475)
                      |+|  |.|||.|.||.-+|..|.+.|++|.+.+| ++..+.+.++|-...    ..       +....++++    +..+
T Consensus         2 mmk--I~IiGaGAvG~~~a~~L~~aG~~V~lv~r-~~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~~~~~~----~~~~   74 (341)
T PRK08229          2 MAR--ICVLGAGSIGCYLGGRLAAAGADVTLIGR-ARIGDEIRAHGLRLTDYRGRDVRVPPDAIAFSTDPAA----LATA   74 (341)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCCEEEEEC-HHHHHHHHHCCCEEECCCCCEEEECCCEEEECCCHHH----CCCC
T ss_conf             477--99989679999999999858998799956-7899999967909963899768963661561488656----5899


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             8999976990699999999972078998999679865
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                      ++||+++.+ .++++.++.+.|.+.++.+|+-.-|.-
T Consensus        75 D~viv~vKa-~~~~~a~~~l~~~l~~~t~il~lQNGl  110 (341)
T PRK08229         75 DLVLVTVKS-AATADAAAALAGHARPGAVVVSFQNGV  110 (341)
T ss_pred             CEEEEEECC-CCHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             989997075-788999999986438996899950477


No 57 
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=98.77  E-value=3.7e-06  Score=64.95  Aligned_cols=192  Identities=16%  Similarity=0.192  Sum_probs=120.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CCC-------CCCCCEECCCHHHHHHH
Q ss_conf             805698157111688999997898599973998999999971-----------221-------12784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------ISG-------LSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~~-------~~~~~~~~~s~~e~v~~   65 (475)
                      .+||+||.|.||..+|..++.+|++|.+||++++..+...+.           +.-       .-..+....++++    
T Consensus         3 ~kV~ViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~dl~~----   78 (284)
T PRK07819          3 QRVGVVGAGQMGSGIAEVCARAGVDVLVFETTEEAATAGRNRIEKSLERAVSAGKLTERERDAALARLTFTTDLED----   78 (284)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCHHH----
T ss_conf             6799989778999999999957990899979889999999999999999987278987999999963706689999----


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCCCCCCCCCCCCC
Q ss_conf             577889999769906999999-99972078998999679865789999999998----4799430675467600035684
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGVSGGVKGARSGA  140 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pVSGG~~gA~~G~  140 (475)
                      +..++.|+=+||-.-.+..-+ .+|-..+.+.++|+-..||...-+. ++..++    =-|.||.-.|--        -+
T Consensus        79 ~~~adlViEav~E~l~~K~~l~~~ld~~~~~p~~IlaSNTS~l~is~-la~~~~~p~R~ig~HffnP~~~--------~~  149 (284)
T PRK07819         79 LADRQLVIEAVVEDEAVKTEIFAELDKVVTDPDAVLASNTSSIPIMK-LAAATKRPGRVLGLHFFNPVPV--------LP  149 (284)
T ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHH-HHHCCCCHHHHCCCCCCCCCCC--------CE
T ss_conf             76599999907387888899999999742899859996588876134-4411588777115642478322--------12


Q ss_pred             E--EEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             3--7884--54899988899999875015678618985698746789887767878889998999999996428997899
Q gi|254780716|r  141 S--LMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEI  216 (475)
Q Consensus       141 s--lMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i  216 (475)
                      .  ++.|  -++++++.+..+++..-.|.     +..+.+. .|.    |-|-|-.   ..+.|++.++..+ .-+.++|
T Consensus       150 LVEIv~g~~Ts~~~~~~~~~~~~~~l~k~-----~v~~~d~-pGF----i~NRl~~---~~~~ea~~l~~eG-va~~edI  215 (284)
T PRK07819        150 LVELVPTLVTSEATVARAEEFATEVLGKQ-----VVRCQDR-SGF----VVNALLV---PYLLSAIRMVESG-FATAEDI  215 (284)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCC-----CEEECCC-CCC----HHHHHHH---HHHHHHHHHHHCC-CCCHHHH
T ss_conf             57771799998999999999999826966-----3686677-774----1999999---9999999999838-9999999


Q ss_pred             HHHHHH
Q ss_conf             999986
Q gi|254780716|r  217 SHLFSK  222 (475)
Q Consensus       217 ~~vf~~  222 (475)
                      -.++..
T Consensus       216 D~~~~~  221 (284)
T PRK07819        216 DKAMVL  221 (284)
T ss_pred             HHHHHH
T ss_conf             999876


No 58 
>pfam02153 PDH Prephenate dehydrogenase. Members of this family are prephenate dehydrogenases EC:1.3.1.12 involved in tyrosine biosynthesis.
Probab=98.76  E-value=1e-05  Score=61.61  Aligned_cols=152  Identities=22%  Similarity=0.292  Sum_probs=105.6

Q ss_pred             HHHHHHHCC--CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             899999789--859997399899999997122112784032898999860577889999769906999999999720789
Q gi|254780716|r   18 LSLNILDKG--FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSP   95 (475)
Q Consensus        18 mA~nL~~~G--~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~   95 (475)
                      +|+-|-++|  .+|++||++++..+...+.+...    ....++ +   .+..+++|++|+|- ..+.+++..+.+.+++
T Consensus         1 lAlalk~~~~~~~I~g~d~~~~~~~~A~~~g~id----~~~~~~-~---~~~~aDlvila~Pv-~~~~~~l~~l~~~~~~   71 (258)
T pfam02153         1 IALALRRKGFNVTVIGYDIDEEAAVAAVELGLGD----EATNDI-E---AAQEADIVVLAVPI-EVTLEVLKELAPHLKE   71 (258)
T ss_pred             CHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCC----CCCCCH-H---HHCCCCEEEEECCH-HHHHHHHHHHHHHCCC
T ss_conf             9288861699967999859999999999869903----246867-7---76679999996999-9999999998865589


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC----CCC----CC-CEEEE---ECCHHHHHHHHHHHHHHH
Q ss_conf             98999679865789999999998479943067-5467600----035----68-43788---454899988899999875
Q gi|254780716|r   96 EDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK----GAR----SG-ASLMV---GGNEKAYNRVENILLSIS  162 (475)
Q Consensus        96 g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~----gA~----~G-~slMv---GG~~~~~~~~~piL~~ia  162 (475)
                      +.+|.|.|.+-..-..... .....+++|++. |+.|.+.    .|.    .| +.+++   +.+.+.++.++.+++.++
T Consensus        72 ~~ivtDv~SvK~~i~~~~~-~~~~~~~~fvg~HPMaG~e~sG~~~a~~~LF~~~~~il~p~~~~~~~~~~~v~~l~~~lG  150 (258)
T pfam02153        72 GALITDVGSVKVEIVKDAE-QLLSDGVGFIPGHPMAGTEKSGPDAARANLFENAPVILTPTEKTDTEALALVRELLEGIG  150 (258)
T ss_pred             CCEEEECCCCCHHHHHHHH-HHCCCCCCEECCCCCCCCCCCCCHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             9589953555579999999-855567864605886478767701100125417159961888887999999999999869


Q ss_pred             CCCCCCCEEEEECCCCHHHHHHH
Q ss_conf             01567861898569874678988
Q gi|254780716|r  163 AKYQNSPCCALLGPDGSGHFVKM  185 (475)
Q Consensus       163 ak~~~~~cv~y~G~~GsGh~vKM  185 (475)
                      ++      +..+-+.-.=..+=+
T Consensus       151 a~------~~~m~~~~HD~~~A~  167 (258)
T pfam02153       151 AK------VILMDPEEHDRVVAL  167 (258)
T ss_pred             CE------EEECCHHHHHHHHHH
T ss_conf             96------998277778899999


No 59 
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=98.76  E-value=7e-06  Score=62.88  Aligned_cols=114  Identities=15%  Similarity=0.135  Sum_probs=80.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC---CCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             9988056981571116889999978985999739989999999712211---2784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGL---SQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~---~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+. +|.+||.|.||.-+|.+|.++|++|..++|.+++.+.+.+.+.-.   ........-..+..+.....++||+++.
T Consensus         1 m~M-kI~IiGaGAiG~~~a~~L~~ag~dV~lv~r~~~~~~~~~~~g~~~~~~~~~~~~~~v~~~~~~~~~~~D~vivavK   79 (305)
T PRK05708          1 MSM-TWHILGAGSLGSLWACRLARAGLPVRLILRDRQRLAAYQQAGGLTLVEQGQASLYAIPAETADAPEPIHRLLVACK   79 (305)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCCEEEEECCCEEEEECCCCCCCCCCCCCEEEEEEC
T ss_conf             998-8999882399999999998489973999947899999997899899868955787404657665788778999804


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             9069999999997207899899967986578999999999
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL  117 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l  117 (475)
                      +. ++++++..+.|.+.++..||-.-|-- ....++++.+
T Consensus        80 ~~-~~~~a~~~l~~~l~~~t~Iv~lQNGl-g~~e~la~~~  117 (305)
T PRK05708         80 AY-DAEPAVASLAHRLAPGAELLLLQNGL-GSQDAVAARV  117 (305)
T ss_pred             CC-CHHHHHHHHHHHCCCCCEEEEECCCC-CHHHHHHHHC
T ss_conf             25-68999999886449995899943776-4799999977


No 60 
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]
Probab=98.75  E-value=1.7e-07  Score=74.77  Aligned_cols=242  Identities=17%  Similarity=0.193  Sum_probs=133.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC----CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             0569815711168899999789----859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG----FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G----~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      +|||||.|+||.+|+.-|.++|    .+|.+.||+.++.+.+.++....     .+.+..++++.   .++||++|+. .
T Consensus         3 ~IgfIG~G~Mg~Ai~~gl~~~g~~~~~~I~v~~~~~e~~~~l~~~~g~~-----~~~~~~~~~~~---advv~LavKP-q   73 (266)
T COG0345           3 KIGFIGAGNMGEAILSGLLKSGALPPEEIIVTNRSEEKRAALAAEYGVV-----TTTDNQEAVEE---ADVVFLAVKP-Q   73 (266)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCC-----CCCCHHHHHHH---CCEEEEEECH-H
T ss_conf             5899846889999999999668998023898379999999999984985-----56867988740---8989998482-7


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC-CCCCCCCCCCCCCCEEEEE---CCHHHHHHHHH
Q ss_conf             9999999997207899899967986578999999999847994306-7546760003568437884---54899988899
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG-IGVSGGVKGARSGASLMVG---GNEKAYNRVEN  156 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid-~pVSGG~~gA~~G~slMvG---G~~~~~~~~~p  156 (475)
                      ...+|+..+.+ ..++.++|-.----.  ...+...+.  +...+- ||=  .+.-...|-+....   .+++..+.++.
T Consensus        74 ~~~~vl~~l~~-~~~~~lvISiaAGv~--~~~l~~~l~--~~~vvR~MPN--t~a~vg~g~t~i~~~~~~~~~~~~~v~~  146 (266)
T COG0345          74 DLEEVLSKLKP-LTKDKLVISIAAGVS--IETLERLLG--GLRVVRVMPN--TPALVGAGVTAISANANVSEEDKAFVEA  146 (266)
T ss_pred             HHHHHHHHHHC-CCCCCEEEEEECCCC--HHHHHHHCC--CCCEEEECCC--HHHHHCCCCEEEECCCCCCHHHHHHHHH
T ss_conf             68999997323-568887999707997--999998748--9966996788--5889717522651376589889999999


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHH
Q ss_conf             99987501567861898569874678988776--7878889998999999996428997899999986068844307999
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHN--GIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK  234 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN--gIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~  234 (475)
                      +|++++.       +..+.+.---.+.=+.=-  +.-|-+++.++++-  .+  .+++.++-.+.-.         -++.
T Consensus       147 l~~~~G~-------v~~v~E~~~da~TaisGSgPAyv~~~iEal~~ag--v~--~Gl~~~~A~~l~~---------~t~~  206 (266)
T COG0345         147 LLSAVGK-------VVEVEESLMDAVTALSGSGPAYVFLFIEALADAG--VR--LGLPREEARELAA---------QTVA  206 (266)
T ss_pred             HHHHCCC-------EEEECHHHHHHHHHHHCCCHHHHHHHHHHHHHHH--HH--CCCCHHHHHHHHH---------HHHH
T ss_conf             9982598-------6996467714999984486899999999999999--98--5999999999999---------9999


Q ss_pred             HHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHH
Q ss_conf             99999974056799952001023336587167789887751788851467778
Q gi|254780716|r  235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIF  287 (475)
Q Consensus       235 i~~~il~~k~~~~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~  287 (475)
                      =+++.+.+..+     .-..+.|.+-.+|=-.=.....|+.+-=-..+..|+.
T Consensus       207 Gaakll~e~~~-----~p~~Lr~~VtSPGGtTiagl~~le~~g~~~~v~~av~  254 (266)
T COG0345         207 GAAKLLLESGE-----HPAELRDQVTSPGGTTIAGLRVLEEDGFRGAVIEAVE  254 (266)
T ss_pred             HHHHHHHHCCC-----CHHHHHHHCCCCCCHHHHHHHHHHHHCHHHHHHHHHH
T ss_conf             99999986699-----9799998575998408999999988073999999999


No 61 
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=98.74  E-value=2.6e-05  Score=58.71  Aligned_cols=206  Identities=15%  Similarity=0.208  Sum_probs=140.3

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--------------CCCCCEECCCHHHHHHHCCCCC
Q ss_conf             05698157111688999997898599973998999999971221--------------1278403289899986057788
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG--------------LSQKVIVTKNLEQMVEAVCKPR   70 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~--------------~~~~~~~~~s~~e~v~~l~~pr   70 (475)
                      +|.+||.|-.|.--|.-|++.|++|...|.+++|++.+.+....              ....+....+.++.+   ...+
T Consensus         2 kI~viGtGYVGLv~g~~lA~~GHeVv~vDid~~KV~~ln~g~~PI~EpgLe~ll~~~~~~gRl~fTtd~~~a~---~~ad   78 (414)
T COG1004           2 KITVIGTGYVGLVTGACLAELGHEVVCVDIDESKVELLNKGISPIYEPGLEELLKENLASGRLRFTTDYEEAV---KDAD   78 (414)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEECCHHHHH---HCCC
T ss_conf             1589888556887899998709848999578899999867999976705899998462357279874788896---2597


Q ss_pred             EEEEECCCH---------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCC--
Q ss_conf             999976990---------699999999972078998999679865789999999998479943067546760003568--
Q gi|254780716|r   71 KILMMVTDG---------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSG--  139 (475)
Q Consensus        71 ~Iil~vp~g---------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G--  139 (475)
                      ++|++||.+         ..|++|+..+.+.++...+||.=||..+-.+.+..+.+.+..-.= |-.|--.|+=-|.|  
T Consensus        79 v~fIavgTP~~~dg~aDl~~V~ava~~i~~~~~~~~vvV~KSTVPvGt~~~v~~~i~~~~~~~-~f~v~~NPEFLREG~A  157 (414)
T COG1004          79 VVFIAVGTPPDEDGSADLSYVEAVAKDIGEILDGKAVVVIKSTVPVGTTEEVRAKIREENSGK-DFEVASNPEFLREGSA  157 (414)
T ss_pred             EEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCC-CCEEECCHHHHCCCCH
T ss_conf             799974899998897328999999999986267873999848879884699999998634677-7507618678447523


Q ss_pred             ------C-EEEEECCHH-HHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             ------4-378845489-99888999998750156786189856987467898877678788899989999999964289
Q gi|254780716|r  140 ------A-SLMVGGNEK-AYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNK  211 (475)
Q Consensus       140 ------~-slMvGG~~~-~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~  211 (475)
                            | -+.+|...+ +-+.++.+++.+..  .+.| +.+++. -+.-.+|...|.-.=--..-|-|.=+++++ .+.
T Consensus       158 v~D~~~PdRIViG~~~~~a~~~~~ely~~~~~--~~~p-~l~t~~-~~AE~IKyaaNafLAtKIsFiNEia~ice~-~g~  232 (414)
T COG1004         158 VYDFLYPDRIVIGVRSERAAAVLRELYAPFLR--QDVP-ILFTDL-REAELIKYAANAFLATKISFINEIANICEK-VGA  232 (414)
T ss_pred             HHHCCCCCEEEECCCCHHHHHHHHHHHHHHHH--CCCC-EEEECC-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCC
T ss_conf             44315898389925771689999999753420--4998-899560-299999999889999999999999999999-698


Q ss_pred             CHHHHHHH
Q ss_conf             97899999
Q gi|254780716|r  212 NPLEISHL  219 (475)
Q Consensus       212 ~~~~i~~v  219 (475)
                      +-.++++-
T Consensus       233 D~~~V~~g  240 (414)
T COG1004         233 DVKQVAEG  240 (414)
T ss_pred             CHHHHHHH
T ss_conf             99999987


No 62 
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]
Probab=98.73  E-value=2.4e-06  Score=66.27  Aligned_cols=194  Identities=19%  Similarity=0.257  Sum_probs=121.9

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC----C--------------CCCEECCCHHHH
Q ss_conf             9988056981571116889999978985999739989999999712211----2--------------784032898999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGL----S--------------QKVIVTKNLEQM   62 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~----~--------------~~~~~~~s~~e~   62 (475)
                      |.-.+||+||-|.||.++|..++..||+|..+|++++..+...+.....    .              ..+.+..++.  
T Consensus         1 ~~i~kv~ViGaG~MG~gIA~~~A~~G~~V~l~D~~~~~~~~~~~~i~~~l~k~~~~g~l~~~~~~~~l~~i~~~~~~~--   78 (307)
T COG1250           1 MEIKKVAVIGAGVMGAGIAAVFALAGYDVVLKDISPEALERALAYIEKNLEKLVEKGKLTEEEADAALARITPTTDLA--   78 (307)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHH--
T ss_conf             974079997246020999999973499569995898999999999999999888627877455999975152557665--


Q ss_pred             HHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH----HCCCCEECCCCCCCCCCCCC
Q ss_conf             86057788999976990699999999972078998999679865789999999998----47994306754676000356
Q gi|254780716|r   63 VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS----EKGIYFIGIGVSGGVKGARS  138 (475)
Q Consensus        63 v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~----~kgi~fid~pVSGG~~gA~~  138 (475)
                        .++.++.|+--++-.-.+..-+..-++.+-+.+.|+-..||+..-+.- ++.++    --|+||...|.-.       
T Consensus        79 --~l~~~DlVIEAv~E~levK~~vf~~l~~~~~~~aIlASNTSsl~it~i-a~~~~rper~iG~HFfNP~~~m-------  148 (307)
T COG1250          79 --ALKDADLVIEAVVEDLELKKQVFAELEALAKPDAILASNTSSLSITEL-AEALKRPERFIGLHFFNPVPLM-------  148 (307)
T ss_pred             --HHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHH-HHHHCCCHHEEEEECCCCCCCC-------
T ss_conf             --663088788853015999999999988655988578622677878999-9873793237987526987711-------


Q ss_pred             CCEE-EEEC---CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             8437-8845---48999888999998750156786189856987467898877678788899989999999964289978
Q gi|254780716|r  139 GASL-MVGG---NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       139 G~sl-MvGG---~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                       +.+ .+.|   ++++++.+..+.+.+. |.   |   .+...-.|.    |-|=|-   ...+.|++.++.++ ..+++
T Consensus       149 -~LVEvI~g~~T~~e~~~~~~~~~~~ig-K~---~---vv~~D~pGF----i~NRil---~~~~~eA~~l~~eG-va~~e  212 (307)
T COG1250         149 -PLVEVIRGEKTSDETVERVVEFAKKIG-KT---P---VVVKDVPGF----IVNRLL---AALLNEAIRLLEEG-VATPE  212 (307)
T ss_pred             -EEEEEECCCCCCHHHHHHHHHHHHHCC-CC---C---EEECCCCCE----EHHHHH---HHHHHHHHHHHHHC-CCCHH
T ss_conf             -058881688789999999999999859-98---8---742678861----257778---99999999999808-99999


Q ss_pred             HHHHHHHH
Q ss_conf             99999986
Q gi|254780716|r  215 EISHLFSK  222 (475)
Q Consensus       215 ~i~~vf~~  222 (475)
                      +|-+++..
T Consensus       213 ~ID~~~~~  220 (307)
T COG1250         213 EIDAAMRQ  220 (307)
T ss_pred             HHHHHHHH
T ss_conf             99999986


No 63 
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]
Probab=98.73  E-value=8.6e-07  Score=69.63  Aligned_cols=153  Identities=19%  Similarity=0.217  Sum_probs=97.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             99880569815711168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      |++  ++++|.|+||+++|++|++.|++|.+-+|..++..+..++.  ....+++ .+..|.++   ..++|++-||- .
T Consensus         1 m~~--~~i~GtGniG~alA~~~a~ag~eV~igs~r~~~~~~a~a~~--l~~~i~~-~~~~dA~~---~aDVVvLAVP~-~   71 (211)
T COG2085           1 MMI--IAIIGTGNIGSALALRLAKAGHEVIIGSSRGPKALAAAAAA--LGPLITG-GSNEDAAA---LADVVVLAVPF-E   71 (211)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHH--HCCCCCC-CCHHHHHH---CCCEEEEECCH-H
T ss_conf             917--99962571878999999967973999647880678899986--4565334-77688884---39989995457-8


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCC---H------------HHHHHHHHHHHHC----CCCEECCCCC-CCCCCCCCCC
Q ss_conf             99999999972078998999679865---7------------8999999999847----9943067546-7600035684
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSH---F------------CDTQIRSLQLSEK----GIYFIGIGVS-GGVKGARSGA  140 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~---~------------~~t~~~~~~l~~k----gi~fid~pVS-GG~~gA~~G~  140 (475)
                      ++-+++.++...+. |+|+||.+|..   .            ..+...++.+...    ..+-+.+.+- ...... ...
T Consensus        72 a~~~v~~~l~~~~~-~KIvID~tnp~~~~~~~~~~~~~~~~~saae~va~~lp~akVVkAFn~i~a~~l~~~~~~~-~~~  149 (211)
T COG2085          72 AIPDVLAELRDALG-GKIVIDATNPIEVNGEPGDLYLVPSEGSAAEIVAKLLPGAKVVKAFNTIPAAVLADLAKPG-GRR  149 (211)
T ss_pred             HHHHHHHHHHHHHC-CEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHCCCCHHHHCCCCCCC-CCE
T ss_conf             77769999998709-9099966887544688301036888885999999977983014655035787731377768-756


Q ss_pred             -EEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             -378845489998889999987501
Q gi|254780716|r  141 -SLMVGGNEKAYNRVENILLSISAK  164 (475)
Q Consensus       141 -slMvGG~~~~~~~~~piL~~iaak  164 (475)
                       .+.+|-|.++-+.+..+.+.++-.
T Consensus       150 ~v~vagDD~~Ak~~v~~L~~~iG~~  174 (211)
T COG2085         150 DVLVAGDDAEAKAVVAELAEDIGFR  174 (211)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCC
T ss_conf             6898459499999999999962966


No 64 
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain. This family also includes lambda crystallin.
Probab=98.72  E-value=7.3e-07  Score=70.14  Aligned_cols=146  Identities=16%  Similarity=0.269  Sum_probs=95.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC------------------CCCCCCEECCCHHHHHHHC
Q ss_conf             0569815711168899999789859997399899999997122------------------1127840328989998605
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS------------------GLSQKVIVTKNLEQMVEAV   66 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~------------------~~~~~~~~~~s~~e~v~~l   66 (475)
                      +||+||.|.||..+|..++.+|++|.+||++++..+...+.-.                  .....+.+..+++++.   
T Consensus         1 kV~ViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~~l~~~~---   77 (180)
T pfam02737         1 KVAVIGAGTMGAGIAQVFARAGLEVVLVDISEEALEKARARIEKSLARLVEKGRLTEEDVDAVLARISFTTDLADAV---   77 (180)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHC---
T ss_conf             98999978899999999996799399997998999999999999899999725675676999985241058899975---


Q ss_pred             CCCCEEEEECCCHHHHHH-HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC----CCCEECCCCCCCCCCCCCCCE
Q ss_conf             778899997699069999-999997207899899967986578999999999847----994306754676000356843
Q gi|254780716|r   67 CKPRKILMMVTDGDPVDQ-LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK----GIYFIGIGVSGGVKGARSGAS  141 (475)
Q Consensus        67 ~~pr~Iil~vp~g~~v~~-vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k----gi~fid~pVSGG~~gA~~G~s  141 (475)
                       ..+.|+=++|..-.+.. ++.++-..+.++.|+ -..||... ..++++.+...    |.||...|--        -|.
T Consensus        78 -~adlViEav~E~l~iK~~l~~~l~~~~~~~~Il-aSnTS~l~-is~la~~~~~p~R~ig~HffnP~~~--------~pL  146 (180)
T pfam02737        78 -DADLVIEAVPENLDLKRELFAELDAIAPPDAIL-ASNTSSLS-ITELAAATKRPERFIGLHFFNPPPL--------MPL  146 (180)
T ss_pred             -CCCEEEECCCCCHHHHHHHHHHHHHHCHHHEEE-EECCCCCC-HHHHHHHCCCCCEEEEECCCCCCCC--------CCE
T ss_conf             -899999925176889999999999743033088-75267689-9999974798766999756887776--------853


Q ss_pred             --EEEEC--CHHHHHHHHHHHHHHHCC
Q ss_conf             --78845--489998889999987501
Q gi|254780716|r  142 --LMVGG--NEKAYNRVENILLSISAK  164 (475)
Q Consensus       142 --lMvGG--~~~~~~~~~piL~~iaak  164 (475)
                        ++.|.  ++++.+++..+++.+...
T Consensus       147 VEIv~g~~T~~~~~~~~~~~~~~lgk~  173 (180)
T pfam02737       147 VEVVRGEKTSPETVATVVELAKKIGKT  173 (180)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             888389998999999999999987996


No 65 
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=98.68  E-value=3.4e-05  Score=57.83  Aligned_cols=97  Identities=15%  Similarity=0.152  Sum_probs=72.9

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC--------CCCEECCCHHHHHHHCCCCCEEEE
Q ss_conf             880569815711168899999789859997399899999997122112--------784032898999860577889999
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS--------QKVIVTKNLEQMVEAVCKPRKILM   74 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~--------~~~~~~~s~~e~v~~l~~pr~Iil   74 (475)
                      +++|+|||.|.||.-+|..|++.|++|....|..  .+.+.++|-...        ..+..+.++++    +...++||+
T Consensus         5 ~~kI~IiGaGAiG~~~a~~L~~aG~~V~li~r~~--~~ai~~~Gl~i~~~~g~~~~~~~~~~~~~~~----~~~~D~viv   78 (313)
T PRK06249          5 TPRIAIIGTGAIGGFYGAMLARAGFDVHFLLRSD--YEAVRENGLQVDSVHGDFHLPQVQAYRSAED----MPPCDWVLV   78 (313)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCH--HHHHHHCCEEEEECCCCEEECCCEEECCHHH----CCCCCEEEE
T ss_conf             8889999914999999999996699569996755--9999868859996698289768402369778----399658999


Q ss_pred             ECCCHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             76990699999999972078998999679865
Q gi|254780716|r   75 MVTDGDPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        75 ~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                      ++.+. +++++...+.+.+.++.+|+-.-|.-
T Consensus        79 ~vKs~-~~~~~~~~l~~~~~~~t~il~lQNG~  109 (313)
T PRK06249         79 GLKTT-ANALLAPLIPQVAAPGAKVLLLQNGL  109 (313)
T ss_pred             ECCCC-CHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             53667-78999998786448995899944766


No 66 
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=98.66  E-value=2e-05  Score=59.60  Aligned_cols=98  Identities=17%  Similarity=0.280  Sum_probs=72.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC---C----CCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             0569815711168899999789859997399899999997122112---7----84032898999860577889999769
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS---Q----KVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~---~----~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      +|.|+|.|.||.=+|..|.++|++|+.+-|. +..+.+.+.|-...   .    ......+.++   .....++||+++.
T Consensus         2 kI~I~GaGAiG~~~a~~L~~~g~~V~lv~r~-~~~~~i~~~Gl~i~~~~~~~~~~~~~~~~~~~---~~~~~D~viva~K   77 (306)
T PRK12921          2 KIAVVGAGAVGGTFGARLLEAGRDVTFLGRS-ARAEALREKGLVIRSDHGDVTVPGPVITDPEE---ITGPFDLVILAVK   77 (306)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEC-CHHHHHHHCCEEEEECCCEEEEECCCCCCCHH---HCCCCCEEEEEEC
T ss_conf             8999992499999999998369988999700-09999997896999779769980610508056---5689768999704


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCH
Q ss_conf             906999999999720789989996798657
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHF  107 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~  107 (475)
                      + .++++++..+.+.+.++.+|+-+-|.-.
T Consensus        78 s-~~~~~a~~~l~~~~~~~t~il~lQNG~g  106 (306)
T PRK12921         78 A-YQLDAAIPDLKPLVGEDTVIIPLQNGIG  106 (306)
T ss_pred             C-CCHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             5-6779999999863399948999348775


No 67 
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]
Probab=98.60  E-value=2.4e-05  Score=58.94  Aligned_cols=175  Identities=18%  Similarity=0.220  Sum_probs=103.3

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCE---ECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898599973998999999971221127840---328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVI---VTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~---~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|.++|.|.||.-++..|.++|.+|..+.|++. .+++.+.|-.......   .......-.+.+..++.|++.+.+ .+
T Consensus         2 kI~IlGaGAvG~l~g~~L~~~g~~V~~~~R~~~-~~~l~~~GL~i~~~~~~~~~~~~~~~~~~~~~~~Dlviv~vKa-~q   79 (307)
T COG1893           2 KILILGAGAIGSLLGARLAKAGHDVTLLVRSRR-LEALKKKGLRIEDEGGNFTTPVVAATDAEALGPADLVIVTVKA-YQ   79 (307)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECHHH-HHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEECC-CC
T ss_conf             599987878999999999858995799810899-9999878979981688522443235673336788889998042-23


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC----CCCEECCCCCC-C-CCCCCCCC-E--EEEECCHHHHH
Q ss_conf             999999997207899899967986578999999999847----99430675467-6-00035684-3--78845489998
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK----GIYFIGIGVSG-G-VKGARSGA-S--LMVGGNEKAYN  152 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k----gi~fid~pVSG-G-~~gA~~G~-s--lMvGG~~~~~~  152 (475)
                      +++++..+.|.+.+...|+-.-|.--..- ++.+.....    |+.+.++.-.| | ..-+..|. .  .+.|+.++.++
T Consensus        80 ~~~al~~l~~~~~~~t~vl~lqNG~g~~e-~l~~~~~~~~il~G~~~~~a~~~~~g~v~~~g~g~~~ig~~~~~~~~~~~  158 (307)
T COG1893          80 LEEALPSLAPLLGPNTVVLFLQNGLGHEE-ELRKILPKETVLGGVTTHGAVREGPGHVVHTGLGDTVIGELRGGRDELVK  158 (307)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCHHH-HHHHHCCCCEEEEEEEECCEEECCCCEEEEECCCCEEEECCCCCCHHHHH
T ss_conf             89999998730799848999708972699-99873883428989984243871784599936785798426776307899


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             889999987501567861898569874678988776
Q gi|254780716|r  153 RVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHN  188 (475)
Q Consensus       153 ~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN  188 (475)
                      .+...|+.-.-.      +.+....=.....|.+-|
T Consensus       159 ~i~~~~~~a~~~------~~~~~di~~~~w~Kl~~N  188 (307)
T COG1893         159 ALAELFKEAGLE------VELHPDILAAIWRKLVVN  188 (307)
T ss_pred             HHHHHHHHCCCC------EEECHHHHHHHHHHHHHH
T ss_conf             999999828987------688677999999888863


No 68 
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=98.59  E-value=3e-05  Score=58.29  Aligned_cols=192  Identities=14%  Similarity=0.211  Sum_probs=119.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------CCC-------CCCCCEECCCHHHHHHH
Q ss_conf             805698157111688999997898599973998999999971-----------221-------12784032898999860
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-----------ISG-------LSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-----------~~~-------~~~~~~~~~s~~e~v~~   65 (475)
                      .+||+||-|.||..+|..++.+|++|.++|++++..+.-.+.           +.-       ....+++..+.++    
T Consensus       314 ~~v~ViGaG~MG~GIA~~~a~aG~~V~l~D~~~e~l~~g~~~~~~~~~~~v~~g~~~~~~~~~~l~ri~~~~~~~~----  389 (715)
T PRK11730        314 KQAAVLGAGIMGGGIAYQSASKGVPVIMKDINQKALDLGMNEAAKLLNKQVERGRIDGLKMAGVLSTITPTLDYAG----  389 (715)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCHH----
T ss_conf             2799978771079999999957995799978999999999999999999986489987999999956874154024----


Q ss_pred             CCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCC-CCCCCCCCCC
Q ss_conf             577889999769906999999-999720789989996798657899999999984----7994306754-6760003568
Q gi|254780716|r   66 VCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGV-SGGVKGARSG  139 (475)
Q Consensus        66 l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pV-SGG~~gA~~G  139 (475)
                      +..+++||=.|+..-.++.-+ .++-+.+.++.|+-. .||... -.++++.++.    -|.||...+- .--++     
T Consensus       390 l~~~DlVIEAV~E~l~~K~~vf~~l~~~~~~~aIlAs-NTSsl~-i~~lA~~~~~Per~iG~HFfnP~~~m~LVE-----  462 (715)
T PRK11730        390 FKDVDVVVEAVVENPKVKAAVLAEVEQKVREDTILAS-NTSTIS-ISLLAKALKRPENFCGMHFFNPVHRMPLVE-----  462 (715)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCCC-HHHHHHHCCCCCCEEEEEECCCCCCCCEEE-----
T ss_conf             3358889985436588999999999865587538851-576577-899997516821156522148844164488-----


Q ss_pred             CEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             437884--548999888999998750156786189856987467898877678788899989999999964289978999
Q gi|254780716|r  140 ASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEIS  217 (475)
Q Consensus       140 ~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~  217 (475)
                        +..|  -++++.+.+..+.+.+...      ...++ ...|-    +-|-|-   +-.+.|+..++..+  -++.+|-
T Consensus       463 --Vv~g~~Ts~~t~~~~~~~~~~lgK~------pVvv~-d~pGF----i~NRil---~~~~~ea~~l~~eG--a~~~~ID  524 (715)
T PRK11730        463 --VIRGEKTSDETIATVVAYASKMGKT------PIVVN-DCPGF----FVNRVL---FPYFAGFSQLLRDG--ADFRQID  524 (715)
T ss_pred             --EECCCCCCHHHHHHHHHHHHHCCCC------EEEEE-CCCCH----HHHHHH---HHHHHHHHHHHHCC--CCHHHHH
T ss_conf             --8168999999999999999981982------38982-46860----587899---99999999999879--9999999


Q ss_pred             HHHH-HCC
Q ss_conf             9998-606
Q gi|254780716|r  218 HLFS-KWD  224 (475)
Q Consensus       218 ~vf~-~w~  224 (475)
                      ..+. .|.
T Consensus       525 ~a~~~~~G  532 (715)
T PRK11730        525 KVMEKQFG  532 (715)
T ss_pred             HHHHHCCC
T ss_conf             99987479


No 69 
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]
Probab=98.58  E-value=5.4e-07  Score=71.12  Aligned_cols=110  Identities=17%  Similarity=0.254  Sum_probs=90.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|+.|+..|..+..-|++|.+||+...+..       ..........+++++....+   +|.+.+|-.+.+.
T Consensus       143 kTvGIiG~G~IG~~va~~l~afgm~v~~~d~~~~~~~-------~~~~~~~~~~~Ld~lL~~aD---iv~lh~PlT~eT~  212 (324)
T COG0111         143 KTVGIIGLGRIGRAVAKRLKAFGMKVIGYDPYSPRER-------AGVDGVVGVDSLDELLAEAD---ILTLHLPLTPETR  212 (324)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCC-------CCCCCCEECCCHHHHHHHCC---EEEECCCCCCHHH
T ss_conf             8899989878999999999867986999889886000-------12356311026999987699---9998389981222


Q ss_pred             HHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             999-9997207899899967986578999999999847994
Q gi|254780716|r   84 QLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        84 ~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      ..+ .+.+..+++|.++|.++-...-|...+.+.+++..|.
T Consensus       213 g~i~~~~~a~MK~gailIN~aRG~vVde~aL~~AL~~G~i~  253 (324)
T COG0111         213 GLINAEELAKMKPGAILINAARGGVVDEDALLAALDSGKIA  253 (324)
T ss_pred             CCCCHHHHHCCCCCCEEEECCCCCEECHHHHHHHHHCCCCC
T ss_conf             13799999448998199988875203589999999709831


No 70 
>KOG2380 consensus
Probab=98.57  E-value=5.3e-06  Score=63.77  Aligned_cols=149  Identities=17%  Similarity=0.135  Sum_probs=102.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      .||+||+|+||.=+|..|.++|+.|.++||+.  .++..+..+     ...++.+.|+|+  ..|++|++|+.. ..++.
T Consensus        54 ~IaIIGfGnmGqflAetli~aGh~li~hsRsd--yssaa~~yg-----~~~ft~lhdlce--rhpDvvLlctsi-lsiek  123 (480)
T KOG2380          54 VIAIIGFGNMGQFLAETLIDAGHGLICHSRSD--YSSAAEKYG-----SAKFTLLHDLCE--RHPDVVLLCTSI-LSIEK  123 (480)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCEEEECCCCH--HHHHHHHHC-----CCCCCCHHHHHH--CCCCEEEEEEHH-HHHHH
T ss_conf             89997137088999999986486267447500--689999741-----233461777875--489979997025-40998


Q ss_pred             HHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCC-CC--CCCCE-EE---EECC----HHHHH
Q ss_conf             99999720-789989996798657899999999984799430675467600-03--56843-78---8454----89998
Q gi|254780716|r   85 LIDKLKPL-LSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVK-GA--RSGAS-LM---VGGN----EKAYN  152 (475)
Q Consensus        85 vi~~l~~~-l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~-gA--~~G~s-lM---vGG~----~~~~~  152 (475)
                      |+...-+. ++.|.+++|-....- -.+....+--.+....+-+----||+ +.  -.|+- +.   --|.    .+-++
T Consensus       124 ilatypfqrlrrgtlfvdvlSvKe-fek~lfekYLPkdfDIlctHpmfGPksvnh~wqglpfVydkvRig~~~~r~ercE  202 (480)
T KOG2380         124 ILATYPFQRLRRGTLFVDVLSVKE-FEKELFEKYLPKDFDILCTHPMFGPKSVNHEWQGLPFVYDKVRIGYAASRPERCE  202 (480)
T ss_pred             HHHHCCCHHHCCCEEEEEEEECCH-HHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCCHHHHH
T ss_conf             998568034202106742343140-4789999858432666864477687768876666865999742143224628899


Q ss_pred             HHHHHHHHHHCC
Q ss_conf             889999987501
Q gi|254780716|r  153 RVENILLSISAK  164 (475)
Q Consensus       153 ~~~piL~~iaak  164 (475)
                      .+..||.....+
T Consensus       203 ~fleIf~cegck  214 (480)
T KOG2380         203 FFLEIFACEGCK  214 (480)
T ss_pred             HHHHHHHHCCCE
T ss_conf             999999852770


No 71 
>PRK09287 6-phosphogluconate dehydrogenase; Validated
Probab=98.57  E-value=1e-06  Score=69.10  Aligned_cols=110  Identities=15%  Similarity=0.241  Sum_probs=85.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHH---HHCCCEEEHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             7889999999999999999999999999611014566798899998---5189468537899999998708885200079
Q gi|254780716|r  316 FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI---WRAGCIIRSQILNDIVKSLTEDPSSTNLLNI  392 (475)
Q Consensus       316 ~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~i---W~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~  392 (475)
                      ..-|++.+++.+-.+.+-.++.++++|+..     .+++..+|+++   |+.|- ++|.||+-..+++.+..+...-.+.
T Consensus       166 aGHfvKMVHNGIEY~~MQ~iaE~y~~lk~~-----~~~~~~ei~~vF~~wn~g~-l~SyLieIT~~il~~kd~~~g~~lv  239 (459)
T PRK09287        166 AGHYVKMVHNGIEYGDMQLIAEAYDLLKDG-----LGLSAEEIADVFAEWNKGE-LNSYLIEITADILRQKDEETGKPLV  239 (459)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCCHHHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             522889987015578899999999999874-----1899899999999984686-2269999999999851777798352


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH-HHHH
Q ss_conf             899999995247699999999983998479999999-9986
Q gi|254780716|r  393 PSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALS-YFDT  432 (475)
Q Consensus       393 ~~~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL~-y~~~  432 (475)
                      +.|.+....+.++ ||++..|++.|+|+|++.+|+. .+.+
T Consensus       240 d~I~D~a~qkGTG-~Wt~~~al~lgvp~p~I~~Av~aR~~S  279 (459)
T PRK09287        240 DVILDKAGQKGTG-KWTSQSALDLGVPLTLITEAVFARYLS  279 (459)
T ss_pred             HHHCCCCCCCCCH-HHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             3312544578716-879999998099928999999999985


No 72 
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=98.55  E-value=7.2e-07  Score=70.20  Aligned_cols=115  Identities=17%  Similarity=0.259  Sum_probs=92.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ..+||+||+|+.|+.+|+.+..-|.+|.+||+++....  ..       ......+++++....   ++|.+++|-.+.+
T Consensus        36 gk~vgIiG~G~IG~~va~~l~~fg~~V~~~d~~~~~~~--~~-------~~~~~~~l~~ll~~s---Dii~~~~plt~~T  103 (176)
T pfam02826        36 GKTVGIIGLGRIGRAVARRLKAFGMKVIAYDRYPKAEA--EA-------LGARYVSLDELLAES---DVVSLHLPLTPET  103 (176)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCCCHH--HH-------CCEEECCHHHHHHHC---CEEEECCCCCCCC
T ss_conf             99999989699999999999983981254379876102--31-------571666899998629---9887547674202


Q ss_pred             HHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC
Q ss_conf             9999-9997207899899967986578999999999847994306754
Q gi|254780716|r   83 DQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV  129 (475)
Q Consensus        83 ~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV  129 (475)
                      ...+ .+.+..++++.++|.+|-...-|...+.+.+++..+.....=|
T Consensus       104 ~~li~~~~l~~mk~~a~lIN~sRG~ivde~aL~~aL~~~~i~~a~lDV  151 (176)
T pfam02826       104 RHLINAERLALMKPGAILINTARGGLVDEDALIAALKSGRIAGAALDV  151 (176)
T ss_pred             CCCCCHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEEC
T ss_conf             463469999851899889980675512899999999809915899846


No 73 
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional
Probab=98.53  E-value=3.9e-07  Score=72.11  Aligned_cols=114  Identities=14%  Similarity=0.240  Sum_probs=89.9

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHC-CCCCCCCCCH
Q ss_conf             278899999999999999999999999996110145667988999985189468537899999998708-8852000798
Q gi|254780716|r  315 CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTED-PSSTNLLNIP  393 (475)
Q Consensus       315 ~~~~~i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~-~~l~~Ll~~~  393 (475)
                      ...-|++.+++.+-.+.+-.++.++++|+......  +.++++|++-|+.| .++|+||+-..+++.+. .+..+-.+.+
T Consensus       180 GaGH~vKMVHNGIEY~~mq~iaE~y~il~~~~~~~--~~~i~~vf~~Wn~g-~l~syLieIt~~il~~~~~~~~~~~~ld  256 (474)
T PTZ00142        180 SSGHYVKMVHNGIEYGDMQLISEAYKLMKHILGMS--NLELSEVFNKWNEG-ILDSYLIEITADILAKKKDELPNNHLVD  256 (474)
T ss_pred             CCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCC--HHHHHHHHHHHHCC-CHHHHHHHHHHHHHHHCCCCCCCCCCHH
T ss_conf             71031001035403899999999999998735999--89999999998376-5347999999999975236878982413


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH-HHHH
Q ss_conf             99999995247699999999983998479999999-9986
Q gi|254780716|r  394 SISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALS-YFDT  432 (475)
Q Consensus       394 ~~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL~-y~~~  432 (475)
                      .+.+....+.++ ||++..|++.|+|+|++.+|+. .+.|
T Consensus       257 ~I~d~a~~kGTG-~Wt~~~al~lgvp~p~i~~av~aR~lS  295 (474)
T PTZ00142        257 KILDIAGQKGTG-KWTAIEALDRGIPVPLIAESVDARCIS  295 (474)
T ss_pred             HHCCCCCCCCCH-HHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             200555688736-989999998099927999999999975


No 74 
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=98.52  E-value=7.5e-05  Score=55.33  Aligned_cols=193  Identities=11%  Similarity=0.139  Sum_probs=120.0

Q ss_pred             CEEEEEECCHHHHHHHH-HHHHCCCEEEEEECCHHHHHHHHHHCCC------------------CCCCCEECCCHHHHHH
Q ss_conf             80569815711168899-9997898599973998999999971221------------------1278403289899986
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSL-NILDKGFRLAVYNKDFELTDVFIKKISG------------------LSQKVIVTKNLEQMVE   64 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~-nL~~~G~~V~vydr~~~~~~~l~~~~~~------------------~~~~~~~~~s~~e~v~   64 (475)
                      .+||+||-|.||..+|. ..++.|++|..+|++++..+.-.+....                  ....+++..+.+    
T Consensus       310 ~kv~ViGaG~MG~gIA~~~a~~aG~~V~l~D~~~e~l~~~~~~i~~~l~~~v~~g~~~~~~~~~~l~~i~~~~~~~----  385 (706)
T PRK11154        310 NKVGVLGGGLMGGGIAYVTATKAGLPVRIKDINPQGINHALKYSWDLLDKKVKRRHMTPAERDKQMALISGTTDYR----  385 (706)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCEEEECCHH----
T ss_conf             6799986473238999999998698799997999999999998899999998618999899999862241004412----


Q ss_pred             HCCCCCEEEEECCCHHHHHH-HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH--H--CCCCEECC-CCCCCCCCCCC
Q ss_conf             05778899997699069999-9999972078998999679865789999999998--4--79943067-54676000356
Q gi|254780716|r   65 AVCKPRKILMMVTDGDPVDQ-LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS--E--KGIYFIGI-GVSGGVKGARS  138 (475)
Q Consensus        65 ~l~~pr~Iil~vp~g~~v~~-vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~--~--kgi~fid~-pVSGG~~gA~~  138 (475)
                      .+...+.||-.|+..-.+.. |+.++-..+.++.|+.--+.+-+-+.  +++.++  +  -|.||.-. ++.--++    
T Consensus       386 ~~~~~DlVIEAv~E~~~~K~~v~~~le~~~~~~aIlAtNTSsl~i~~--la~~~~rP~r~iG~HFfnP~~~m~LVE----  459 (706)
T PRK11154        386 GFKHADLVIEAVFEDLALKQQMVADVEQNCAEHTIFASNTSSLPIGQ--IAAAAARPEQVIGLHYFSPVEKMPLVE----  459 (706)
T ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHH--HHHHCCCCCEEEEEEECCCCCCCCEEE----
T ss_conf             31568879997145288899999999964798858950676776899--998647841045544257744264279----


Q ss_pred             CCEEEEE--CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             8437884--54899988899999875015678618985698746789887767878889998999999996428997899
Q gi|254780716|r  139 GASLMVG--GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEI  216 (475)
Q Consensus       139 G~slMvG--G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i  216 (475)
                         +..|  -++++.+.+..+.+.+...      ...+++ ..|-.    -|=|   .+..+.|+..++..+  .+.++|
T Consensus       460 ---Vi~g~~Ts~et~~~~~~~~~~lgK~------pv~v~d-~pGFi----~NRi---l~~~~~ea~~l~~eG--~~~~~I  520 (706)
T PRK11154        460 ---VIPHAKTSAETIATTVALAKKQGKT------PIVVKD-GAGFY----VNRI---LAPYMNEAARLLLEG--EPIEHI  520 (706)
T ss_pred             ---EECCCCCCHHHHHHHHHHHHHCCCE------EEEECC-CCCCH----HHHH---HHHHHHHHHHHHHCC--CCHHHH
T ss_conf             ---9437898389999999999975987------899632-37417----9999---999999999999769--999999


Q ss_pred             HHHHHHCCC
Q ss_conf             999986068
Q gi|254780716|r  217 SHLFSKWDT  225 (475)
Q Consensus       217 ~~vf~~w~~  225 (475)
                      -..+..|.-
T Consensus       521 D~a~~~~G~  529 (706)
T PRK11154        521 DAALVKFGF  529 (706)
T ss_pred             HHHHHHCCC
T ss_conf             999997599


No 75 
>PRK06436 glycerate dehydrogenase; Provisional
Probab=98.52  E-value=3.4e-06  Score=65.17  Aligned_cols=109  Identities=15%  Similarity=0.240  Sum_probs=89.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      -+++|+||+|+.|+.+|+.+..-|.+|.+|||+...      +.     ....+.+++|+...   .++|.+.+|-.+.+
T Consensus       122 gktvGIiG~G~IG~~vA~~~~afg~~V~~~~r~~~~------~~-----~~~~~~~~~ell~~---sDivslh~Plt~~T  187 (303)
T PRK06436        122 NKSLGILGYGGIGRRVALLAKAFGMNIYAYTRSYVN------DG-----ISSIYMEPEDIMKK---SDFVLISLPLTDET  187 (303)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCC------CC-----CCEEECCHHHHHHH---CCEEEEECCCCHHH
T ss_conf             888999897656999999999779889998985322------45-----74552689999975---99999925786556


Q ss_pred             HHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             99999-99720789989996798657899999999984799430
Q gi|254780716|r   83 DQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        83 ~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                      ...++ +.+..+++|.++|.++-...-|...+.+.|++..+...
T Consensus       188 ~~lI~~~~l~~MK~~a~lIN~aRG~iVde~aL~~aL~~g~i~ga  231 (303)
T PRK06436        188 RGMINSKMLSLFRKGLAIINVARADVVDKNDMLNFLRNHNDKYY  231 (303)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCEECHHHHHHHHHHCCCEEE
T ss_conf             77768999985699978999278654689999999981996599


No 76 
>pfam10727 Rossmann-like Rossmann-like domain. This family of proteins contain a Rossmann-like domain.
Probab=98.51  E-value=3.1e-06  Score=65.51  Aligned_cols=96  Identities=14%  Similarity=0.198  Sum_probs=77.1

Q ss_pred             EEEECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHH
Q ss_conf             6981571116889999978985999-739989999999712211278403289899986057788999976990699999
Q gi|254780716|r    7 GIIGLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQL   85 (475)
Q Consensus         7 GiIGLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~v   85 (475)
                      ||||-|++|..++..|.++||.|++ |.|+.+..+.+.+...      ..+.++.|++...   ++||+++|++ ...++
T Consensus         1 GiIGaGrvG~~L~~al~~aGh~v~gv~srs~~s~~~a~~~~~------~~~~~~~ev~~~a---dlv~itvPDd-~I~~v   70 (111)
T pfam10727         1 GIISAGRVGVALGEALERAGHVVHAISAISDASRERAERRLD------SPVLPIPDVIRRA---ELVVLAVPDA-ELPGL   70 (111)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHCC------CCCCCHHHHHHHC---CEEEEECCHH-HHHHH
T ss_conf             943765779999999997898289998389889999998669------9767958989767---9999989788-89999


Q ss_pred             HHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             999972078998999679865789999
Q gi|254780716|r   86 IDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        86 i~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      .++|.....+|++++-||-.+-.+..+
T Consensus        71 v~~la~~~~~GqiV~HtSGa~g~~vL~   97 (111)
T pfam10727        71 VEGLAATVRRGQIVAHTSGAHGIGILA   97 (111)
T ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHC
T ss_conf             999983267997999866875077614


No 77 
>PRK12480 D-lactate dehydrogenase; Provisional
Probab=98.51  E-value=1.5e-06  Score=67.90  Aligned_cols=115  Identities=13%  Similarity=0.159  Sum_probs=92.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ...+|+||+|+.|+.+|+.+..-|.+|.+||+.+++..          +......+++|+....   ++|.+.+|-.+.+
T Consensus       146 gktvGIiG~G~IG~~va~~~~~fg~~Vi~yD~~~~~~~----------~~~~~~~sleell~~s---DiIslh~Plt~~T  212 (330)
T PRK12480        146 NMTVAIIGTGRIGAATAKIYAGFGATITAYDAYPNKDL----------DFLTYKDSVKEAIKDA---DIISLHVPANKES  212 (330)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCC----------CCCEECCCHHHHHHHC---CEEEECCCCCHHH
T ss_conf             86899967588999999998756998999899864221----------2132327899998759---9999737685331


Q ss_pred             HHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC
Q ss_conf             99999-9972078998999679865789999999998479943067546
Q gi|254780716|r   83 DQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS  130 (475)
Q Consensus        83 ~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS  130 (475)
                      ...++ +.+..+++|.++|.++-...-|...+.+.|++..|.-.+.=|-
T Consensus       213 ~~lIn~~~l~~MK~~ailINtaRG~iVde~aL~~AL~~g~I~gAgLDV~  261 (330)
T PRK12480        213 YHLFDKAMFDHVKKGAILVNAARGAVINTPDLIAAVNDGTLLGAAIDTY  261 (330)
T ss_pred             HCCHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHCCCEEEEEEECC
T ss_conf             2004899997579997699727863319999999997598458998558


No 78 
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]
Probab=98.47  E-value=3.8e-06  Score=64.89  Aligned_cols=113  Identities=19%  Similarity=0.279  Sum_probs=89.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|..|+.+|+++..-|.+|..|||++.  .+..++.     ....+ ++.|+....+   +|.+.+|..+.+.
T Consensus       147 ktvGIiG~GrIG~avA~r~~~Fgm~v~y~~~~~~--~~~~~~~-----~~~y~-~l~ell~~sD---ii~l~~Plt~~T~  215 (324)
T COG1052         147 KTLGIIGLGRIGQAVARRLKGFGMKVLYYDRSPN--PEAEKEL-----GARYV-DLDELLAESD---IISLHCPLTPETR  215 (324)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCC--HHHHHHC-----CCEEC-CHHHHHHHCC---EEEEECCCCHHHH
T ss_conf             8889978488999999987217968998668874--5557405-----86041-6899997699---9999779983766


Q ss_pred             HHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             999-99972078998999679865789999999998479943067
Q gi|254780716|r   84 QLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        84 ~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ..+ .+.+..+++|.++|.++=-..-|...+.+.+++..+.-.+.
T Consensus       216 hLin~~~l~~mk~ga~lVNtaRG~~VDe~ALi~AL~~g~i~gagl  260 (324)
T COG1052         216 HLINAEELAKMKPGAILVNTARGGLVDEQALIDALKSGKIAGAGL  260 (324)
T ss_pred             HHCCHHHHHHCCCCEEEEECCCCCEECHHHHHHHHHCCCCCEEEE
T ss_conf             532999997568976999648742165999999998097422670


No 79 
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)). Members of this protein family are the eukaryotic enzyme, glycerol-3-phosphate dehydrogenase (NAD(+)) (EC 1.1.1.8). Enzymatic activity for 1.1.1.8 is defined as sn-glycerol 3-phosphate + NAD(+) = glycerone phosphate + NADH. Note the very similar reactions of enzymes defined as EC 1.1.1.94 and 1.1.99.5, assigned to families of proteins in the bacteria.
Probab=98.46  E-value=4e-06  Score=64.72  Aligned_cols=148  Identities=15%  Similarity=0.237  Sum_probs=91.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC--------CEEEEEECCHHH-----HHHHHHHC--------CCCCCCCEECCCHHHHH
Q ss_conf             0569815711168899999789--------859997399899-----99999712--------21127840328989998
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG--------FRLAVYNKDFEL-----TDVFIKKI--------SGLSQKVIVTKNLEQMV   63 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G--------~~V~vydr~~~~-----~~~l~~~~--------~~~~~~~~~~~s~~e~v   63 (475)
                      +|++||-|.||.++|..|+++|        ++|..|-|.++.     ++...+.+        -...+++....++++.+
T Consensus         1 KI~ViGaGawGTALA~~La~ng~~~~~~~~~~V~lw~r~~~~~~~~~~~~in~~~~N~~yLp~i~Lp~~i~~t~dl~~~~   80 (342)
T TIGR03376         1 RVAVVGSGNWGTAIAKIVAENARALPELFEESVRMWVFEEEIEGRNLTEIINTTHENVKYLPGIKLPANLVAVPDLVEAA   80 (342)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCHHHHH
T ss_conf             98998779999999999997488654557863799972322100468999974496867798784898608966899998


Q ss_pred             HHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCH--HH-HHHHHHHHHH-CCCCEECCCCCCCCC----C
Q ss_conf             60577889999769906999999999720789989996798657--89-9999999984-799430675467600----0
Q gi|254780716|r   64 EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHF--CD-TQIRSLQLSE-KGIYFIGIGVSGGVK----G  135 (475)
Q Consensus        64 ~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~--~~-t~~~~~~l~~-kgi~fid~pVSGG~~----g  135 (475)
                      +.   .++|++.+|+ +.+.++++++.++++++.++|.++--.-  .+ .....+.+++ .+..   +.|-.||.    -
T Consensus        81 ~~---ad~ii~avPs-~~~r~~~~~l~~~l~~~~~ii~~sKGle~~~~~~~~~seii~e~~~~~---~~vLsGPs~A~EV  153 (342)
T TIGR03376        81 KG---ADILVFVIPH-QFLEGICKQLKGHVKPNARAISCIKGLEVSKDGVKLLSDIIEEELGIP---CGVLSGANLANEV  153 (342)
T ss_pred             HC---CCEEEEECCH-HHHHHHHHHHHHHCCCCCEEEEEECCEEECCCCCCCHHHHHHHHHCCC---EEEEECCCCHHHH
T ss_conf             36---9889996686-999999999985458887389842344436998311999999985998---6997277638998


Q ss_pred             CCCCCE-EEEECC-----HHHHHHHHHHHH
Q ss_conf             356843-788454-----899988899999
Q gi|254780716|r  136 ARSGAS-LMVGGN-----EKAYNRVENILL  159 (475)
Q Consensus       136 A~~G~s-lMvGG~-----~~~~~~~~piL~  159 (475)
                      |+.-|+ ..+++.     .+.-+.++.+|.
T Consensus       154 a~~~pt~~~vA~~~~~~~~~~a~~i~~lf~  183 (342)
T TIGR03376       154 AKEKFSETTVGYRDPADFDVDARVLKALFH  183 (342)
T ss_pred             HCCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             638886438984374124999999999978


No 80 
>PRK07574 formate dehydrogenase; Provisional
Probab=98.45  E-value=4.1e-06  Score=64.64  Aligned_cols=151  Identities=13%  Similarity=0.113  Sum_probs=106.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH--HHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             805698157111688999997898599973998--999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF--ELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~--~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +++|+||+|+.|+.+|+++..-|.+|..||+.+  +..+.   +     .++..+.+++|+...++   +|-+.+|-.+.
T Consensus       193 KTlGIVG~GrIG~~VArra~aFgm~Vl~yDp~~l~~~~e~---~-----lg~~~~~sldeLl~~sD---vVslh~PLt~e  261 (385)
T PRK07574        193 MTVGTVGAGRIGLAVLRRLKPFDVTLHYTDRHRLPAEVEQ---E-----LGLTYHPDVDSLVSVCD---VVTIHCPLHPE  261 (385)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHH---H-----CCCCCCCCHHHHHHHCC---EEEECCCCCHH
T ss_conf             9899989788999999999977998998588669889999---7-----19865689999986289---69986679857


Q ss_pred             HHHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCC-----CCCC-EEE----EECCHHH
Q ss_conf             999999-9972078998999679865789999999998479943067546760003-----5684-378----8454899
Q gi|254780716|r   82 VDQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGA-----RSGA-SLM----VGGNEKA  150 (475)
Q Consensus        82 v~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA-----~~G~-slM----vGG~~~~  150 (475)
                      +...++ +.+..+++|.++|+++-...-|...+.+.|++..+.-.+.-|--.+...     ++=+ .+|    .|-..++
T Consensus       262 T~~Lin~~~l~~MK~ga~LVNtARG~iVDe~AL~~AL~sG~i~gaglDV~~~EP~p~dhPl~~lpNv~lTPHiaG~t~~A  341 (385)
T PRK07574        262 TEHLFDKDVLSRMKRGSYLVNTARGKIVDRDAVVEALESGHLAGYAGDVWFPQPAPADHPWRTMPRNAMTPHISGTTLSA  341 (385)
T ss_pred             HHHHCCHHHHHCCCCCCEEEECCCCHHCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHCCCCCEECCCCCCCCHHH
T ss_conf             74010299994389981899888611019999999997298049996789988998998022299616888545486999


Q ss_pred             HHH----HHHHHHHHHCCC
Q ss_conf             988----899999875015
Q gi|254780716|r  151 YNR----VENILLSISAKY  165 (475)
Q Consensus       151 ~~~----~~piL~~iaak~  165 (475)
                      -.+    ++.+|+.+-..-
T Consensus       342 q~R~a~g~~~~l~~~~~g~  360 (385)
T PRK07574        342 QARYAAGTREILECFFEGR  360 (385)
T ss_pred             HHHHHHHHHHHHHHHHCCC
T ss_conf             9999998999999996599


No 81 
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=98.42  E-value=6.1e-06  Score=63.37  Aligned_cols=107  Identities=20%  Similarity=0.342  Sum_probs=89.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|+.|+.+|.....-|.+|.+||+.+..     .     ..+...+.+++|+....+   +|-+-+|-.+.+.
T Consensus       152 KtlGIIG~G~IG~~VA~~a~~fGm~Vi~yD~~~~~-----~-----~~~~~~~~sl~ell~~sD---~IslH~Plt~~T~  218 (409)
T PRK11790        152 KTLGIVGYGHIGTQLSVLAESLGMRVIFYDIEDKL-----P-----LGNATQVGSLEELLAQSD---VVSLHVPETPSTK  218 (409)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCHHHC-----C-----CCCCEECCCHHHHHHHCC---EEEECCCCCHHHH
T ss_conf             78986367547699999998769989997860212-----5-----668467488999987599---9998267984663


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             9999-997207899899967986578999999999847994
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      ..++ +.+..+++|.++|.++-...-|...+.+.|++..+.
T Consensus       219 ~lIn~~~l~~MK~ga~LIN~ARG~iVDe~AL~~AL~~g~I~  259 (409)
T PRK11790        219 NMIGAEELALMKPGAILINASRGTVVDIDALADALKSGHLA  259 (409)
T ss_pred             CCCCHHHHHHCCCCCEEEECCCCHHCCHHHHHHHHHCCCCC
T ss_conf             10439999726999899986885103999999999739930


No 82 
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional
Probab=98.42  E-value=0.00012  Score=53.69  Aligned_cols=176  Identities=15%  Similarity=0.202  Sum_probs=115.5

Q ss_pred             EEEEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             05698-15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +|.+| |-|.||.=+++-|...||.|.+.|+..                   ..+.+++.   +.+++|+++||= ..+.
T Consensus       100 ~i~IIGG~G~mG~~F~~~f~~sGy~V~ild~~d-------------------w~~~~~~~---~~advViVsVPI-~~T~  156 (374)
T PRK11199        100 PVVIVGGKGQLGRLFAKMLTLSGYQVRILEKDD-------------------WDRADDIL---ADAGMVIVSVPI-HLTE  156 (374)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCC-------------------CCCHHHHH---HCCCEEEEEECH-HHHH
T ss_conf             179980798277999999996798799616444-------------------53489887---179989998145-8899


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCCCCCCCCE-EE-EECCHHHHHHHHHHHHH
Q ss_conf             99999972078998999679865789999999998479943067-54676000356843-78-84548999888999998
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVKGARSGAS-LM-VGGNEKAYNRVENILLS  160 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~gA~~G~s-lM-vGG~~~~~~~~~piL~~  160 (475)
                      +|+.++ |.+.++.++.|.+..--.-.   .+-++......++. |+-|-..+...|.. +. .|...+.|..+.+.|+.
T Consensus       157 ~VI~~l-~~l~~~~lL~DiTSvK~~Pl---~aMl~~h~gpV~GlHPMFGP~v~sl~~QvVV~c~gr~~e~~~wl~~~~~~  232 (374)
T PRK11199        157 EVIEKL-PPLPEDCILVDLTSVKNGPL---QAMLAAHSGPVLGLHPMFGPDVGSLAKQVVVVCDGRQPEAYQWLLEQIQI  232 (374)
T ss_pred             HHHHHC-CCCCCCCEEEECHHCCHHHH---HHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH
T ss_conf             999857-78999868986100427899---99998568985022778799964447876998899983778999999998


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             7501567861898569874678988776787888999899999999642899789999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISH  218 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~  218 (475)
                      .+++      +..+-+.-.-..+-.| -|.-+-.  .++=+..+.+  .+.+.+++.+
T Consensus       233 ~Ga~------l~~~~~~eHD~~Ma~V-QgL~HF~--~~~~g~~L~~--~~~dl~~ll~  279 (374)
T PRK11199        233 WGAR------LHRISAVEHDQAMAFI-QALRHFS--TFAYGLHLAK--ENVDLEQLLA  279 (374)
T ss_pred             HCCE------EEECCHHHHHHHHHHH-HHHHHHH--HHHHHHHHHH--CCCCHHHHHH
T ss_conf             4878------9986888888997999-9999999--9999999986--4999899987


No 83 
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=98.40  E-value=2.2e-06  Score=66.67  Aligned_cols=96  Identities=15%  Similarity=0.281  Sum_probs=70.1

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8805698157111688999997898-599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..++-+||.|.||..++.+|.+.|. +|+++|||.++++++.++.....-.+.   +.+++-+.+...++|+.+.+++.+
T Consensus        12 ~~~vlVIGaG~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~~~~~~---~~~~l~~~l~~~DivI~aT~s~~~   88 (134)
T pfam01488        12 GKKVLLIGAGEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGEEVEAL---PLDELEELLAEADIVISATSAPTP   88 (134)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEEE---ECHHHHHHHHHCCEEEEECCCCCC
T ss_conf             89899999609999999999975998899954757899999998499725898---513544136319999992599973


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +-.  .+.+....+..++||.+
T Consensus        89 ii~--~~~~~~~~~~~~iiDLa  108 (134)
T pfam01488        89 IIT--KEMVEEALKGLLFVDIA  108 (134)
T ss_pred             EEC--HHHHHHCCCCEEEEEEC
T ss_conf             648--99997443985999834


No 84 
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=98.39  E-value=2.8e-05  Score=58.51  Aligned_cols=111  Identities=15%  Similarity=0.241  Sum_probs=85.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHC--CCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             056981571116889999978--98599-973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDK--GFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~--G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +||+||+|.||...++.+.+.  ++++. ++|+++++.+.+.++.     ++..+.+.+++.+. ++++.|+++.|+..+
T Consensus         2 ki~iiG~G~~g~~~~~~~~~~~~~~~i~ai~d~~~~~~~~~~~~~-----~~~~~~~~~~~l~~-~~iD~v~I~tp~~~H   75 (120)
T pfam01408         2 RVGIVGAGKIGRRHLRALNESQDGAELVGVLDPDPARAEAVAESF-----GVPAYSDLEELLAD-PDVDAVSVATPPGLH   75 (120)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHH-----CCCEECCHHHHHHC-CCCCEEEECCCHHHH
T ss_conf             899990779999999999855999789999829999999999983-----99678869999737-788989990874618


Q ss_pred             HHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             999999997207899899967-9865789999999998479943
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      .+-+..-+...   -.++++= -..+.++..+..+.++++|..+
T Consensus        76 ~~~~~~~l~~g---~~v~~EKP~~~~~~e~~~l~~~a~~~~~~~  116 (120)
T pfam01408        76 FELALAALEAG---KHVLVEKPLATTVEEAKELVELAEKKGVRL  116 (120)
T ss_pred             HHHHHHHHHHC---CEEEEECCCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             99999999819---989996898199999999999999829969


No 85 
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=98.38  E-value=9.7e-06  Score=61.85  Aligned_cols=108  Identities=17%  Similarity=0.254  Sum_probs=87.4

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEEC--CHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978985999739--98999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNK--DFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr--~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      .++|+||+|+.|+.+|+.+..-|.+|.+||+  ++++.+++         ++.. .+++|+.   ++.++|-+-+|-.+.
T Consensus       139 ktlGIiG~G~IG~~vA~~~~~fgm~Vi~yDP~~~~~~~~~~---------gv~~-~~l~ell---~~sD~IslH~Plt~e  205 (524)
T PRK13581        139 KTLGVIGLGRIGSEVAKRAKAFGMKVIAYDPYISPERAAQL---------GVEL-VELDELL---ARADFITLHTPLTPE  205 (524)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHC---------CCEE-EEHHHHH---HHCCEEEECCCCCHH
T ss_conf             88999776757899999998549747887776446679871---------9668-6089973---108899993678615


Q ss_pred             HHHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             999999-9972078998999679865789999999998479943
Q gi|254780716|r   82 VDQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        82 v~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      +...++ +.+..+++|.++|.++-...-|...+.+.|++..+..
T Consensus       206 T~~li~~~~~~~MK~ga~lIN~aRG~iVde~aL~~AL~~g~i~g  249 (524)
T PRK13581        206 TRNLIGAEELAKMKPGVRIINCARGGIIDEAALAEALKSGKVAG  249 (524)
T ss_pred             HHHHCCHHHHHHCCCCCEEEECCCCCEECHHHHHHHHHCCCCCE
T ss_conf             54430799996068998699748876058999999996499765


No 86 
>PRK08605 D-lactate dehydrogenase; Validated
Probab=98.36  E-value=1e-05  Score=61.71  Aligned_cols=116  Identities=14%  Similarity=0.149  Sum_probs=88.9

Q ss_pred             CCEEEEEECCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8805698157111688999997-898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILD-KGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~-~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..++|+||+|+.|+.+|+.+++ -|.+|.+||+.++..  .. .      .+....+++|+....   ++|.+.+|..+.
T Consensus       146 ~ktvGIiG~G~IG~~vak~~a~~fgm~vi~yd~~~~~~--~~-~------~~~~~~~l~ell~~s---DiIslh~Plt~~  213 (332)
T PRK08605        146 DLKVAVIGTGRIGLAVAKIFAKGYGCDVVAYDPFPNAK--AA-T------YVDYKDTIEEAVEGA---DIVTLHMPATKY  213 (332)
T ss_pred             CCEEEEEEEEHHHHHHHHHHHHHCCCEEEEECCCCCHH--HH-H------CCEECCCHHHHHHHC---CEEEEECCCCHH
T ss_conf             77899997436889999999875698267877887655--66-2------070216899998649---999993368835


Q ss_pred             HHHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC
Q ss_conf             999999-9972078998999679865789999999998479943067546
Q gi|254780716|r   82 VDQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS  130 (475)
Q Consensus        82 v~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS  130 (475)
                      +...++ +.+..++++.++|.++-...-|...+.+.|++..+.-.+.-|-
T Consensus       214 T~~lI~~~~l~~MK~~a~lINtaRG~iVde~aL~~AL~~g~I~gAalDVf  263 (332)
T PRK08605        214 NTYLFNADLFKHFKKGAVFVNCARGSLVDTKALLDALDNGLIKGAALDTY  263 (332)
T ss_pred             HHHHCCHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEEEECC
T ss_conf             50121899997224796899906865338999999998198128998537


No 87 
>pfam00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain. This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each.
Probab=98.35  E-value=2.2e-06  Score=66.57  Aligned_cols=113  Identities=8%  Similarity=0.137  Sum_probs=79.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CCCCHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             6987467898877678788899989999999964---2899789999998606884-43079999999997405679995
Q gi|254780716|r  175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS---LNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSSSDTITGMP  250 (475)
Q Consensus       175 G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~---~~~~~~~i~~vf~~w~~~~-~~syLl~i~~~il~~k~~~~g~~  250 (475)
                      .+..-..+++-+.+++-.+.+-..+.+|++++.+   .+. +..+++|..-|..|- ++|.||+-..+++.+..+...=.
T Consensus       133 ~~~~~~~~i~~L~~Aly~s~i~syaQGf~li~~as~~~~W-~lnl~~Ia~iWr~GCIIRs~lL~~i~~a~~~~~~l~nLl  211 (290)
T pfam00393       133 DKGDKAEFIEDVRQALYASKIVSYAQGFMLLRAASKEYGW-NLNLGEIARIWRGGCIIRAQFLDKIKDAYEKNPDLPNLL  211 (290)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHCCCCEEEHHHHHHHHHHHHCCCCCCCCC
T ss_conf             6543789999999999999999999999999999998277-888899999855886654998999999985499731201


Q ss_pred             CHHHCCCCCCCC-CHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             200102333658-71677898877517888514677788
Q gi|254780716|r  251 IIDVICDKASQK-GTGIRSIIEGHKLSSSMTITETAIFA  288 (475)
Q Consensus       251 lid~i~d~~~~k-gTg~Wt~~~a~~lgvp~p~i~~av~a  288 (475)
                      +.+.+.+....+ -.-+-.+..|++.|+|+|++.+|+.-
T Consensus       212 ~~~~f~~~l~~~~~~lR~vV~~ai~~giP~PalSsaL~Y  250 (290)
T pfam00393       212 LDPYFKKEIKEYQQSWRRVVAIAVEAGIPVPAFSSALSY  250 (290)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             359999999999999999999999859983889999999


No 88 
>PRK13243 glyoxylate reductase; Reviewed
Probab=98.35  E-value=5.4e-06  Score=63.72  Aligned_cols=112  Identities=21%  Similarity=0.307  Sum_probs=89.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|+.|+.+|+.+..-|.+|.+||+....-  ..++.     ++ ...+++++..   ..++|.+.+|-.+.+.
T Consensus       151 ktlGIiG~G~IG~~vak~~~~fgm~V~~~d~~~~~~--~~~~~-----~~-~~~~l~ell~---~sDiIslh~Plt~eT~  219 (333)
T PRK13243        151 KTIGIVGFGRIGQAIARRAKGFGMRILYYSRTRKPE--VEKEL-----GA-EYRPLEDLLR---ESDFVVLAVPLTKETY  219 (333)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHH--HHHHC-----CC-EEECHHHHHH---HCCEEEECCCCCCCCC
T ss_conf             899997925668999999997699999989989866--78760-----96-8811999742---1652664255860134


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             9999-997207899899967986578999999999847994306
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      ..++ +.+..+++|.++|.++-...-|...+.+.|++..+...+
T Consensus       220 ~li~~~~~~~MK~~a~lIN~aRG~iVde~aL~~aL~~g~i~gA~  263 (333)
T PRK13243        220 HMINEERLKLMKKTAILVNIARGKVVDTKALVKALKEGWIAGAG  263 (333)
T ss_pred             CCCCHHHHHHCCCCEEEEECCCCHHCCHHHHHHHHHHCCCEEEE
T ss_conf             61369999717998199985884003999999999809913899


No 89 
>PRK06932 glycerate dehydrogenase; Provisional
Probab=98.33  E-value=1.6e-05  Score=60.21  Aligned_cols=112  Identities=16%  Similarity=0.228  Sum_probs=88.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|+.|+.+|+.+..-|.+|..+++....  ..          ...+.+++|+..   ..++|.+.+|-.+.+.
T Consensus       148 ktvGIiG~G~IG~~va~~~~~fGm~V~~~~~~~~~--~~----------~~~~~~l~ell~---~sDiIslh~Plt~eT~  212 (314)
T PRK06932        148 STLGVFGKGCLGSEVGRLATALGMKVLYAEHKGAT--EC----------REGYTPFEEVLK---QADIVTLHCPLTESTQ  212 (314)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCCH--HH----------CCCCCCHHHHHH---CCCEEEEEECCCCCCC
T ss_conf             68899763528889999985289889997876612--32----------346575999962---3583689511301023


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC
Q ss_conf             9999-9972078998999679865789999999998479943067546
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS  130 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS  130 (475)
                      ..++ +.+..++++.++|.++-...-|...+.+.+++..+...+.=|-
T Consensus       213 ~li~~~~l~~MK~~a~lIN~aRG~iVde~aL~~AL~~g~I~gA~lDV~  260 (314)
T PRK06932        213 NLINAETLALMKPTAFLINTGRGPLVDEQALVDALETGHIAGAALDVL  260 (314)
T ss_pred             CHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCC
T ss_conf             366699973578871999826755449999999998299028997279


No 90 
>PRK08410 2-hydroxyacid dehydrogenase; Provisional
Probab=98.32  E-value=7.8e-06  Score=62.54  Aligned_cols=105  Identities=22%  Similarity=0.304  Sum_probs=84.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|+||+|+.|+.+|+.+..-|.+|.+||+.....          ... ....+++++....   ++|.+.+|-.+.+.
T Consensus       146 ktlGIvG~G~IG~~va~~l~~fGm~V~~~d~~~~~~----------~~~-~~~~~l~ell~~s---Divslh~Plt~~T~  211 (311)
T PRK08410        146 KKWGIIGLGTIGKRVAKIAQAFGAEVVYYSTSGKNK----------NSE-YERLSLEELLKTS---DIISIHAPLNEKTK  211 (311)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCC----------CCC-CEECCHHHHHHHC---CEEEEECCCCCCCC
T ss_conf             889998447489999999997699899989843124----------578-1357899998737---80145335762223


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             9999-99720789989996798657899999999984799
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI  122 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi  122 (475)
                      ..++ +.+..+++|.++|.++-...-|...+.+.++++-+
T Consensus       212 ~li~~~~l~~Mk~~a~lIN~aRG~iVde~aL~~aL~~~~i  251 (311)
T PRK08410        212 NLINYEELKLLKDGAILINVGRGGIVNEKDLAKALDEKDI  251 (311)
T ss_pred             CHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCC
T ss_conf             4012899963045755999257422599999999975995


No 91 
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR003710   ApbA, the ketopantoate reductase enzyme 1.1.1.169 from EC of Salmonella typhimurium is required for the synthesis of thiamine via the alternative pyrimidine biosynthetic pathway . Precursors to the pyrimidine moiety of thiamine are synthesized de novo by the purine biosynthetic pathway or the alternative pyrimidine biosynthetic (APB) pathway. The ApbA protein catalyzes the NADPH-specific reduction of ketopantoic acid to pantoic acid. This activity had previously been associated with the pantothenate biosynthetic gene panE . ApbA and PanE are allelic .; GO: 0008677 2-dehydropantoate 2-reductase activity, 0006206 pyrimidine base metabolic process.
Probab=98.30  E-value=0.0002  Score=52.13  Aligned_cols=176  Identities=16%  Similarity=0.184  Sum_probs=119.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC--CEEEEEECCH--HHHHHHHHHC-----CCC------CCCCEECCCHHHHHHHCCCC
Q ss_conf             0569815711168899999789--8599973998--9999999712-----211------27840328989998605778
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG--FRLAVYNKDF--ELTDVFIKKI-----SGL------SQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G--~~V~vydr~~--~~~~~l~~~~-----~~~------~~~~~~~~s~~e~v~~l~~p   69 (475)
                      +|+|||.|.||+-++..|.++|  ++|+++.|..  +..+.+.++|     ...      ...+..+.+++++.  ..++
T Consensus         1 ~i~i~G~GA~G~l~ga~L~~~g~~~~V~~~~R~~r~~~~~~~~~~GL~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~   78 (332)
T TIGR00745         1 KIAIIGAGAVGSLYGARLARAGANHDVTLLARGKRPKQLEALNQEGLRIVSLDGEGVFELKIPVSAATDPETLP--PQKA   78 (332)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCEEEECCCCCCEEEECCCEEECCCCCCC--CCCC
T ss_conf             96899517889999999873189951899988721688999985883897625677503304412204753357--8775


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH--C----CCCEECCCCCCCC-CCCCCCC-E
Q ss_conf             89999769906999999999720789989996798657899999999984--7----9943067546760-0035684-3
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE--K----GIYFIGIGVSGGV-KGARSGA-S  141 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~--k----gi~fid~pVSGG~-~gA~~G~-s  141 (475)
                      |++|+++.+. ++++.+..+.|.+.++.+|+-.-|. ...-.++.+.+.+  .    |+.+.++.-++.- .--..|. .
T Consensus        79 D~~~~~~K~~-~~~~~~~~~~~~~~~~~~vl~lqNG-~g~~e~l~~~~~~n~~~~l~G~~~~ga~~~~~g~~~~~~g~G~  156 (332)
T TIGR00745        79 DLVIITVKAY-QTEEALALLLPLIGPNTVVLLLQNG-LGHEEKLAELLPENRRRVLGGVTTHGAAREEPGLVVHHAGEGA  156 (332)
T ss_pred             CEEEEEECCC-CHHHHHHHHHHHCCCCCEEEEEECC-CHHHHHHHHHCCCCCCCEEEEEEEEEEEEECCCEEEEEECCCE
T ss_conf             4899970350-0489999998641888279997388-0279999985069977089999988767708840899723633


Q ss_pred             EEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             78845489998889999987501567861898569874678988776
Q gi|254780716|r  142 LMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHN  188 (475)
Q Consensus       142 lMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN  188 (475)
                      +.+|--... +.++.+.+.+..-.   --+.+.++.=...--|.+-|
T Consensus       157 ~~~G~~~~~-~~~~~~a~~l~~ag---~~~~~~~d~~~~~W~Kl~~N  199 (332)
T TIGR00745       157 TKIGDYVGE-EAVEALAELLNEAG---IPAELTEDIQAAIWKKLLVN  199 (332)
T ss_pred             EEECCCCCH-HHHHHHHHHHHHCC---CCEEECCHHHHHHHHHHHHH
T ss_conf             884577764-57899999973179---85378302899998878645


No 92 
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated
Probab=98.27  E-value=9.1e-06  Score=62.05  Aligned_cols=107  Identities=18%  Similarity=0.210  Sum_probs=83.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH-
Q ss_conf             8805698157111688999997898599973998999999971221127840328989998605778899997699069-
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP-   81 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~-   81 (475)
                      ...+|+||+|+.|+.+|+.+..-|++|.+||+..+..+           ....+.+++++...++   +|-+-+|-.+. 
T Consensus       116 gktvGIIG~G~IG~~va~~l~afG~~vl~~DP~~~~~~-----------~~~~~~sleell~~sD---iIslHvPLt~~g  181 (379)
T PRK00257        116 ERTYGIVGVGHVGGRLVRVLRGLGWKVLVCDPPRQEAE-----------GDGDFVSLERILEECD---IISLHTPLTKEG  181 (379)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCHHHHHH-----------CCCCEECHHHHHHHCC---EEEEECCCCCCC
T ss_conf             98799977167999999999977998999784576643-----------3860334999987499---999925777788


Q ss_pred             ---HHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             ---99999-9997207899899967986578999999999847994
Q gi|254780716|r   82 ---VDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        82 ---v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                         +...+ ...+..++++.++|.++-...-|...+.+.+++..+.
T Consensus       182 ~~~T~~Li~~~~L~~mk~~aiLINtsRG~VVDe~ALl~aL~~g~~~  227 (379)
T PRK00257        182 EHPTWHLLDEAFLASLRPGAWLINASRGAVVDNQALREALLSGEDL  227 (379)
T ss_pred             CCCCCCCCCHHHHHHCCCCCEEEECCCCHHCCHHHHHHHHHHCCCC
T ss_conf             7532047199999607998099988973001999999999819963


No 93 
>KOG0069 consensus
Probab=98.25  E-value=2e-05  Score=59.54  Aligned_cols=110  Identities=15%  Similarity=0.212  Sum_probs=88.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.||++|+|+.|+.+|++|..-|-.+.-++|++...+...+.++.       ..+..++....   ++|++++|..+.+.
T Consensus       163 K~vgilG~G~IG~~ia~rL~~Fg~~i~y~~r~~~~~~~~~~~~~~-------~~d~~~~~~~s---D~ivv~~pLt~~T~  232 (336)
T KOG0069         163 KTVGILGLGRIGKAIAKRLKPFGCVILYHSRTQLPPEEAYEYYAE-------FVDIEELLANS---DVIVVNCPLTKETR  232 (336)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCC-------CCCHHHHHHHC---CEEEEECCCCHHHH
T ss_conf             779996274788999996353266255411357763668874354-------36788887328---87999268977888


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             9999-997207899899967986578999999999847994
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      .+++ +++..+++|-++|.++-...-|-....+.+++--+.
T Consensus       233 ~liNk~~~~~mk~g~vlVN~aRG~iide~~l~eaL~sG~i~  273 (336)
T KOG0069         233 HLINKKFIEKMKDGAVLVNTARGAIIDEEALVEALKSGKIA  273 (336)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHCCCCC
T ss_conf             77609999864797699964642402599999787539853


No 94 
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=98.25  E-value=3.9e-05  Score=57.38  Aligned_cols=229  Identities=16%  Similarity=0.131  Sum_probs=143.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCC-CCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             99880569815711168899999789-859997399899999997122112-7840328989998605778899997699
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLS-QKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++  |=+||.|..|+..|.+|+.+| ++|.+=||++++.+++.+...... .-..-+.+.+.+.+.+...++||-++|.
T Consensus         1 m~~--ilviGaG~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~~~~v~~~~vD~~d~~al~~li~~~d~VIn~~p~   78 (389)
T COG1748           1 MMK--ILVIGAGGVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELIGGKVEALQVDAADVDALVALIKDFDLVINAAPP   78 (389)
T ss_pred             CCC--EEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCC
T ss_conf             972--899898666799999998578962999848888999987533466316994256758899987257789992870


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE-ECCCCCCCCCCC-------C---CCCE--EEEE
Q ss_conf             0699999999972078998999679865789999999998479943-067546760003-------5---6843--7884
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF-IGIGVSGGVKGA-------R---SGAS--LMVG  145 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f-id~pVSGG~~gA-------~---~G~s--lMvG  145 (475)
                      .-. ..+++   ..++.|--++|.+...... .++...+++.|+.. ++||+.=|...+       .   .-.+  +.+|
T Consensus        79 ~~~-~~i~k---a~i~~gv~yvDts~~~~~~-~~~~~~a~~Agit~v~~~G~dPGi~nv~a~~a~~~~~~~i~si~iy~g  153 (389)
T COG1748          79 FVD-LTILK---ACIKTGVDYVDTSYYEEPP-WKLDEEAKKAGITAVLGCGFDPGITNVLAAYAAKELFDEIESIDIYVG  153 (389)
T ss_pred             HHH-HHHHH---HHHHHCCCEEECCCCCCHH-HHHHHHHHHCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             542-99999---9998599889754677506-565489887490797166768645799999999986165648999982


Q ss_pred             C--CHH----HHH---HHHHHHHHHHCCCC------------------------CCCEEEEECCCCHHHHHHHHHH----
Q ss_conf             5--489----998---88999998750156------------------------7861898569874678988776----
Q gi|254780716|r  146 G--NEK----AYN---RVENILLSISAKYQ------------------------NSPCCALLGPDGSGHFVKMIHN----  188 (475)
Q Consensus       146 G--~~~----~~~---~~~piL~~iaak~~------------------------~~~cv~y~G~~GsGh~vKMVhN----  188 (475)
                      |  +..    .|.   ..+-.|..+...+.                        +.--+.+..-.|..+++|.++-    
T Consensus       154 ~~g~~~~~~l~ya~tws~e~~l~e~~~p~~~~~~Gk~~~v~~~~~~~~~~~~~~G~~~~y~~~~~el~sL~~~i~~~~~~  233 (389)
T COG1748         154 GLGEHGDNPLGYATTWSPEINLREYTRPARYWENGKWVEVDPLEEREVFEFPVIGYGDVYAFYHDELRSLVKTIPGVVRT  233 (389)
T ss_pred             CCCCCCCCCCCCEEEECHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHCCCCCEE
T ss_conf             58989887765326625788689754755998478799816656323324677873258953782277797757540004


Q ss_pred             HHHHHHH-HHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             7878889-9989999999964289978999999860688443079999999997405
Q gi|254780716|r  189 GIEYANM-QLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD  244 (475)
Q Consensus       189 gIey~~m-q~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~  244 (475)
                      ..+...= |...|.+..|+. +++-..+-.++.       ...--+|.+..+|..+-
T Consensus       234 ~~~~t~r~~g~~~~i~~L~~-lGll~~~~v~~~-------~~i~p~eflk~vl~~~~  282 (389)
T COG1748         234 RFEMTFRYPGHLEVIKALRD-LGLLSREPVKVQ-------QEIVPLEFLKAVLPDPL  282 (389)
T ss_pred             EEEEECCCHHHHHHHHHHHH-CCCCCCCCCCCC-------CCCCHHHHHHHHCCCCC
T ss_conf             67760486409999999987-578865543335-------54464888998634501


No 95 
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=98.24  E-value=1.8e-05  Score=59.97  Aligned_cols=95  Identities=16%  Similarity=0.317  Sum_probs=66.7

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             98805698157111688999997898-59997399899999997122112784032898999860577889999769906
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ...+|-+||.|-||.-.+++|.++|. ++.+.|||.++++++.++...   ..   ...+++-+.+...++|+.+..++.
T Consensus       177 ~~~~vLviGaGem~~l~~~~L~~~g~~~i~v~nRt~~ra~~la~~~g~---~~---~~~~~l~~~l~~~DvvisaT~s~~  250 (311)
T cd05213         177 KGKKVLVIGAGEMGELAAKHLAAKGVAEITIANRTYERAEELAKELGG---NA---VPLDELLELLNEADVVISATGAPH  250 (311)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC---EE---ECHHHHHHHHHHCCEEEEECCCCC
T ss_conf             116799986879999999999965998259976867899999997498---99---729999999976899999279996


Q ss_pred             HHHHHHHHHH-HCCCCCCEEEECC
Q ss_conf             9999999997-2078998999679
Q gi|254780716|r   81 PVDQLIDKLK-PLLSPEDILLDGG  103 (475)
Q Consensus        81 ~v~~vi~~l~-~~l~~g~iiID~s  103 (475)
                      ++... +.+. ..-.+..++||.+
T Consensus       251 ~~~~~-~~~~~~~~~~~~~iiDLa  273 (311)
T cd05213         251 YAKIV-ERAMKKRSGKPRLIVDLA  273 (311)
T ss_pred             CHHHH-HHHHHHCCCCCEEEEEEC
T ss_conf             20359-999753479976999917


No 96 
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=98.21  E-value=2.5e-05  Score=58.84  Aligned_cols=74  Identities=20%  Similarity=0.429  Sum_probs=58.7

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8805698157111688999997898-599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+|-+||.|-||.-.+++|.++|. ++++.|||.++++++.++...   .   +.+.+++.+.+...++||++..++.+
T Consensus       182 ~~~vlviGaGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~~---~---~~~~~~l~~~l~~~DvvisaT~s~~~  255 (429)
T PRK00045        182 GKKVLVIGAGEMGELVAKHLAEKGVRKITVANRTLERAEELAEEFGA---E---AIPLEELPEALAEADIVISSTAAPHP  255 (429)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCC---E---EECHHHHHHHHHHCCEEEEECCCCCC
T ss_conf             06599976748999999999855998499975867789999997598---8---97499999999658999994489975


Q ss_pred             H
Q ss_conf             9
Q gi|254780716|r   82 V   82 (475)
Q Consensus        82 v   82 (475)
                      +
T Consensus       256 i  256 (429)
T PRK00045        256 I  256 (429)
T ss_pred             C
T ss_conf             0


No 97 
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]
Probab=98.19  E-value=0.00016  Score=52.95  Aligned_cols=114  Identities=17%  Similarity=0.207  Sum_probs=85.2

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCC---CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             998805698157-11168899999789---85999739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKG---FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G---~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |++..||+||+| .++...+..+...+   .-|.++|+++++.+++.++....    ..+.+++++.+. +.++.|+++.
T Consensus         1 ~~~irvgiiG~G~~~~~~~~~~~~~~~~~~~~vav~d~~~~~a~~~a~~~~~~----~~~~~~~~ll~~-~~iD~V~Iat   75 (342)
T COG0673           1 MKMIRVGIIGAGGIAGKAHLPALAALGGGLELVAVVDRDPERAEAFAEEFGIA----KAYTDLEELLAD-PDIDAVYIAT   75 (342)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHCCCC----CCCCCHHHHHCC-CCCCEEEEEC
T ss_conf             99327999898767888889999738874699999649989999999981997----452999999459-9998899969


Q ss_pred             CCHHHHHHHHHHHHHCCCCC-CEEEEC-CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99069999999997207899-899967-986578999999999847994
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPE-DILLDG-GNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g-~iiID~-sts~~~~t~~~~~~l~~kgi~  123 (475)
                      |+..+.+-++..|.    .| .++++= =+.+..+..++.+.++++|+.
T Consensus        76 p~~~H~~~a~~AL~----aGkhVl~EKPla~t~~ea~~l~~~a~~~g~~  120 (342)
T COG0673          76 PNALHAELALAALE----AGKHVLCEKPLALTLEEAEELVELARKAGVK  120 (342)
T ss_pred             CCHHHHHHHHHHHH----CCCEEEEECCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             80677999999997----7996999289989999999999999975994


No 98 
>PRK06487 glycerate dehydrogenase; Provisional
Probab=98.17  E-value=2.3e-05  Score=59.16  Aligned_cols=105  Identities=14%  Similarity=0.201  Sum_probs=85.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+||+||+|..|+.+|+.+..-|.+|.+|++......         .    ...+++|+...   .++|.+.+|-.+.+.
T Consensus       149 ktvGIiG~G~IG~~va~~~~~fg~~V~~~~~~~~~~~---------~----~~~~l~ell~~---sDivslh~Plt~~T~  212 (317)
T PRK06487        149 KTLGLLGHGELGGAVARLAEAFGMRVLIGQLPGRPAR---------P----DRLPLDELLPQ---VDALTLHCPLTEHTR  212 (317)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCC---------C----CCCCHHHHHHH---CCEEEEECCCCCCCH
T ss_conf             7899978676899999999748999999928888642---------4----50579999873---885687335761121


Q ss_pred             HHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             9999-9972078998999679865789999999998479943
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      ..++ +.+..++++.++|.++-...-|...+.+.+++..+..
T Consensus       213 ~li~~~~l~~Mk~~a~lIN~aRG~lVde~aL~~AL~~g~i~g  254 (317)
T PRK06487        213 HLIGARELALMKPGALLINTARGGLVDEQALADALRSGHLGG  254 (317)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEE
T ss_conf             157999998538997899706865469999999998499418


No 99 
>pfam02558 ApbA Ketopantoate reductase PanE/ApbA. This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) <= 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway.
Probab=98.08  E-value=2.9e-05  Score=58.36  Aligned_cols=99  Identities=17%  Similarity=0.262  Sum_probs=72.1

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCC---CCEE-CCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             5698157111688999997898599973998999999971221127---8403-28989998605778899997699069
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQ---KVIV-TKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~---~~~~-~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      |.++|.|.||.-+|..|.++|++|..+.|.+ ..+.+.+.+-....   .... .....+.......++.||+++++. +
T Consensus         1 I~IiGaGaiG~~~a~~L~~ag~~V~lv~R~~-~~~~i~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~D~viv~vKa~-~   78 (150)
T pfam02558         1 IAILGAGAVGSLYGARLARAGHDVTLIARGR-HLEAIRENGLRITSPGGERTVPPPVATSASEELGPADLVIVAVKAY-Q   78 (150)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHCCEEEEECCCCEEEECCEECCCHHHCCCCCEEEEEECCC-C
T ss_conf             9999668999999999997799289997563-6788774976999479838980741038657658867999972245-8


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             9999999972078998999679865
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                      +++.++.+.+.+.++..|+-+-|--
T Consensus        79 ~~~al~~l~~~l~~~t~iv~lqNG~  103 (150)
T pfam02558        79 TAEALEDLAPLLGPNTVVLLLQNGL  103 (150)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             8999999886528883899942587


No 100
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine.
Probab=98.02  E-value=9.8e-05  Score=54.45  Aligned_cols=90  Identities=21%  Similarity=0.255  Sum_probs=66.1

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             98805698157111688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +..+|++||-|.-|.+-|+||.+.|.+|.+-.|.-++.-+..++     +.+. ..+++|.+...   ++|++.+|+. .
T Consensus         3 k~k~iaViGYGsQG~AhAlNLrDSG~~V~vglr~~s~S~~kA~~-----dGf~-v~~~~eA~~~a---Diim~L~PD~-~   72 (165)
T pfam07991         3 KGKKIAVIGYGSQGHAHALNLRDSGVNVIVGLRPGSKSWEKAKK-----DGFE-VYTVAEAVKKA---DVVMILLPDE-V   72 (165)
T ss_pred             CCCEEEEEEECCHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHH-----CCCC-CCCHHHHHHHC---CEEEEECCCH-H
T ss_conf             79989999346164888723053499789997899867999997-----8970-04899998657---8999837977-7


Q ss_pred             HHHHH-HHHHHCCCCCCEEEE
Q ss_conf             99999-999720789989996
Q gi|254780716|r   82 VDQLI-DKLKPLLSPEDILLD  101 (475)
Q Consensus        82 v~~vi-~~l~~~l~~g~iiID  101 (475)
                      -.+++ +.+.|.|++|+++.=
T Consensus        73 q~~iy~~~I~p~lk~G~~L~F   93 (165)
T pfam07991        73 QAEVYEKEIAPNLKEGAALAF   93 (165)
T ss_pred             HHHHHHHHHHHHCCCCCEEEE
T ss_conf             899999989865789977997


No 101
>PRK05479 ketol-acid reductoisomerase; Provisional
Probab=98.00  E-value=8.5e-05  Score=54.91  Aligned_cols=181  Identities=17%  Similarity=0.190  Sum_probs=102.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             88056981571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ..+|++||-|+-|.+-|+||.+.|.+|.|--|.-++.-+..++     +++ -..+++|.+...   ++|++.+|+. .-
T Consensus        17 ~k~iaViGYGsQG~AhAlNLrDSG~~V~vglr~gs~S~~kA~~-----dGf-~v~~~~eA~~~a---Dii~~L~PD~-~q   86 (336)
T PRK05479         17 GKKVAIIGYGSQGHAHALNLRDSGVDVVVGLREGSKSWKKAEA-----DGF-EVLTVAEAAKWA---DVIMILLPDE-LQ   86 (336)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHH-----CCC-EECCHHHHHHHC---CEEEEECCHH-HH
T ss_conf             9979997527076898855374499779997999803999998-----799-436799999746---8665428757-78


Q ss_pred             HHHH-HHHHHCCCCCCEEEEC--CCCCHHHHHHHHHHHHHCCCC-EECCCCCCCCC-C----CCCC-CEEE-EE--CCHH
Q ss_conf             9999-9997207899899967--986578999999999847994-30675467600-0----3568-4378-84--5489
Q gi|254780716|r   83 DQLI-DKLKPLLSPEDILLDG--GNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGVK-G----ARSG-ASLM-VG--GNEK  149 (475)
Q Consensus        83 ~~vi-~~l~~~l~~g~iiID~--sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~~-g----A~~G-~slM-vG--G~~~  149 (475)
                      .+|+ +.+.|+|++|+++.=.  =|.+|..      .--.+++. ++=||=+-|.. .    .-.| ||+. |-  -+-.
T Consensus        87 ~~vy~~~I~p~lk~G~~L~FaHGFnIhy~~------I~pp~~vDVimVAPKgpG~~VR~~y~~G~GvP~liAV~qD~sG~  160 (336)
T PRK05479         87 AEVYKEEIEPNLKEGAALAFAHGFNIHFGQ------IVPPADVDVIMVAPKGPGHLVRREYVEGGGVPCLIAVHQDASGN  160 (336)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCHHCCCE------EEECCCCCEEEECCCCCCHHHHHHHHCCCCEEEEEEEEECCCHH
T ss_conf             999999998545899768861443000560------44458976799888999768999986389804899998688735


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEE-----------EECCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             99888999998750156786189-----------856987467898877678-788899989999999964289978
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSPCCA-----------LLGPDGSGHFVKMIHNGI-EYANMQLIADIYGILRDSLNKNPL  214 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~cv~-----------y~G~~GsGh~vKMVhNgI-ey~~mq~iaE~~~~l~~~~~~~~~  214 (475)
                      +++.+...-.+++..-   ..|.           .+|+           -.+ +.|...+|--+|+.|..+ ++.++
T Consensus       161 A~~~alaya~~iG~~r---aGvieTTF~eEtetDLfGE-----------Q~VLcGG~~~Li~agFetLvea-Gy~PE  222 (336)
T PRK05479        161 AKDLALAYAKGIGGTR---AGVIETTFKEETETDLFGE-----------QAVLCGGLTELIKAGFETLVEA-GYQPE  222 (336)
T ss_pred             HHHHHHHHHHHCCCCC---CCEEECCHHHHHHHHHHHH-----------HHHHHCHHHHHHHHHHHHHHHC-CCCHH
T ss_conf             9999999998738776---6557425599988762445-----------7886243999999999999984-99889


No 102
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=98.00  E-value=0.00018  Score=52.49  Aligned_cols=123  Identities=15%  Similarity=0.192  Sum_probs=82.9

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCC--CCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             5698157111688999997898--59997399899999997122112--7840328989998605778899997699069
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKISGLS--QKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~~~~--~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      |-+||.|.||+.++..|++++.  +|++-||+.++++.+.+......  ....-..+.+++...++..++|+.|+|.-. 
T Consensus         1 IlvlGaG~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~diVv~~~p~~~-   79 (384)
T pfam03435         1 VLIIGAGGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAPKLGLRFIAIAVDADNYEALAALLKEGDLVINLAPPFL-   79 (384)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCEEEECCCHHH-
T ss_conf             9898977879999999972899886999989889989877523698538999577899999998712899999984341-


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-EECCCCCCCC
Q ss_conf             999999997207899899967986578999999999847994-3067546760
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGV  133 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~  133 (475)
                      -..+++   ..++.|.-+||.+ ...++..++.++++++|+. .++||.+=|.
T Consensus        80 ~~~i~~---~c~~~g~~yvd~s-~~~~~~~~l~~~a~~ag~~~~~~~G~~PGi  128 (384)
T pfam03435        80 SLTVLK---ACIETGVHYVDTS-YLREAQLALHEKAKEAGVTAVLGCGFDPGL  128 (384)
T ss_pred             CHHHHH---HHHHCCCCEEECC-CCHHHHHHHHHHHHHCCCEEEECCCCCCCH
T ss_conf             699999---9997399757534-366889999997765696899678889884


No 103
>PRK13304 L-aspartate dehydrogenase; Reviewed
Probab=97.97  E-value=0.00019  Score=52.28  Aligned_cols=172  Identities=17%  Similarity=0.263  Sum_probs=103.1

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--CCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             9988056981571116889999978--985-9997399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--GFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |.+  ||+||.|.||+.+|..|.+.  +++ +.+|||++++.+++....     ....+.+++++.+   .|++|+=|-+
T Consensus         1 M~r--VgiIG~GaIG~~Va~~l~~g~~~~~L~~V~~r~~~~a~~~a~~~-----~~~~~~~ld~l~~---~~DlVVE~A~   70 (265)
T PRK13304          1 MLK--IGIVGCGAIANLITKAIDSGRINAELLAFYDRNLEKAENLAEKT-----GAPACLSIDELVK---DVDLVVECAS   70 (265)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCC-----CCCCCCCHHHHHH---CCCEEEECCC
T ss_conf             949--99986578999999998679986499999789878988776415-----9971279899833---8999998989


Q ss_pred             CHHHHHHHHHHHHHCCCCC-CEEEECCCCCHHH---HHHHHHHHHHCCCC-EECCCCCCCCC---CCCCC-C-EE-EEEC
Q ss_conf             9069999999997207899-8999679865789---99999999847994-30675467600---03568-4-37-8845
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPE-DILLDGGNSHFCD---TQIRSLQLSEKGIY-FIGIGVSGGVK---GARSG-A-SL-MVGG  146 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g-~iiID~sts~~~~---t~~~~~~l~~kgi~-fid~pVSGG~~---gA~~G-~-sl-MvGG  146 (475)
                      . +++.+....++   +.| |+++ +|..-..|   -.++.+.+++.|-+ |+-.|=-||-.   .|..| . .+ |.+=
T Consensus        71 ~-~av~~~~~~~L---~~G~dlvv-~SvGALaD~~l~~~L~~~A~~~g~~i~ipsGAigGlD~l~aa~~~~l~~V~~~tr  145 (265)
T PRK13304         71 Q-KAVEDTVPKSL---NNGKDVII-MSVGALADKELFLKLYKLAKENGCKIYLPSGAIAGIDGIKAASLGEIESVTLTTR  145 (265)
T ss_pred             H-HHHHHHHHHHH---HCCCCEEE-ECHHHHCCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             8-99999999999---75998999-8136855989999999999737977998261344278899986589757999987


Q ss_pred             -CHHHHHHHHHHHHHHHCCCCCCCEEEEECCC--CHHHHHHHHHH
Q ss_conf             -4899988899999875015678618985698--74678988776
Q gi|254780716|r  147 -NEKAYNRVENILLSISAKYQNSPCCALLGPD--GSGHFVKMIHN  188 (475)
Q Consensus       147 -~~~~~~~~~piL~~iaak~~~~~cv~y~G~~--GsGh~vKMVhN  188 (475)
                       ++..|... |..+.+--....+|-+.|-|+.  .+-.|=|=||=
T Consensus       146 K~P~~l~~~-~~~~~~~l~~~~e~~~~F~G~Area~~~fP~NvNV  189 (265)
T PRK13304        146 KPPHGLEGA-LEELGINLEDIKEPKVLFEGTASEAVKKFPQNINV  189 (265)
T ss_pred             ECHHHHCCC-HHHHCCCCCCCCCCEEEEECCHHHHHHHCCCHHHH
T ss_conf             486896778-66604673014677799825899999876752789


No 104
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=97.93  E-value=0.00018  Score=52.47  Aligned_cols=72  Identities=21%  Similarity=0.416  Sum_probs=55.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             880569815711168899999789-859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..++-|||.|-||.-.|++|..+| ..|++.|||.++++++.++..      .-+..++|+.+.+...++||.+-.++.
T Consensus       178 ~~~vlvIGAGem~~lva~~L~~~g~~~i~IaNRT~erA~~La~~~~------~~~~~l~el~~~l~~~DvVissTsa~~  250 (414)
T COG0373         178 DKKVLVIGAGEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLG------AEAVALEELLEALAEADVVISSTSAPH  250 (414)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHC------CEEECHHHHHHHHHHCCEEEEECCCCC
T ss_conf             6769998651899999999985898779997587899999999838------702218778876520799999069985


No 105
>PRK08818 prephenate dehydrogenase; Provisional
Probab=97.92  E-value=0.00063  Score=48.50  Aligned_cols=144  Identities=13%  Similarity=0.210  Sum_probs=98.4

Q ss_pred             CCEEEEEECC-HHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             8805698157-1116889999978-9859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    3 QADIGIIGLG-SMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         3 k~~IGiIGLG-~MG~~mA~nL~~~-G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      .+-|||||.+ --|+=+|+-|.++ +++|.+||....+                 ..+++++   +.+.++|++.||- .
T Consensus         4 ~piV~iiG~~~~~G~w~a~flr~~~~~~vig~dp~~~~-----------------s~D~~~l---~~~aDIVIisVPI-~   62 (373)
T PRK08818          4 QPVVGIVGIAGAYGRWLAQFLRTRMQLEVIGYDPADPG-----------------SLDPATL---LARADVLVFSAPI-R   62 (373)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCC-----------------CCCHHHH---HHCCCEEEEECCH-H
T ss_conf             86389962663265899999874366178854887756-----------------6698898---6238989997780-3


Q ss_pred             HHHHHHHH---HHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCC-CCCCCCC-EEEE-ECCHHHHHH
Q ss_conf             99999999---972078998999679865789999999998479943067-546760-0035684-3788-454899988
Q gi|254780716|r   81 PVDQLIDK---LKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGV-KGARSGA-SLMV-GGNEKAYNR  153 (475)
Q Consensus        81 ~v~~vi~~---l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~-~gA~~G~-slMv-GG~~~~~~~  153 (475)
                      ++.+|+.+   +.|.++.|.++.|.+..--.-+    +...+...+++.. |+-|.| ....+|. .+++ +.+.....-
T Consensus        63 ~T~~vI~E~~~~Ap~~~~gsLLmDVTSIKe~Pv----~AM~~s~~eVv~~HPMfGpP~sPsL~gqVVIltp~~~~~~~~~  138 (373)
T PRK08818         63 HTAALIERYVALAGARAAGQLWLDVTSIKQAPV----AAMLASQAEVVGLHPMTAPPKSPTLKGRVMVVCEARLQHWSPW  138 (373)
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEEHHHHHHHH----HHHHHCCCCEECCCCCCCCCCCCCCCCEEEEEECCCCCCCHHH
T ss_conf             238899887741655678856885033406889----9986444422237887789998640441899705765523599


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECCC
Q ss_conf             899999875015678618985698
Q gi|254780716|r  154 VENILLSISAKYQNSPCCALLGPD  177 (475)
Q Consensus       154 ~~piL~~iaak~~~~~cv~y~G~~  177 (475)
                      ++.+++...++      |.++-|.
T Consensus       139 v~kl~e~lgAe------v~~~sPe  156 (373)
T PRK08818        139 VDSLCSALQAE------CVYATPE  156 (373)
T ss_pred             HHHHHHHCCCE------EEEECHH
T ss_conf             99999753877------9996888


No 106
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=97.92  E-value=0.00032  Score=50.63  Aligned_cols=246  Identities=19%  Similarity=0.159  Sum_probs=124.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH--
Q ss_conf             805698157111688999997898599973998999999971221127840328989998605778899997699069--
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP--   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~--   81 (475)
                      .+|+|||=-.--.-|++.|.++|++|..|......         .....+..+.++++....   .++|++=||-.+.  
T Consensus         3 ~~iaviGGD~Rq~~l~~~L~~~g~~V~~~gf~~~~---------~~~~~~~~~~~~~~~~~~---~d~iIlPvpg~~d~g   70 (296)
T PRK08306          3 MHIAVIGGDARQLELIRKLVELGAKVSLVGFDQLD---------HGFTGVAKCSSLEEALSD---VDVIILPVPGTNDEG   70 (296)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCEEEECCHHHHHHC---CCEEEECCCCCCCCC
T ss_conf             48999787589999999999779979998357655---------566761773467888723---999997883225896


Q ss_pred             -HHH-------HH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC------------CCCCC-CCC----
Q ss_conf             -999-------99-99972078998999679865789999999998479943067------------54676-000----
Q gi|254780716|r   82 -VDQ-------LI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI------------GVSGG-VKG----  135 (475)
Q Consensus        82 -v~~-------vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~------------pVSGG-~~g----  135 (475)
                       +..       ++ +.++..+.++.++.-+- +++    ...+.++++|+.++|-            |.--| ..-    
T Consensus        71 ~i~~~~~~~~~~l~~~~~~~l~~~~~vf~G~-~~~----~l~~~~~~~~~~~~d~~e~d~vAi~NaipTAEGai~~ai~~  145 (296)
T PRK08306         71 EVDTVFSNEKLVLTKELLEKTPEHCTIFSGI-ANP----YLKELAETTGRKLIELFERDDVAIYNSIPTAEGAIMMAIEH  145 (296)
T ss_pred             EEECCCCCCCCCHHHHHHHHCCCCCEEEEEC-CCH----HHHHHHHHCCCCEEEEECCCHHHHHCCCCCHHHHHHHHHHC
T ss_conf             3855346787632299997469998799955-998----99999997598367620020355562701489999999965


Q ss_pred             ---CCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ---35684378845489998889999987501567861898569874678988776787888999899999999642899
Q gi|254780716|r  136 ---ARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKN  212 (475)
Q Consensus       136 ---A~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~  212 (475)
                         ...|...+|=|=-..=..+-..|..+.+++       +++.--+.|.                ++++.+--+  -..
T Consensus       146 tp~ti~gs~~lVlG~Gr~G~~lA~~l~~lGA~V-------~V~aR~~~~~----------------a~a~~~G~~--~v~  200 (296)
T PRK08306        146 TPITIHGSNVLVLGFGRTGMTLARTLKALGAKV-------KVGARKSAHL----------------ARITEMGYS--PVH  200 (296)
T ss_pred             CCCCCCCCCEEEECCCHHHHHHHHHHHHCCCEE-------EEEECCHHHH----------------HHHHHCCCE--EEE
T ss_conf             996324765899898689999999999779969-------9997999999----------------999976985--871


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCC-CCHHHHHHHH-------HHHH-CCCCCHHH
Q ss_conf             7899999986068844307999999999740567999520010233365-8716778988-------7751-78885146
Q gi|254780716|r  213 PLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKASQ-KGTGIRSIIE-------GHKL-SSSMTITE  283 (475)
Q Consensus       213 ~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g~~lid~i~d~~~~-kgTg~Wt~~~-------a~~l-gvp~p~i~  283 (475)
                      .+++.....++.==..-=+=+=+|+++|.+...  +.    .|.|.|.. -||---.++.       |.-| |.-+|.-+
T Consensus       201 ~~~L~~~~~~~D~i~NTIPa~Vlt~~~l~~~~~--~a----vIIDLAS~PGG~Df~~A~~~Gika~lapgLPGk~APkTa  274 (296)
T PRK08306        201 LSELAEEVGEADIIFNTIPALVLTKNVLSKMPP--HA----LIIDLASKPGGTDFEYAKKLGIKALLAPGLPGKVAPKTA  274 (296)
T ss_pred             HHHHHHHHCCCCEEEECCCHHHCCHHHHHCCCC--CC----EEEEECCCCCCCCHHHHHHHCCEEEECCCCCCCCCHHHH
T ss_conf             999997735699999898525439999941899--96----999947799973889999839859972899973171539


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             77788877500577
Q gi|254780716|r  284 TAIFARNLSLYRDE  297 (475)
Q Consensus       284 ~av~aR~~S~~k~~  297 (475)
                      .-..++.+++.-.+
T Consensus       275 g~Ila~~i~~ll~e  288 (296)
T PRK08306        275 GQILANVLSNLLAE  288 (296)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 107
>TIGR01915 npdG NADPH-dependent F420 reductase; InterPro: IPR010185   Members of this family are found only in species with evidence of coenzyme F420. All members of this family are believed to act as NADPH-dependent F420 reductase..
Probab=97.91  E-value=9.5e-05  Score=54.56  Aligned_cols=169  Identities=20%  Similarity=0.248  Sum_probs=115.5

Q ss_pred             EEEEE-ECCHHHHHHHHHHHHCC-------CEEEEEECCHHHHHHHHHHCCC----C----CCCCEECCCHHHHHHHCCC
Q ss_conf             05698-15711168899999789-------8599973998999999971221----1----2784032898999860577
Q gi|254780716|r    5 DIGII-GLGSMGSNLSLNILDKG-------FRLAVYNKDFELTDVFIKKISG----L----SQKVIVTKNLEQMVEAVCK   68 (475)
Q Consensus         5 ~IGiI-GLG~MG~~mA~nL~~~G-------~~V~vydr~~~~~~~l~~~~~~----~----~~~~~~~~s~~e~v~~l~~   68 (475)
                      .|+++ |.|..|.+||+||+.+|       .+|.+-.|++||+++-.++...    .    .-+++++++.+-    .+.
T Consensus         2 kIAvLGGTGdqG~GLALRlA~~glmPeG~~~~iIIGSR~~EkA~EaA~ka~e~l~~~G~d~~i~~~G~~N~~A----A~~   77 (233)
T TIGR01915         2 KIAVLGGTGDQGKGLALRLAKAGLMPEGVDNEIIIGSRDKEKAEEAAAKALEELGDQGVDRDIKVEGAENEEA----AKR   77 (233)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCHHH----HHH
T ss_conf             6788448884025699999870778787775557704884569999999999997089513625754887788----723


Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHH----------------HHHHHHHHHHHCCCCEECC--CCC
Q ss_conf             8899997699069999999997207899899967986578----------------9999999998479943067--546
Q gi|254780716|r   69 PRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFC----------------DTQIRSLQLSEKGIYFIGI--GVS  130 (475)
Q Consensus        69 pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~----------------~t~~~~~~l~~kgi~fid~--pVS  130 (475)
                      .++|++.||. +++-.++..|..-|+.++||||++.---.                -+.+.++.+.++|.+-+.|  -+|
T Consensus        78 aDVVil~vP~-~~~~~~l~~~~~~L~~dK~Vis~~VPl~~~Ig~~~~~y~~P~eGSaA~~~a~~lpeqg~~VvaAFhN~~  156 (233)
T TIGR01915        78 ADVVILAVPF-DHVLKTLESIKDELEADKIVISPVVPLASAIGGKGLRYLPPEEGSAAELVAKLLPEQGSKVVAAFHNIS  156 (233)
T ss_pred             CCEEEEEECC-HHHHHHHHHHHHHHCCCCEEEECCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCEEHHHHCCCC
T ss_conf             8978998422-224789999999851892899647875000024430026873102899999853326750102121324


Q ss_pred             CCC-----CCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHH
Q ss_conf             760-----00356843788454899988899999875015678618985698746789
Q gi|254780716|r  131 GGV-----KGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV  183 (475)
Q Consensus       131 GG~-----~gA~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~v  183 (475)
                      -..     .--..-.+|-+|=++++-+.+..+=+.|..=    . -.-+|+-=..|-|
T Consensus       157 A~~L~D~~~~~~D~D~LV~g~de~A~~~V~eLA~~I~G~----R-a~d~G~LenA~~~  209 (233)
T TIGR01915       157 AAKLKDVVDEEVDCDVLVCGDDEEAKKVVAELAEKIDGL----R-AIDAGPLENARIV  209 (233)
T ss_pred             HHHCCCCCCCCCCCCEEEECCCHHHHHHHHHHHCCCCCC----C-CCCCCCCHHHHHH
T ss_conf             454044003743345366268777899999984038943----2-4126771457888


No 108
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=97.91  E-value=0.00041  Score=49.84  Aligned_cols=174  Identities=13%  Similarity=0.149  Sum_probs=100.7

Q ss_pred             CCEEEEEECCHHHHHHHHHHHH--CCCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             8805698157111688999997--8985-999739989999999712211278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILD--KGFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~--~G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |.+||+||.|.+|+.++..|.+  .+++ +.+|+|++++.+++.+....    .....+++++.   +.|++|+=|-.. 
T Consensus         6 kmrVgliG~GaIG~~va~~l~~g~~~~~l~~V~~r~~~~~~~~~~~~~~----~~~~~~~~~l~---~~~DlVVE~A~~-   77 (271)
T PRK13302          6 ELRVAIAGLGAIGKAIAQALDRGLPGLTLSAVAVRDPQRHADFIWGLRR----PPPVVPLDQLA---THADIVVEAAPA-   77 (271)
T ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCC----CCCCCCHHHHH---HCCCEEEECCCH-
T ss_conf             6779998867899999999975899818999992887888999873589----87407889960---189999989898-


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-EECCCCCCCCC----CCCCCC-EE-EEEC-CHHHH
Q ss_conf             69999999997207899899967986578999999999847994-30675467600----035684-37-8845-48999
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGVK----GARSGA-SL-MVGG-NEKAY  151 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~~----gA~~G~-sl-MvGG-~~~~~  151 (475)
                      +++.+....++   +.|.-++-+|..-..|..++.+.+++.|-+ |+-.|=-||-.    .+..+. .+ |.+= ++..|
T Consensus        78 ~av~~~~~~~L---~~G~dlvv~SvGALad~~~l~~~A~~~g~~i~ipsGAigGlD~l~aa~~~~l~~V~~~t~K~P~~l  154 (271)
T PRK13302         78 SVLRAIVEPVL---AAGKKAIVLSVGALLRNEDLIDLARQNGGQIIVPTGALLGLDAVTAAAEGTIHSVKMITRKPPDGL  154 (271)
T ss_pred             HHHHHHHHHHH---HCCCCEEEECHHHHCCCHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHCCCCCEEEEEEECCCHHH
T ss_conf             99999999999---759978997557956929999999966985998070343478999986289847999963295475


Q ss_pred             HHHHHHHHHHHCC--CCCCCEEEEECCC--CHHHHHHHHHH
Q ss_conf             8889999987501--5678618985698--74678988776
Q gi|254780716|r  152 NRVENILLSISAK--YQNSPCCALLGPD--GSGHFVKMIHN  188 (475)
Q Consensus       152 ~~~~piL~~iaak--~~~~~cv~y~G~~--GsGh~vKMVhN  188 (475)
                      .. .|.+..-...  ...+|-+.|-|+.  ..-.|=|=||=
T Consensus       155 ~g-~p~~~e~~~~l~~~~e~~~lF~G~Area~~~fP~NvNV  194 (271)
T PRK13302        155 KG-APFLVTNNIDIDGLTEPLLLFEGSAREAAKGFPANLNV  194 (271)
T ss_pred             CC-CHHHHHHCCCHHCCCCCEEEEECCHHHHHHHCCCHHHH
T ss_conf             57-80355525770006776699606899999877650769


No 109
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=97.90  E-value=0.00014  Score=53.31  Aligned_cols=187  Identities=18%  Similarity=0.190  Sum_probs=103.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+|++||-|+-|.+-|+||.+.|.+|.+--|.-+..+...+      +++ -..+++|.+...   ++|++.+|+. .-.
T Consensus        17 k~iaVIGYGsQG~AhAlNLrDSG~~V~vglr~g~s~~~A~~------~Gf-~v~~~~eA~~~a---Dvi~~L~pD~-~q~   85 (335)
T PRK13403         17 KTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKA------DGF-EVMSVSEAVRTA---QVVQMLLPDE-QQA   85 (335)
T ss_pred             CEEEEEEECCHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH------CCC-EECCHHHHHHHC---CEEEEECCHH-HHH
T ss_conf             97999756707689885647639977999799856999998------799-316799999857---9787508858-799


Q ss_pred             HHHH-HHHHCCCCCCEEEEC--CCCCHHHHHHHHHHHHHCCCC-EECCCCCCCCCC-----CCCC-CEEE-E--ECCHHH
Q ss_conf             9999-997207899899967--986578999999999847994-306754676000-----3568-4378-8--454899
Q gi|254780716|r   84 QLID-KLKPLLSPEDILLDG--GNSHFCDTQIRSLQLSEKGIY-FIGIGVSGGVKG-----ARSG-ASLM-V--GGNEKA  150 (475)
Q Consensus        84 ~vi~-~l~~~l~~g~iiID~--sts~~~~t~~~~~~l~~kgi~-fid~pVSGG~~g-----A~~G-~slM-v--GG~~~~  150 (475)
                      ++++ .+.|.|++|+++.=.  =|.+|.      ...-.+++. ++-||=.-|..-     .-.| ||+. |  -.+-.+
T Consensus        86 ~vy~~~i~p~lk~G~~L~FaHGfnI~~~------~I~pp~~vdV~mvAPKgpG~~VR~~y~~G~Gvp~l~AV~qD~sg~a  159 (335)
T PRK13403         86 HVYKAEVEENLREGQMLLFSHGFNIHFG------QINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTA  159 (335)
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCHHHCC------EECCCCCCCEEEECCCCCCHHHHHHHHCCCCCCEEEEEEECCCCHH
T ss_conf             9997442553689972376144311224------2457899867998999996579999871799745999976897539


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEE-----------EECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             9888999998750156786189-----------85698746789887767878889998999999996428997899999
Q gi|254780716|r  151 YNRVENILLSISAKYQNSPCCA-----------LLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHL  219 (475)
Q Consensus       151 ~~~~~piL~~iaak~~~~~cv~-----------y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~v  219 (475)
                      .+.+...-.+++..-   ..+.           .+|+-          --.+.|...+|--+|+.|..+ ++.+ |++ -
T Consensus       160 ~~~alaya~aiG~~r---aGv~eTtF~eEtetDLfGEQ----------~VLcGg~~~li~agFetLvea-Gy~P-e~A-Y  223 (335)
T PRK13403        160 LHVALAYAKGVGCTR---AGVIETTFQEETETDLFGEQ----------AVLCGGVTALVKAGFETLTEG-GYRP-EIA-Y  223 (335)
T ss_pred             HHHHHHHHHHCCCCC---CCEEECCHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHC-CCCH-HHH-H
T ss_conf             999999998617776---77562251888876512224----------654028999999999999986-9987-999-9


Q ss_pred             HHHC
Q ss_conf             9860
Q gi|254780716|r  220 FSKW  223 (475)
Q Consensus       220 f~~w  223 (475)
                      |+-.
T Consensus       224 fE~l  227 (335)
T PRK13403        224 FECL  227 (335)
T ss_pred             HHHH
T ss_conf             9999


No 110
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=97.82  E-value=0.0023  Score=44.40  Aligned_cols=184  Identities=11%  Similarity=0.116  Sum_probs=109.4

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHH------------------HHCCCCC-------CCCEECCCHHHHHHHCCC
Q ss_conf             116889999978985999739989999999------------------7122112-------784032898999860577
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFELTDVFI------------------KKISGLS-------QKVIVTKNLEQMVEAVCK   68 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~~~~~l~------------------~~~~~~~-------~~~~~~~s~~e~v~~l~~   68 (475)
                      ||+.+|..++.+|++|.+||.+++..+...                  +.+.-..       .++... +..+..+.+..
T Consensus         1 MG~gIA~~~A~~G~~V~l~Di~~~~~e~~~~~~~~~~~~i~~~l~~~~~~g~l~~~~~~~~l~ri~~~-~~~~~~~al~d   79 (311)
T PRK08269          1 MGQGIALAFAFAGLDVTLIDFKPRDAAGFEAFDARARAEIGRPLAALVALGRIDAAQADAVLARIAVV-ARDGAADALAD   79 (311)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCC-CCCCCHHHHCC
T ss_conf             93799999981798089997980355668999999999999999999975999989999999613346-87650878478


Q ss_pred             CCEEEEECCCHHHHHH-HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH----CCCCEECCCC-CCCCCCCCCCCEE
Q ss_conf             8899997699069999-99999720789989996798657899999999984----7994306754-6760003568437
Q gi|254780716|r   69 PRKILMMVTDGDPVDQ-LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE----KGIYFIGIGV-SGGVKGARSGASL  142 (475)
Q Consensus        69 pr~Iil~vp~g~~v~~-vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~----kgi~fid~pV-SGG~~gA~~G~sl  142 (475)
                      ++.|+=.||-.-.+.. ++.+|-..+.++.|+. ..||...-+ ++++.+..    .|.||.-.|- .--++       +
T Consensus        80 aDlVIEAV~E~l~iK~~vf~~l~~~~~~~~Ila-SNTSsl~is-~la~~~~~p~R~ig~HFfnP~~~m~lVE-------V  150 (311)
T PRK08269         80 ADLVFEAVPEVLDAKRDALRWLGRHVDADATIA-STTSTFLVT-DLQRHVAHPARFLNAHWLNPAYLMPLVE-------V  150 (311)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE-EECCCCCHH-HHHHHCCCCCEEEEECCCCCCCCCCCCC-------C
T ss_conf             999998870588999999999997679874798-306627899-9997469813089962477646685011-------0


Q ss_pred             EEEC--CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             8845--48999888999998750156786189856987467898877678788899989999999964289978999999
Q gi|254780716|r  143 MVGG--NEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLF  220 (475)
Q Consensus       143 MvGG--~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf  220 (475)
                      +.|-  ++++.+.+..+++.+...      ...+.+. -|..    -|-|.+   -.+.|++.++..+ --+.++|-.++
T Consensus       151 v~g~~Ts~e~~~~~~~~~~~~GK~------pVv~kd~-pGFi----~NRi~~---~~~~EA~~lv~eG-vas~edID~a~  215 (311)
T PRK08269        151 SPSDATDPAVVDRLAALLERIGKV------PVVCGPS-PGYI----VPRIQA---LAMNEAARMVEEG-VASAEDIDTAI  215 (311)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCE------EEEECCC-CCCH----HHHHHH---HHHHHHHHHHHCC-CCCHHHHHHHH
T ss_conf             789999999999999999973980------6996787-7507----999889---9999999999829-99999999999


Q ss_pred             HH
Q ss_conf             86
Q gi|254780716|r  221 SK  222 (475)
Q Consensus       221 ~~  222 (475)
                      ..
T Consensus       216 ~~  217 (311)
T PRK08269        216 RT  217 (311)
T ss_pred             HH
T ss_conf             86


No 111
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=97.78  E-value=0.00024  Score=51.56  Aligned_cols=94  Identities=20%  Similarity=0.308  Sum_probs=67.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157111688999997898599973998999-9999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELT-DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~-~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .+|++||-|+-|.+-|+||.+.|.+|++--|.-+.. +...+.      ++ -+.+++|.+..   .++|++.+|+- +-
T Consensus        19 K~iaIIGYGsQG~ahalNlRDSGlnViiGlr~g~~s~~kA~~d------Gf-~V~~v~ea~k~---ADvim~L~PDe-~q   87 (338)
T COG0059          19 KKVAIIGYGSQGHAQALNLRDSGLNVIIGLRKGSSSWKKAKED------GF-KVYTVEEAAKR---ADVVMILLPDE-QQ   87 (338)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHC------CC-EEECHHHHHHC---CCEEEEECCHH-HH
T ss_conf             8699990270878887422424874799856887248999966------97-75139998522---79999818654-67


Q ss_pred             HHHHH-HHHHCCCCCCEEEE--CCCCCHH
Q ss_conf             99999-99720789989996--7986578
Q gi|254780716|r   83 DQLID-KLKPLLSPEDILLD--GGNSHFC  108 (475)
Q Consensus        83 ~~vi~-~l~~~l~~g~iiID--~sts~~~  108 (475)
                      .+|+. .+.|.|++|+.+.=  +=|.+|.
T Consensus        88 ~~vy~~~I~p~Lk~G~aL~FaHGfNihf~  116 (338)
T COG0059          88 KEVYEKEIAPNLKEGAALGFAHGFNIHFG  116 (338)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCEECC
T ss_conf             89999874345227866776265531133


No 112
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=97.77  E-value=0.00019  Score=52.36  Aligned_cols=179  Identities=13%  Similarity=0.211  Sum_probs=101.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCCEECC--CHHHHHHHCCCCCEEEEECCCH
Q ss_conf             880569815711168899999789-8599973998999999971221127840328--9899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKVIVTK--NLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~--s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      ..++=+||.|-||.=.|+||..+| ..|.+-|||.+|+++|+++....  ....+.  .++++.+.|...++||.+-.++
T Consensus       185 ~~~~LliGAGeMg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P--~~~~f~~La~~~L~~~L~~~DivissTgA~  262 (436)
T TIGR01035       185 GKKVLLIGAGEMGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGP--EAVKFEALALEKLEEALAEADIVISSTGAP  262 (436)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCC--CCCCCCHHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             641899827457999999996489528988556778999999870786--645444554899999974288999855765


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH-HHHHCCCCEECCCCCCCCCCCCCCC-E-EEEECCHHHHHHHHH
Q ss_conf             699999999972078998999679865789999999-9984799430675467600035684-3-788454899988899
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL-QLSEKGIYFIGIGVSGGVKGARSGA-S-LMVGGNEKAYNRVEN  156 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~-~l~~kgi~fid~pVSGG~~gA~~G~-s-lMvGG~~~~~~~~~p  156 (475)
                      .++-          +       .  ...+.+.+..+ .-.......+|-.|=--...+..-+ . ++.     ..|-+++
T Consensus       263 ~pi~----------~-------~--~~~e~a~~~Rr~de~~~pl~~~DIAvPRdvd~~v~~L~~vfLy-----~vDDL~~  318 (436)
T TIGR01035       263 EPIV----------S-------K--EDVERALKERRRDEAARPLFIVDIAVPRDVDPEVAKLEGVFLY-----DVDDLKE  318 (436)
T ss_pred             CCCC----------C-------C--HHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHCCCCEEEE-----EECCHHH
T ss_conf             3100----------2-------0--3489999972220015886999758899863786222966997-----3031389


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             99987501567861898569874678988776787888999899999999642899789999998606884430799999
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT  236 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~  236 (475)
                      +-+.=.++                        -.     +.+..++.|+.       +|+.....+|+.-...-+.-++-
T Consensus       319 ~~~~N~a~------------------------R~-----~~~~~ae~I~~-------~E~~~f~~w~~~l~~~p~I~~Lr  362 (436)
T TIGR01035       319 VVEENLAE------------------------RR-----EEAEKAELIVE-------EEVAEFKQWLRSLEVEPTIKELR  362 (436)
T ss_pred             HHHHHHHH------------------------HH-----HHHHHHHHHHH-------HHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             99999999------------------------99-----99999999999-------99999999998658317889999


Q ss_pred             HHHHHHC
Q ss_conf             9999740
Q gi|254780716|r  237 AEILSSS  243 (475)
Q Consensus       237 ~~il~~k  243 (475)
                      +.+..-.
T Consensus       363 ~~ae~~~  369 (436)
T TIGR01035       363 SKAEEVR  369 (436)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 113
>PRK06823 ornithine cyclodeaminase; Validated
Probab=97.75  E-value=0.00026  Score=51.36  Aligned_cols=115  Identities=15%  Similarity=0.160  Sum_probs=83.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978--98599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDK--GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~--G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +.+|+||.|.++...+.-+..-  --+|.+|||++++.+.|.+......-.+..+.+++|.+...+   +|+++-|+..+
T Consensus       129 ~~l~iiGtG~QA~~~l~a~~~v~~i~~v~v~~r~~~~~~~f~~~~~~~~~~v~~~~~~~eav~~AD---IIvtaT~s~~P  205 (315)
T PRK06823        129 KAIGIVGTGIQARMQLMYLKNVTDCRQLWVWGRSETALEEYRQYAQALGFAVNTTLDAAEVAHAAN---LIVTTTPSREP  205 (315)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCC---EEEEEECCCCC
T ss_conf             569997718999999999987187109999469979999999999861990799489999974277---47988789996


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHH-HHCCCCEECC
Q ss_conf             999999997207899899967986578999999999-8479943067
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL-SEKGIYFIGI  127 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l-~~kgi~fid~  127 (475)
                      +-   .  ...++||..|.-.|...| ..+++...+ .....-|+|-
T Consensus       206 v~---~--~~~lkpG~hi~~iGs~~p-~~~Eld~~~l~~a~~vvvD~  246 (315)
T PRK06823        206 LL---Q--AEDIQPGTHITAVGADSP-GKQELDAELVARADKILVDS  246 (315)
T ss_pred             CC---C--CCCCCCCCEEEECCCCCC-CCCCCCHHHHHCCCEEEECC
T ss_conf             41---6--555789967984279994-11004999991498999887


No 114
>PRK10669 putative cation:proton antiport protein; Provisional
Probab=97.73  E-value=0.0022  Score=44.49  Aligned_cols=114  Identities=16%  Similarity=0.221  Sum_probs=71.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHH--HHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997898599973998999999971221127840328989998--6057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV--EAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v--~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++=++|.|..|+.+++.|.++|.++.+.|.++++++++.+++...   +.+=.+-.|+.  ..++++|.+++++|+....
T Consensus       419 hvii~G~Gr~G~~va~~L~~~~~~~vvid~d~~~v~~~~~~g~~v---~~GDa~~~~~L~~agi~~A~~vvit~~d~~~~  495 (558)
T PRK10669        419 HALLVGYGRVGSLLGEKLLASGIPLVVIETSRTRVDELRERGIRA---VLGNAANEEIMQLAHLDCARWLLLTIPNGYEA  495 (558)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEE---EEECCCCHHHHHHCCCCCCCEEEEEECCHHHH
T ss_conf             989989886699999999987998899989899999999689979---99789988999857913249999981988999


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             999999972078998999679865789999999998479943067
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ..++..+...-..-.|++-+.      ..+..+++++.|.+.+=.
T Consensus       496 ~~iv~~~r~~~p~~~IiaRa~------~~~~~~~L~~aGA~~VV~  534 (558)
T PRK10669        496 GEIVASAREKNPDIEIIARAH------YDDEVAYITERGANQVVM  534 (558)
T ss_pred             HHHHHHHHHHCCCCEEEEEEC------CHHHHHHHHHCCCCEEEC
T ss_conf             999999998786986999979------899999999779998989


No 115
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only]
Probab=97.68  E-value=0.0074  Score=40.63  Aligned_cols=185  Identities=11%  Similarity=0.157  Sum_probs=114.7

Q ss_pred             EEEEECCHH--------------------HHHHHHHHHHCCCEEEEEECCHHHHHHH-HHHCCCCCCCCEECCCHHHHHH
Q ss_conf             569815711--------------------1688999997898599973998999999-9712211278403289899986
Q gi|254780716|r    6 IGIIGLGSM--------------------GSNLSLNILDKGFRLAVYNKDFELTDVF-IKKISGLSQKVIVTKNLEQMVE   64 (475)
Q Consensus         6 IGiIGLG~M--------------------G~~mA~nL~~~G~~V~vydr~~~~~~~l-~~~~~~~~~~~~~~~s~~e~v~   64 (475)
                      |.+.|.||-                    |..||-.++++|++|...+.+.+-.++- .+.  -+++++....+-.+.+ 
T Consensus         4 v~vygagnq~ly~~~l~~pek~ggE~PyGGa~mAiefAeAGHDVVLaePn~d~~dd~~w~~--vedAGV~vv~dD~eaa-   80 (340)
T COG4007           4 VAVYGAGNQRLYLEQLNLPEKYGGEPPYGGARMAIEFAEAGHDVVLAEPNRDIMDDEHWKR--VEDAGVEVVSDDAEAA-   80 (340)
T ss_pred             EEEECCCCCCHHHHHCCCHHHHCCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH--HHHCCCEEECCCHHHH-
T ss_conf             8997277501138761975651899998704889999874785796368722038899999--9865827742735553-


Q ss_pred             HCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH-HHHHHHH----CCCC-EECCCCCCCCCCCCC
Q ss_conf             057788999976990699999999972078998999679865789999-9999984----7994-306754676000356
Q gi|254780716|r   65 AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI-RSLQLSE----KGIY-FIGIGVSGGVKGARS  138 (475)
Q Consensus        65 ~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~-~~~~l~~----kgi~-fid~pVSGG~~gA~~  138 (475)
                        +...+.++.-|-|+++-.+..++++++.+|.+|..+-|++|-.--. +...|+-    .|+. +--++|-|+|.    
T Consensus        81 --~~~Ei~VLFTPFGk~T~~Iarei~~hvpEgAVicnTCT~sp~vLy~~LE~~Lr~kR~dVGvssmHPAgvPGtp~----  154 (340)
T COG4007          81 --EHGEIHVLFTPFGKATFGIAREILEHVPEGAVICNTCTVSPVVLYYSLEGELRTKREDVGVSSMHPAGVPGTPQ----  154 (340)
T ss_pred             --HCCEEEEEECCCCHHHHHHHHHHHHHCCCCCEECCCCCCCHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCC----
T ss_conf             --05658999626532667899999843867868616666764688877656645735535723568778999877----


Q ss_pred             CCEEEEE---------CCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
Q ss_conf             8437884---------54899988899999875015678618985698746789887767---87888999899999999
Q gi|254780716|r  139 GASLMVG---------GNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNG---IEYANMQLIADIYGILR  206 (475)
Q Consensus       139 G~slMvG---------G~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNg---Iey~~mq~iaE~~~~l~  206 (475)
                      .-...++         .+++-.+++..+.+.++..+       |+=|.-   .+--|-.+   .---..+++.+.|.+-.
T Consensus       155 h~~yviagr~t~g~elATeEQi~r~velaes~Gk~~-------yv~pad---v~s~VaDmg~lvtav~l~gvldyy~Vg~  224 (340)
T COG4007         155 HGHYVIAGRSTEGKELATEEQIERCVELAESTGKEV-------YVLPAD---VVSAVADMGVLVTAVALSGVLDYYYVGT  224 (340)
T ss_pred             CCEEEEECCCCCCEEECCHHHHHHHHHHHHHCCCCE-------EECCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             763898216777623034999999999998619722-------762788---8877623578999999999989998877


Q ss_pred             HHC
Q ss_conf             642
Q gi|254780716|r  207 DSL  209 (475)
Q Consensus       207 ~~~  209 (475)
                      +..
T Consensus       225 qIi  227 (340)
T COG4007         225 QII  227 (340)
T ss_pred             HHH
T ss_conf             872


No 116
>PRK11579 putative oxidoreductase; Provisional
Probab=97.68  E-value=0.0036  Score=42.93  Aligned_cols=112  Identities=14%  Similarity=0.153  Sum_probs=78.9

Q ss_pred             CCC-CEEEEEECCHHHHHH-HHHHHH-CCCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             998-805698157111688-999997-8985-999739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQ-ADIGIIGLGSMGSNL-SLNILD-KGFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k-~~IGiIGLG~MG~~m-A~nL~~-~G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |++ -.+|+||+|.+|..+ +..+.. .|.+ |.++|++++++++   .    ...+..+.+++++.+. +.++.|+++.
T Consensus         1 M~~~irvgiiG~G~~~~~~h~~~~~~~~~~~l~av~d~~~~~~~a---~----~~~~~~~~~~~~ll~~-~~id~V~i~t   72 (346)
T PRK11579          1 MSDKIRVGLIGYGYASKTFHAPLIAGTPGLELAAVSSSDETKVKA---D----WPTVTVVSEPKHLFND-PNIDLIVIPT   72 (346)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHC---C----CCCCCEECCHHHHHCC-CCCCEEEECC
T ss_conf             998875999936299999999999629991999997989999950---2----5899538999999459-9999999979


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99069999999997207899899967-986578999999999847994
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~  123 (475)
                      |+..+.+-++.-+...   -.++++= =+.+..+..++.+.++++|+.
T Consensus        73 p~~~H~~~~~~al~aG---khv~~EKP~a~~~~~a~~l~~~a~~~g~~  117 (346)
T PRK11579         73 PNDTHFPLAKAALEAG---KHVVVDKPFTVTLSQARELDALAKSLGRV  117 (346)
T ss_pred             CCHHHHHHHHHHHHCC---CCEEECCCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             9678999999999879---94895387678799999999999872967


No 117
>PRK13940 glutamyl-tRNA reductase; Provisional
Probab=97.64  E-value=0.00043  Score=49.71  Aligned_cols=74  Identities=16%  Similarity=0.205  Sum_probs=54.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157111688999997898-5999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-+||.|.||.-.+++|.++|. ++.+.||+.++++++.++...     .....++++.+.+...++|+++..++.++
T Consensus       182 ~~vlvvGaGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~~-----~~~~~~~~l~~~l~~aDivisaT~a~~~i  256 (414)
T PRK13940        182 KNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRN-----ASAHYLSELPQLIKKADIIIAAVNVLEYI  256 (414)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCC-----CCCCCHHHHHHHHHHCCEEEEECCCCHHH
T ss_conf             8389966864789999999976998799945756779999997088-----85016999999986388799816982444


No 118
>pfam02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family. This family contains the bacterial Ornithine cyclodeaminase enzyme EC:4.3.1.12, which catalyses the deamination of ornithine to proline. This family also contains mu-Crystallin the major component of the eye lens in several Australian marsupials, mRNA for this protein has also been found in human retina.
Probab=97.62  E-value=0.00081  Score=47.70  Aligned_cols=115  Identities=15%  Similarity=0.254  Sum_probs=79.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH-
Q ss_conf             805698157111688999997--89859997399899999997122112784032898999860577889999769906-
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD-   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~-   80 (475)
                      ..+|+||.|.++..-.+-+..  .--+|.+|||++++.+.|.+......-.+..+.++++.+...+   +|+++-++.+ 
T Consensus       130 ~~l~iiGaG~QA~~~l~al~~v~~i~~v~v~~r~~~~~~~f~~~~~~~~~~v~~~~~~~~av~~AD---IIvtaT~s~~~  206 (312)
T pfam02423       130 STLAIIGAGAQAEFQAEALSAVLPIEEIRIYDRDPEAAEKFARNLQGKGFEIVACTSAEEAVEGAD---IVVTVTPDKEF  206 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCHHHHHHCCC---EEEEEECCCCC
T ss_conf             579996462538999999996199768999968989999999999834996599489999971499---89997359977


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             99999999972078998999679865789999999998479943067
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ++   +.  ...+++|..|+-.|...|.. +++...+-.+.--|+|.
T Consensus       207 P~---~~--~~~l~~G~hv~~vGs~~p~~-~El~~~~~~~a~v~vD~  247 (312)
T pfam02423       207 PI---LK--AEWVKPGVHINAVGADCPGK-TELDPDILLRADIFVDY  247 (312)
T ss_pred             CC---CC--HHHCCCCCEEEEECCCCCCC-CCCCHHHHHCCCEEECC
T ss_conf             50---07--78838986899726999970-43689998208176066


No 119
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=97.62  E-value=0.0029  Score=43.65  Aligned_cols=101  Identities=18%  Similarity=0.311  Sum_probs=66.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-CCCCCCCCEE-CCCHHHHHHH-CCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898599973998999999971-2211278403-2898999860-5778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK-ISGLSQKVIV-TKNLEQMVEA-VCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~-~~~~~~~~~~-~~s~~e~v~~-l~~pr~Iil~vp~g~~   81 (475)
                      +|.+||+|.+|..+|++|.+.|++|.+-|+++++++++.+. ....  -+.+ ..+.+-+-+. ++..+.++.+..+ ..
T Consensus         2 ~iiIiG~G~vG~~va~~L~~~g~~Vv~Id~d~~~~~~~~~~~~~~~--~v~gd~t~~~~L~~agi~~aD~vva~t~~-d~   78 (225)
T COG0569           2 KIIIIGAGRVGRSVARELSEEGHNVVLIDRDEERVEEFLADELDTH--VVIGDATDEDVLEEAGIDDADAVVAATGN-DE   78 (225)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEE--EEEECCCCHHHHHHCCCCCCCEEEEEECC-CH
T ss_conf             8999898578899999998789908999768899998632000449--99926889899986798638999998088-67


Q ss_pred             HHHHHHHHHH-CCCCCCEEEECCCCCHH
Q ss_conf             9999999972-07899899967986578
Q gi|254780716|r   82 VDQLIDKLKP-LLSPEDILLDGGNSHFC  108 (475)
Q Consensus        82 v~~vi~~l~~-~l~~g~iiID~sts~~~  108 (475)
                      +..++-.+.. .+..-.++.-..+..+.
T Consensus        79 ~N~i~~~la~~~~gv~~viar~~~~~~~  106 (225)
T COG0569          79 VNSVLALLALKEFGVPRVIARARNPEHE  106 (225)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCHHH
T ss_conf             9999999999873998499995694167


No 120
>PRK13301 putative L-aspartate dehydrogenase; Provisional
Probab=97.56  E-value=0.0015  Score=45.71  Aligned_cols=118  Identities=16%  Similarity=0.271  Sum_probs=71.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC---CEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             99880569815711168899999789---85999-739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG---FRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G---~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |++ .||+||+|.||+.++..|...+   +.+.+ +++..+..+.+       ...+..+.++.+++.  .+|++|+=|-
T Consensus         1 M~~-rVgiiG~GAIG~~Va~~l~~~~~~~~~l~~~~~~~~~~~~~~-------~~~~~~~~~~~~lla--~~pDlVvE~A   70 (267)
T PRK13301          1 MTH-RIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPAL-------AGRVALLDGLPGLLA--WRPDLVVEAA   70 (267)
T ss_pred             CCE-EEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHH-------CCCCCCCCCHHHHHC--CCCCEEEECC
T ss_conf             951-799985169999999998617776528999815335555553-------256654577577741--2899999897


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHH---HHHHHHHHHCCCC-EECCCCCCC
Q ss_conf             9906999999999720789989996798657899---9999999847994-306754676
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDT---QIRSLQLSEKGIY-FIGIGVSGG  132 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t---~~~~~~l~~kgi~-fid~pVSGG  132 (475)
                      +. .+|.+....+   |+.|.-++-+|..-..|.   .++.+.+++.|-+ |+-.|=-||
T Consensus        71 s~-~Av~~~a~~v---L~~G~dlvv~SvGALaD~~l~~~l~~~A~~~g~~i~ipsGAIgG  126 (267)
T PRK13301         71 GQ-QAIAEHAEGC---LTAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAG  126 (267)
T ss_pred             CH-HHHHHHHHHH---HHCCCCEEEECHHHHCCHHHHHHHHHHHHHCCCEEEECCCHHHC
T ss_conf             98-9999999999---97599699982378479889999999999779869974730104


No 121
>KOG2741 consensus
Probab=97.56  E-value=0.0039  Score=42.67  Aligned_cols=118  Identities=11%  Similarity=0.170  Sum_probs=91.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHC---CCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             056981571116889999978---985-9997399899999997122112784032898999860577889999769906
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDK---GFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~---G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      .+||+|+|.|+.-.+++|...   ++. |.+++|+.+++++|++.....  +.+.+.+.+||+++ +..++|.+..|+..
T Consensus         8 r~Gi~g~g~ia~~f~~al~~~p~s~~~Ivava~~s~~~A~~fAq~~~~~--~~k~y~syEeLakd-~~vDvVyi~~~~~q   84 (351)
T KOG2741           8 RWGIVGAGRIARDFVRALHTLPESNHQIVAVADPSLERAKEFAQRHNIP--NPKAYGSYEELAKD-PEVDVVYISTPNPQ   84 (351)
T ss_pred             EEEEEEHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHHHHHCCCC--CCCCCCCHHHHHCC-CCCCEEEECCCCCC
T ss_conf             8988604677899999721475458279999655278899999865999--87425579988249-87687996799800


Q ss_pred             HHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             9999999997207899899967-98657899999999984799430675
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIYFIGIG  128 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~fid~p  128 (475)
                      +.+-+..-|...   -.++++- -..+..+..++.+.++.+|+.|++.-
T Consensus        85 H~evv~l~l~~~---K~VL~EKPla~n~~e~~~iveaA~~rgv~~meg~  130 (351)
T KOG2741          85 HYEVVMLALNKG---KHVLCEKPLAMNVAEAEEIVEAAEARGVFFMEGL  130 (351)
T ss_pred             HHHHHHHHHHCC---CCEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             899999999759---9578656553889999999999997694887644


No 122
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional
Probab=97.54  E-value=0.011  Score=39.26  Aligned_cols=185  Identities=14%  Similarity=0.185  Sum_probs=113.9

Q ss_pred             HHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             1688999997898599973998999-999971221127840328989998605778899997699069999999997207
Q gi|254780716|r   15 GSNLSLNILDKGFRLAVYNKDFELT-DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLL   93 (475)
Q Consensus        15 G~~mA~nL~~~G~~V~vydr~~~~~-~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l   93 (475)
                      |+.||-.++++|++|..-+.+++.. ++.-+.  -+++++....+-.|.+   +...+.++.-|-|+.+-.+...+++++
T Consensus        32 Gs~MAiefA~AGHDVvLaePn~~~lsee~w~~--VEdAgVkvv~dD~eAa---kh~Ei~ilFTPFGk~T~~Iak~Il~hl  106 (341)
T PRK12557         32 GSRMAIEFAEAGHDVVLAEPNKSMLSDEQWKR--VEDAGVKVVTDDAEAA---KHAEIAVLFTPFGKKTVEIAKEILPHL  106 (341)
T ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCHHHHHH--HHHCCCEEECCCHHHH---HCCEEEEEECCCCCHHHHHHHHHHHHC
T ss_conf             04999999975784797357623169899999--9974966733616665---267589996476406789999886218


Q ss_pred             CCCCEEEECCCCCHHHHHH-HHHHHHH----CCCC-EECCCCCCCCCC--------CCCCCEEEEECCHHHHHHHHHHHH
Q ss_conf             8998999679865789999-9999984----7994-306754676000--------356843788454899988899999
Q gi|254780716|r   94 SPEDILLDGGNSHFCDTQI-RSLQLSE----KGIY-FIGIGVSGGVKG--------ARSGASLMVGGNEKAYNRVENILL  159 (475)
Q Consensus        94 ~~g~iiID~sts~~~~t~~-~~~~l~~----kgi~-fid~pVSGG~~g--------A~~G~slMvGG~~~~~~~~~piL~  159 (475)
                      ..|.+|..+-|++|-.--. +...++.    .||. |--++|-|+|..        +.+|..+   .+++-.+++-.+.+
T Consensus       107 pe~AVIcnTCTvspvvLy~~Le~eLr~kR~DvGisSmHPA~VPGTp~h~~Yviag~~~~g~~~---AteEQi~k~veL~e  183 (341)
T PRK12557        107 PEGAVICNTCTVSPVVLYYSLEVELRTKRKDVGISSMHPAAVPGTPQHGHYVIAGKATNGTEY---ATEEQIEKCVELAE  183 (341)
T ss_pred             CCCCEEECCCCCCHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCC---CCHHHHHHHHHHHH
T ss_conf             778776166677599999999999830124247335687789998767528973677787401---46999999999999


Q ss_pred             HHHCCCCCCCEEEEECCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             875015678618985698746789-887767878889998999999996428997899
Q gi|254780716|r  160 SISAKYQNSPCCALLGPDGSGHFV-KMIHNGIEYANMQLIADIYGILRDSLNKNPLEI  216 (475)
Q Consensus       160 ~iaak~~~~~cv~y~G~~GsGh~v-KMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i  216 (475)
                      .+....       |+=|..--..| -|- --.--..++.+.+-|.+-.+..+ -++++
T Consensus       184 S~gK~~-------yvvPadv~s~VaDMg-slvtav~l~gvldyy~vg~~ii~-AP~~M  232 (341)
T PRK12557        184 STGKEV-------YVVPADVSSTVADMG-SLLTAVTLSGVLDYYSVGTKIIK-APKEM  232 (341)
T ss_pred             HCCCCC-------EEECHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHC-CHHHH
T ss_conf             629851-------660656524454568-89999999999999999899864-85999


No 123
>PRK08618 ornithine cyclodeaminase; Validated
Probab=97.54  E-value=0.00082  Score=47.64  Aligned_cols=114  Identities=16%  Similarity=0.220  Sum_probs=79.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHH-C-CCEEEEEECCHHHHHHHHHHCCC-CCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997-8-98599973998999999971221-12784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD-K-GFRLAVYNKDFELTDVFIKKISG-LSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~-~-G~~V~vydr~~~~~~~l~~~~~~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..+|+||.|..+...++-+.. . =-+|.+|||++++.++|.++... .+-.+.++.++++.+...+   +|+++-++.+
T Consensus       128 ~~l~iiGaG~QA~~~~~a~~~v~~i~~v~v~~r~~~~~~~f~~~~~~~~g~~v~~~~~~~~av~~aD---iV~taT~s~~  204 (325)
T PRK08618        128 KTLCLIGTGGQAKGQLEAVLAVRDIEKVRVYSRTFEKAYAFAQEIQSKFNTEIYVVESADEAIEEAD---IIVTVTNAKT  204 (325)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCC---EEEEECCCCC
T ss_conf             5699975607999999999860896689999479999999999998750996699589999984398---8999259998


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH-HHHHCCCCEECC
Q ss_conf             99999999972078998999679865789999999-998479943067
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL-QLSEKGIYFIGI  127 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~-~l~~kgi~fid~  127 (475)
                      ++   +++   .+++|..|+-.|...|. .++... .+.....-|+|.
T Consensus       205 Pv---~~~---~l~~g~hi~aiGs~~p~-~~El~~~~l~~a~~vvvD~  245 (325)
T PRK08618        205 PV---FSE---KLKKGVHINAVGSFRPD-MQEIPSEAIARADKVVVES  245 (325)
T ss_pred             CC---CCC---CCCCCEEECCCCCCCCC-CCCCCHHHHHHCCEEEECC
T ss_conf             64---454---35887175132468986-3457899995199899987


No 124
>PRK06141 ornithine cyclodeaminase; Validated
Probab=97.54  E-value=0.00047  Score=49.41  Aligned_cols=115  Identities=14%  Similarity=0.117  Sum_probs=78.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978--98599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDK--GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~--G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+|+||.|..+...+.-+..-  --+|.+|+|++++.++|.++.....-.+..+.++++.+...+   +|++.-++.++
T Consensus       126 ~~l~iiG~G~QA~~~l~a~~~v~~i~~v~v~~r~~~~a~~~~~~~~~~~~~~~~~~~~~~av~~aD---II~taT~s~~P  202 (313)
T PRK06141        126 RRLLVVGTGRLASLLALAHASVRPIKQVRVWGRNPAKAAALAAELREQGFDAEVVTDLEAAVRQAD---IISCATLSTEP  202 (313)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCC---EEEECCCCCCC
T ss_conf             679997788999999999997289758999938989999999999850997599589999861087---79971688986


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             9999999972078998999679865789999999998479943067
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      +   ++  ...+++|..|+-.|...|. .++....+-.+.--|+|.
T Consensus       203 v---~~--~~~l~~G~hI~avGs~~p~-~~El~~~~~~~a~v~vD~  242 (313)
T PRK06141        203 L---VR--GEWLRPGTHLDLVGSFTPD-MRECDDAAIARASVYVDT  242 (313)
T ss_pred             C---CC--CCCCCCCCEEEEECCCCCC-CEECCHHHHCCCEEEEEC
T ss_conf             4---46--4446787269763589987-554597786077399918


No 125
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; InterPro: IPR011967    This 3-hydroxyacyl-CoA dehydrogenase is involved in the degradation of phenylacetic acid, presumably in steps following the opening of the phenyl ring . The sequences included in this entry are all found in possible operons with other related genes such as paaA, paaB, paaD, paaE, paaF and paaN . Some genomes contain these other genes without an apparent paaC in the same operon - possibly in these cases a different dehydrogenase involved in fatty acid degradation may fill in the needed activity. .
Probab=97.52  E-value=0.00023  Score=51.74  Aligned_cols=149  Identities=15%  Similarity=0.217  Sum_probs=88.9

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH-----------HCC-------CCCCCCEECCCHHHHHH
Q ss_conf             880569815711168899999789859997399899999997-----------122-------11278403289899986
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK-----------KIS-------GLSQKVIVTKNLEQMVE   64 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~-----------~~~-------~~~~~~~~~~s~~e~v~   64 (475)
                      ..+|.+||-|.||.++|.==+++||+|..||..++....-++           +++       ...+.+.|+.+++++++
T Consensus         5 ~v~vaVIGaGaMGaGIA~VAA~aGH~V~LYD~r~eA~a~a~agIe~~L~~lV~kgkL~a~e~e~~l~Rl~PV~~l~alAd   84 (508)
T TIGR02279         5 VVKVAVIGAGAMGAGIAQVAARAGHQVLLYDIRAEALARAVAGIEKRLKSLVEKGKLTAEEAERTLKRLVPVTDLEALAD   84 (508)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             10689964685210389999825984887228889999999999999888752377778888888731787789999860


Q ss_pred             HCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH---CCCCEECC-CCCCCCCCCCCCC
Q ss_conf             0577889999769906999999999720789989996798657899999999984---79943067-5467600035684
Q gi|254780716|r   65 AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE---KGIYFIGI-GVSGGVKGARSGA  140 (475)
Q Consensus        65 ~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~---kgi~fid~-pVSGG~~gA~~G~  140 (475)
                      +    +.+|=-+.--=.|+.-+..=+..+-+-|.||-.-||+.+-|--.+...+.   .|.||.-. |+--=+       
T Consensus        85 A----gLvIEAivE~L~VK~aLFaqLe~lc~ad~iiasNTSSlSIta~AAglarP~rvaGlHFFNPAP~MaLV-------  153 (508)
T TIGR02279        85 A----GLVIEAIVENLEVKKALFAQLEELCTADAIIASNTSSLSITALAAGLARPERVAGLHFFNPAPVMALV-------  153 (508)
T ss_pred             C----CCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCEE-------
T ss_conf             2----73224677406777999998986367015256232577799999731387707511134865536215-------


Q ss_pred             EEEEEC---CHHHHHHHHHHHHHHHC
Q ss_conf             378845---48999888999998750
Q gi|254780716|r  141 SLMVGG---NEKAYNRVENILLSISA  163 (475)
Q Consensus       141 slMvGG---~~~~~~~~~piL~~iaa  163 (475)
                       =.|+|   +.++.+.+-..=.+=++
T Consensus       154 -EVVSGLaT~~eVae~ly~~a~aWGK  178 (508)
T TIGR02279       154 -EVVSGLATEAEVAEQLYETARAWGK  178 (508)
T ss_pred             -EEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             -6623635428999999999873288


No 126
>PRK07340 ornithine cyclodeaminase; Validated
Probab=97.50  E-value=0.0009  Score=47.36  Aligned_cols=162  Identities=12%  Similarity=0.113  Sum_probs=98.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             805698157111688999997--898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+++||.|..+...+.-+..  .--+|.+|+|++++.+.|.++........ ...+.++.+...   ++|+++-++.++
T Consensus       126 ~~l~iiGaG~QA~~~~~a~~~v~~~~~V~v~~r~~~~a~~~~~~~~~~~~~~-~~~~~e~av~~a---DiI~taT~S~~P  201 (304)
T PRK07340        126 RDLLLIGTGVQAAHHLEALAALLPVRRVWVRGRTAASAAAFCAAARALGPTL-EPLDGDAIPPAV---DVVVTVTTSRTP  201 (304)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCCCCCE-EECCHHHHHHHC---CEEEEECCCCCC
T ss_conf             5179973479999999999985997489998799899999999986009917-976899998428---989994189976


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             99999999720789989996798657899999999984799430675467600035684378845489998889999987
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSI  161 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~i  161 (475)
                      +-   .   ..+++|..|.-.|...| +.+++...+-.+.--|+|-.-.   .-++.|..+..+.+.+....+-.++   
T Consensus       202 v~---~---~~~~~g~hI~aiGs~~p-~~~Eld~~l~~~a~v~VD~~e~---~~~eaGeli~a~~~~~~~~eLg~v~---  268 (304)
T PRK07340        202 VY---P---EAARAGRLVVGVGAFTP-DMAELAPRTVRGSALYVDDPAG---ARHEAGDLIQAGVDWSRVRSLADAL---  268 (304)
T ss_pred             CC---C---CCCCCCEEEECCCCCCC-CCEECCHHHHHCCEEEEECHHH---HHHHCHHHHHCCCCHHHHEEHHHHH---
T ss_conf             44---6---55799818941378999-8435699999419599907999---9986313875688510012599997---


Q ss_pred             HCCCCCCCEEEEECCCCHHHH
Q ss_conf             501567861898569874678
Q gi|254780716|r  162 SAKYQNSPCCALLGPDGSGHF  182 (475)
Q Consensus       162 aak~~~~~cv~y~G~~GsGh~  182 (475)
                      ..+..+....+.+-..|.|..
T Consensus       269 ~g~~~~r~~~tvFksvG~a~~  289 (304)
T PRK07340        269 RGTVPARGGPVLFKSVGCAAW  289 (304)
T ss_pred             CCCCCCCCCCEEEECCCHHHH
T ss_conf             599889999889969885999


No 127
>PRK06407 ornithine cyclodeaminase; Provisional
Probab=97.49  E-value=0.0013  Score=46.15  Aligned_cols=115  Identities=17%  Similarity=0.223  Sum_probs=78.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCC-CCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997--898599973998999999971221-12784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISG-LSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..+|+||.|..+...++-+..  .--+|.+|+|++++.++|.++... ..-.+.++.++++.+...+   +|+++-++..
T Consensus       119 ~~l~iiG~G~QA~~~~~a~~~v~~i~~v~v~~r~~~~a~~f~~~~~~~~~~~v~~~~~~e~av~~aD---iI~taT~s~~  195 (302)
T PRK06407        119 ENFTIIGSGFQAETQLEGMASVYNPKRIRVYSRNFDHARAFAERFSKEFGVDIRPVDNAEAALRDAD---TITSITNSDT  195 (302)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCC---EEEEECCCCC
T ss_conf             7899996659999999999974077389998088899999999986440995799489999983499---9999418988


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH-HHHCCCCEECC
Q ss_conf             999999999720789989996798657899999999-98479943067
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ-LSEKGIYFIGI  127 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~-l~~kgi~fid~  127 (475)
                      ++-   .  ...+++|..|.-.|...|. .+++... +....+.++|.
T Consensus       196 Pv~---~--~~~l~~g~hi~aiGa~~p~-~~Eld~~ll~~a~~vvvD~  237 (302)
T PRK06407        196 PIF---N--RKYLGDEYHVNLAGSNYPN-RREAEHSVLNDADIVVTEH  237 (302)
T ss_pred             CCC---C--HHHCCCCCEEEEECCCCCC-CCCCCHHHHHHCCEEEECC
T ss_conf             671---5--8887999489963799998-5307999996199999888


No 128
>PRK08291 ornithine cyclodeaminase; Validated
Probab=97.47  E-value=0.0011  Score=46.82  Aligned_cols=114  Identities=11%  Similarity=0.161  Sum_probs=76.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCC-CCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997--898599973998999999971221-12784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISG-LSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..+|+||.|..+..-.+-|..  .=-+|.+|+|++++.+.|.++... .+-.+.++.++++.+...+   +|+++-++..
T Consensus       133 ~~l~iiG~G~QA~~~l~Al~~v~~i~~v~v~~r~~~~a~~f~~~~~~~~g~~v~~~~~~~~av~~aD---IIvtaT~s~~  209 (330)
T PRK08291        133 SRVAVFGAGEQARLQLEALTLVRDIREVRVWARDAAKAEAFAAELRAALGIPVTVARDVHAALAGAD---IVVTTTPSEE  209 (330)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCCEEEECCHHHHHHCCC---EEEEEECCCC
T ss_conf             5699987648899999999973897689998389899999999998976996699299999972288---8999768999


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH-HHHCCCCEEC
Q ss_conf             999999999720789989996798657899999999-9847994306
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ-LSEKGIYFIG  126 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~-l~~kgi~fid  126 (475)
                      ++-   .  ...++||..|+-.|...|. .++.... +......+.|
T Consensus       210 Pv~---~--~~~lkpG~hI~aiGs~~p~-~rEld~~~~~~a~~vv~D  250 (330)
T PRK08291        210 PIL---K--AEWLHPGLHVTAMGSDAEH-KNEIAPAVFAAADRYVCD  250 (330)
T ss_pred             CCC---C--HHHCCCCCEEEEECCCCCC-CCCCCHHHHHCCCEEEEC
T ss_conf             501---5--1006998289970699987-452477777308799969


No 129
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]
Probab=97.46  E-value=0.0014  Score=45.83  Aligned_cols=116  Identities=16%  Similarity=0.203  Sum_probs=80.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCCCC-CCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997--89859997399899999997122112-784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISGLS-QKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      +.+|+||.|.++.-...-+..  ..-++.+|+|+++..+++........ ..+..+.+.++.+...+   +|+++-|+.+
T Consensus       131 ~~laiIGaG~qA~~ql~a~~~v~~~~~I~i~~r~~~~~e~~a~~l~~~~~~~v~a~~s~~~av~~aD---iIvt~T~s~~  207 (330)
T COG2423         131 STLAIIGAGAQARTQLEALKAVRDIREIRVYSRDPEAAEAFAARLRKRGGEAVGAADSAEEAVEGAD---IVVTATPSTE  207 (330)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEECCCHHHHHHCCC---EEEEECCCCC
T ss_conf             5799988848999999999962896189997689899999999987633865132368998861399---8999428998


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHH-HHHCCCCEECCC
Q ss_conf             999999999720789989996798657899999999-984799430675
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ-LSEKGIYFIGIG  128 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~-l~~kgi~fid~p  128 (475)
                      ++   +  ....+++|.-|.-.|.-. ....+...+ +...+.-|+|-+
T Consensus       208 Pi---l--~~~~l~~G~hI~aiGad~-p~k~Eld~e~l~ra~~vvvD~~  250 (330)
T COG2423         208 PV---L--KAEWLKPGTHINAIGADA-PGKRELDPEVLARADRVVVDSL  250 (330)
T ss_pred             CE---E--CHHHCCCCCEEEECCCCC-CCCCCCCHHHHHHCCEEEECCH
T ss_conf             76---2--386658970897037899-6524278999985090997577


No 130
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=97.45  E-value=0.0064  Score=41.09  Aligned_cols=86  Identities=19%  Similarity=0.266  Sum_probs=57.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEE-CCCHHHHHH-HCCCCCEEEEECCCHHHH
Q ss_conf             056981571116889999978985999739989999999712211278403-289899986-057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIV-TKNLEQMVE-AVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~-~~s~~e~v~-~l~~pr~Iil~vp~g~~v   82 (475)
                      +|=++|.|.+|+.+|+.|...|++|.+-|+++++++.+.......  .+.+ ..+++-+-+ .+++++.+ +.+++...+
T Consensus         2 ~IiI~GaG~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~lDv~--~i~Gd~~~~~~L~~Agi~~ad~~-IAvT~~De~   78 (455)
T PRK09496          2 KIIILGAGQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRLDVR--TVVGNGSHPDVLREAGAEDADML-IAVTDSDET   78 (455)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCEE--EEEECCCCHHHHHHCCCCCCCEE-EEECCCHHH
T ss_conf             799999888999999999868997999989999999988625868--99966899999996599869999-995797189


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999997207
Q gi|254780716|r   83 DQLIDKLKPLL   93 (475)
Q Consensus        83 ~~vi~~l~~~l   93 (475)
                      .-+.-.+...+
T Consensus        79 Nli~~~lAk~l   89 (455)
T PRK09496         79 NMVACQIAKSL   89 (455)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999986


No 131
>PRK13303 L-aspartate dehydrogenase; Provisional
Probab=97.43  E-value=0.0053  Score=41.65  Aligned_cols=171  Identities=13%  Similarity=0.193  Sum_probs=96.1

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC-CE---EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             99880569815711168899999789-85---999739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG-FR---LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G-~~---V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |.+  ||+||.|.||+.+|..|.+.. ..   |.+++++.+..+....      ..+..+.+++++.   ++|++|+=|-
T Consensus         1 Mmr--VgiiG~GaIG~~va~~l~~~~~~~~~~v~~~~~~~~~~~~~~~------~~~~~~~~~~~L~---~~~DlVVE~A   69 (265)
T PRK13303          1 MMK--VAMIGFGAIAAAVYELLEHDPRLRVDWVIVPEHSVDAVRRALG------RAVQVVSSVDALA---QRPDLVVECA   69 (265)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHC------CCCCCCCCHHHHH---HCCCEEEECC
T ss_conf             929--9998546899999999844997279999946852677875304------5886447988982---3799999898


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHH---HHHHHHHHHHCCC-CEECCCCCCCCC---CCCCC-C-EE-EEEC
Q ss_conf             990699999999972078998999679865789---9999999984799-430675467600---03568-4-37-8845
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCD---TQIRSLQLSEKGI-YFIGIGVSGGVK---GARSG-A-SL-MVGG  146 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~---t~~~~~~l~~kgi-~fid~pVSGG~~---gA~~G-~-sl-MvGG  146 (475)
                      +. +++.+....++   +.|.-++-+|..-..|   -.++.+.+++.|- -|+-.|=-||-.   .|+.| . .+ +.+-
T Consensus        70 ~~-~av~~~~~~~L---~~g~dl~v~SvgALaD~~~~~~l~~~A~~~~~~i~ipsGAigGlD~l~aa~~~~i~~V~~~t~  145 (265)
T PRK13303         70 GH-AALKEHVVPIL---KAGIDCAVASVGALADEALRERLEQAAEAGGARLHLLSGAIGGIDALAAAKEGGLDEVRYTGR  145 (265)
T ss_pred             CH-HHHHHHHHHHH---HCCCCEEEECCHHHCCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             88-99999999999---729988998815857988999999999868975997262344067999987189738999986


Q ss_pred             -CHHHHHHHHHHHHHHHCCCCCCCEEEEECCC--CHHHHHHHHH
Q ss_conf             -4899988899999875015678618985698--7467898877
Q gi|254780716|r  147 -NEKAYNRVENILLSISAKYQNSPCCALLGPD--GSGHFVKMIH  187 (475)
Q Consensus       147 -~~~~~~~~~piL~~iaak~~~~~cv~y~G~~--GsGh~vKMVh  187 (475)
                       ++..|... |..+.+--....+|-+.|-|+.  ..-+|=|=+|
T Consensus       146 K~P~~l~~~-~~e~~~~l~~~~~~~~~F~G~area~~~fP~NvN  188 (265)
T PRK13303        146 KPPKSWRGS-PAEQLCDLDALTEPTVIFEGSAREAARLFPKNAN  188 (265)
T ss_pred             ECHHHHCCC-HHHHCCCCCCCCCCEEEEECCHHHHHHHCCCHHH
T ss_conf             085786667-1543156103777769973189999987786176


No 132
>pfam02254 TrkA_N TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.
Probab=97.43  E-value=0.0051  Score=41.83  Aligned_cols=110  Identities=18%  Similarity=0.218  Sum_probs=70.7

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEE-CCCHHHHHH-HCCCCCEEEEECCCHHHHH
Q ss_conf             56981571116889999978985999739989999999712211278403-289899986-0577889999769906999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIV-TKNLEQMVE-AVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~-~~s~~e~v~-~l~~pr~Iil~vp~g~~v~   83 (475)
                      |-++|+|.+|..+|+.|.+.| +|.+.|+++++++++.+.+..   -+.+ +.+.+-+-. .+++.+.++.+.++...-.
T Consensus         1 viI~G~g~~G~~la~~L~~~~-~v~vId~d~~~~~~~~~~~~~---vi~GD~~~~~~L~~a~i~~a~~vi~~~~~d~~n~   76 (115)
T pfam02254         1 IIIIGYGRVGRSLAEELREGG-PVVVIDKDPERVEELREEGVP---VVVGDATDEEVLEEAGIEDADAVVAATGDDEANI   76 (115)
T ss_pred             CEEECCCHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHCCCE---EEEEECCCHHHHHHHCCCCCCEEEEECCCHHHHH
T ss_conf             999878889999999998089-999999987998778866986---9999568866787619202879999629849999


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             999999720789989996798657899999999984799430
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                      .+...+........|+.-..+      ....+.+++.|+..+
T Consensus        77 ~~~~~~r~~~~~~~iiar~~~------~~~~~~l~~~Gad~v  112 (115)
T pfam02254        77 LIVLLARELNPAKKIIARAND------PEHAELLRRLGADEV  112 (115)
T ss_pred             HHHHHHHHHCCCCEEEEEECC------HHHHHHHHHCCCCEE
T ss_conf             999999997899809999878------999999997698999


No 133
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=97.40  E-value=0.0013  Score=46.16  Aligned_cols=100  Identities=14%  Similarity=0.201  Sum_probs=75.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC--CCHHH
Q ss_conf             8056981571116889999978985999739989999999712211278403289899986057788999976--99069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV--TDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v--p~g~~   81 (475)
                      .++=|||.|+-|.+-++-...-|-+|.++|+++++.+++...+...... ....+.+.+.+.+...++|+..+  |...+
T Consensus        21 a~vvViG~Gv~G~~A~~~A~~lGa~V~v~D~~~~~l~~~~~~~~~~v~~-~~~~~~~~l~~~i~~aDvvIgavl~pg~~a   99 (150)
T pfam01262        21 AKVVVIGGGVVGLGAAATAKGLGAPVTILDVRPERLEQLDSLFAEFVET-DIFSNCEYLAEAIAEADLVIGTVLIPGARA   99 (150)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCC-HHHCCHHHHHHHHHHCCEEEEEEECCCCCC
T ss_conf             7799989878999999999867998999729999999999864762001-665379999999743879997203178869


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             99999999720789989996798
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~st  104 (475)
                      -.-|.++.+..++||.+|||.+-
T Consensus       100 P~lIt~~mv~~MkpGsVIVDvai  122 (150)
T pfam01262       100 PKLVTREMVKTMKPGSVIVDVAI  122 (150)
T ss_pred             CCEECHHHHHHHCCCCEEEEEEC
T ss_conf             92207999984479939999620


No 134
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. For example, leucine DH catalyzes the reversible oxidative deamination of L-leucine and several other straight or branched chain amino acids to the corresponding 2-oxoacid derivative. Amino acid DH -like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily inc
Probab=97.39  E-value=0.0033  Score=43.21  Aligned_cols=116  Identities=21%  Similarity=0.288  Sum_probs=76.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+|.+-|+|+.|+..|+.|.+.|..|++.|.++.+.....+...     .... +.+++..  ..+++++-|-..+....
T Consensus        29 k~VaIqG~GnVG~~~A~~l~~~Gakvvv~d~~~~~~~~~~~~~~-----~~~~-~~~~~~~--~~~DIl~PcA~~~~i~~  100 (200)
T cd01075          29 KTVAVQGLGKVGYKLAEHLLEEGAKLIVADINEEAVARAAELFG-----ATVV-APEEIYS--VDADVFAPCALGGVIND  100 (200)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC-----CEEE-CCHHHHC--CCCCEEEECCCCCCCCH
T ss_conf             99999898799999999999679979998268899999985689-----8893-7332322--77768865141154689


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC--CCCC
Q ss_conf             9999997207899899967986578999999999847994306754--6760
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV--SGGV  133 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV--SGG~  133 (475)
                      +.    .+.+ +-.+|+.+.|.. -.+....+.+.++||.|+=--+  +||+
T Consensus       101 ~~----a~~i-~ak~I~e~AN~p-~t~~~~~~~L~~rgI~~iPD~laNaGGV  146 (200)
T cd01075         101 DT----IPQL-KAKAIAGAANNQ-LADPRHGQMLHERGILYAPDYVVNAGGL  146 (200)
T ss_pred             HH----HHHC-CCCEEEECCCCC-CCCHHHHHHHHHCCEEEECHHHEECCCH
T ss_conf             99----9870-896997356799-9997899999859929968244207354


No 135
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=97.35  E-value=0.015  Score=38.26  Aligned_cols=117  Identities=15%  Similarity=0.183  Sum_probs=85.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHH--HHCCCCCEEEEECCCHHH
Q ss_conf             805698157111688999997898599973998999999971221127840328989998--605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV--EAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v--~~l~~pr~Iil~vp~g~~   81 (475)
                      .+|=++|.|+.|+.+++.|.++|+++.+-|.+++.++...+.|...   ..+=.+-.|+.  ...++.|.+++++++.+.
T Consensus       400 ~~VII~G~GRvGq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v---~yGDat~~~vL~~AGi~~Ar~vViaidd~~~  476 (615)
T PRK03562        400 PRVIIAGFGRFGQIVGRLLLSSGVKMVVLDHDPDHIETLRKFGMKV---FYGDATRMDLLESAGAAKAEVLINAIDDPQT  476 (615)
T ss_pred             CCEEEEECCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEE---EEECCCCHHHHHHCCCCCCCEEEEEECCHHH
T ss_conf             9989990280469999999978998799979999999999679908---9768999999986791406889999498999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC
Q ss_conf             999999997207899899967986578999999999847994306754
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV  129 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV  129 (475)
                      ...++.-+-..-..=.|+.-.-+      ++...++.+.|+..+=...
T Consensus       477 ~~~iv~~~r~~~P~l~IiaRard------~~~~~~L~~~Ga~~vv~Et  518 (615)
T PRK03562        477 NLQLTELVKEHFPHLQIIARARD------VDHYIRLRQAGVEKPERET  518 (615)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECC------HHHHHHHHHCCCCEEECCH
T ss_conf             99999999975899869998397------7889999978999896665


No 136
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=97.34  E-value=0.018  Score=37.76  Aligned_cols=117  Identities=15%  Similarity=0.260  Sum_probs=85.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEE-CCCHHHH-HHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978985999739989999999712211278403-2898999-8605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIV-TKNLEQM-VEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~-~~s~~e~-v~~l~~pr~Iil~vp~g~~   81 (475)
                      .+|=++|.|..|+.+++.|.++|+++.+-|.|++.++.+.+.|...   ..+ +.+++=+ ....+++|.+++++++.+.
T Consensus       401 ~~VII~G~GR~Gq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v---~yGDat~~~vL~~AGi~~A~~vViai~d~~~  477 (602)
T PRK03659        401 PQVIIVGFGRFGQVIGRLLMANKMRITVLERDISAVNLMRKYGYKV---YYGDATQLELLRAAGAEKAEAIVITCNEPED  477 (602)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEE---EEECCCCHHHHHHCCCCCCCEEEEEECCHHH
T ss_conf             9989978875689999999978999899978679999999789908---9758999999986790405889998298999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC
Q ss_conf             999999997207899899967986578999999999847994306754
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV  129 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV  129 (475)
                      ...+++.+...-..=.|++-.-+      ++...++.+.|+..+=...
T Consensus       478 ~~~iv~~~r~~~P~l~I~aRar~------~~~~~~L~~~Ga~~vv~Et  519 (602)
T PRK03659        478 TMKLVELCQQHFPHLHILARARG------RVEAHELLQAGVTQFSRET  519 (602)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECC------HHHHHHHHHCCCCEEECCH
T ss_conf             99999999987869969998697------8999999978999786627


No 137
>KOG2304 consensus
Probab=97.31  E-value=0.0036  Score=42.94  Aligned_cols=198  Identities=17%  Similarity=0.241  Sum_probs=103.4

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC----CC--CCCEECCCHHHHHHH-CCC---CCEE
Q ss_conf             8805698157111688999997898599973998999999971221----12--784032898999860-577---8899
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG----LS--QKVIVTKNLEQMVEA-VCK---PRKI   72 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~----~~--~~~~~~~s~~e~v~~-l~~---pr~I   72 (475)
                      ..+|++||-|.||+++|.--+..|++|.++|++.++..+..+.-+.    ..  +........+||++. +++   .--+
T Consensus        11 ~~~V~ivGaG~MGSGIAQv~a~sg~~V~l~d~~~~aL~~A~~~I~~sl~rvakKk~~~~~~~~~e~v~~~l~ri~~~tnv   90 (298)
T KOG2304          11 IKNVAIVGAGQMGSGIAQVAATSGLNVWLVDANEDALSRATKAISSSLKRVAKKKKADDPVALEEFVDDTLDRIKTSTNV   90 (298)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCH
T ss_conf             66247875664320399998851994698547778999999999999999986213677156788999999999871777


Q ss_pred             EEECC-CHHHHHHHHH------HHH---HCCCCCCEEEECCCCCHHHHHHHHH---HHHHCCCCEECC-CCCCCCCCCCC
Q ss_conf             99769-9069999999------997---2078998999679865789999999---998479943067-54676000356
Q gi|254780716|r   73 LMMVT-DGDPVDQLID------KLK---PLLSPEDILLDGGNSHFCDTQIRSL---QLSEKGIYFIGI-GVSGGVKGARS  138 (475)
Q Consensus        73 il~vp-~g~~v~~vi~------~l~---~~l~~g~iiID~sts~~~~t~~~~~---~l~~kgi~fid~-pVSGG~~gA~~  138 (475)
                      =..+. ++-+++.+++      +|.   ....+.+.++-.-||+..-+.-...   .-.=.|.||... ||--=.+--+.
T Consensus        91 ~~~v~dadliiEAivEn~diK~~lF~~l~~~ak~~~il~tNTSSl~lt~ia~~~~~~srf~GlHFfNPvPvMKLvEVir~  170 (298)
T KOG2304          91 SDAVSDADLIIEAIVENLDIKRKLFKDLDKIAKSSTILATNTSSLSLTDIASATQRPSRFAGLHFFNPVPVMKLVEVIRT  170 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEHHHHHHHCCCHHHHCEEECCCCCHHHHHHHHHCC
T ss_conf             77642367999999874778999999998446656288625652459987763258345011113587106778666447


Q ss_pred             CCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             84378845489998889999987501567861898569874678988776787888999899999999642899789999
Q gi|254780716|r  139 GASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISH  218 (475)
Q Consensus       139 G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~  218 (475)
                      ..     -++++|+.+..+=+++....       .+-+.-.|    -|.|-+   .|--+-|++.++.++ .-+-++|-.
T Consensus       171 ~~-----TS~eTf~~l~~f~k~~gKtt-------VackDtpG----FIVNRl---LiPyl~ea~r~yerG-dAskeDIDt  230 (298)
T KOG2304         171 DD-----TSDETFNALVDFGKAVGKTT-------VACKDTPG----FIVNRL---LIPYLMEAIRMYERG-DASKEDIDT  230 (298)
T ss_pred             CC-----CCHHHHHHHHHHHHHHCCCC-------EEECCCCC----HHHHHH---HHHHHHHHHHHHHHC-CCCHHHHHH
T ss_conf             88-----88899999999999857770-------32058874----114577---899999999999816-770766889


Q ss_pred             HH
Q ss_conf             99
Q gi|254780716|r  219 LF  220 (475)
Q Consensus       219 vf  220 (475)
                      -+
T Consensus       231 aM  232 (298)
T KOG2304         231 AM  232 (298)
T ss_pred             HH
T ss_conf             98


No 138
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain. This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Probab=97.29  E-value=0.0026  Score=43.94  Aligned_cols=84  Identities=14%  Similarity=0.145  Sum_probs=47.3

Q ss_pred             CHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCC
Q ss_conf             98999860577889999769906999999999720789989996798657899999999984799430675467600035
Q gi|254780716|r   58 NLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGAR  137 (475)
Q Consensus        58 s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~  137 (475)
                      +.+|+++.++..+.+++.... +...++++.+ |.|   ++|.-.| ..+. .... +.++++||...-+|-.....-|+
T Consensus        29 ~~eel~~~~~~~d~li~~~~~-~i~~e~l~~~-~~L---K~I~~~~-~G~D-~ID~-~~a~~~gI~V~n~p~~~~~aVAE  100 (313)
T pfam00389        29 LTEELLEAAKDADALIVRSTT-PVTAEVLEAA-PGL---KVIARRG-VGVD-NIDL-DAATERGILVTNVPGYSTESVAE  100 (313)
T ss_pred             CHHHHHHHHCCCCEEEECCCC-CCCHHHHHCC-CCC---EEEEECC-CCCC-HHHH-HHHHHCCCEEEECCCCCCHHHHH
T ss_conf             989999983898299985899-7689999449-998---4999888-4455-3059-99997999999899877289999


Q ss_pred             CCCEEEEECCHH
Q ss_conf             684378845489
Q gi|254780716|r  138 SGASLMVGGNEK  149 (475)
Q Consensus       138 ~G~slMvGG~~~  149 (475)
                      ...++|..=.+.
T Consensus       101 ~~i~l~L~l~R~  112 (313)
T pfam00389       101 LTVGLILALARR  112 (313)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999997123


No 139
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=97.28  E-value=0.0097  Score=39.75  Aligned_cols=114  Identities=16%  Similarity=0.185  Sum_probs=67.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHHH
Q ss_conf             805698157111688999997898599973998999999971221127840328989998605778899997--699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~~   81 (475)
                      .+|+++|+|.=|.+.|+-|.+.|++|.++|.++....++.+.+...   +......    +.+...+.|+.+  ||...+
T Consensus        13 k~V~V~GlG~sG~a~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~~---~~~~~~~----~~~~~~d~vV~SPGI~~~~p   85 (487)
T PRK03369         13 APVLVAGAGVTGRAVLAALTRFGARPTVCDDDPDALRPHAERGVAT---VSSSDAV----QQIADYALVVTSPGFPPTAP   85 (487)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCCE---ECCCCCH----HHHCCCCEEEECCCCCCCCH
T ss_conf             9899991568389999999978697999989825779998659948---6376226----56467788998995799899


Q ss_pred             -HHHHHH---------HHHHCC-------CCCC-EEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             -999999---------997207-------8998-999679865789999999998479943
Q gi|254780716|r   82 -VDQLID---------KLKPLL-------SPED-ILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        82 -v~~vi~---------~l~~~l-------~~g~-iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                       +....+         +|.-.+       .+.. |-|-+||---..|.-.+..|+..|..-
T Consensus        86 ~l~~a~~~gi~i~~eieL~~~~~~~~~~~~~~~~IaVTGTnGKTTttsli~~iL~~~g~~~  146 (487)
T PRK03369         86 VLAAAAAAGVPIWGDVELAWRLDAAGCYGPPRRWLVVTGTNGKTTTTSMLHAMLRAAGRRS  146 (487)
T ss_pred             HHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             9999998899076599999998744433676655999798872789999999998589985


No 140
>PRK07589 ornithine cyclodeaminase; Validated
Probab=97.24  E-value=0.0019  Score=44.99  Aligned_cols=116  Identities=12%  Similarity=0.187  Sum_probs=75.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHH--CCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             805698157111688999997--898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD--KGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~--~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+|+||-|......+.-+..  .--+|.+|||++++.++|.++-...+-.+..+.+++|.+...+   +|.++-+ .+.
T Consensus       130 ~~l~iIGtG~QA~~Q~~A~~~vr~i~~V~v~~r~~~~a~~~a~~l~~~g~~v~~~~s~~eAv~~AD---IIvTaT~-s~~  205 (346)
T PRK07589        130 RTMALIGNGAQSEFQALAFKALLGIEEIRLYDIDPAATAKLARNLAGPGLRIVRCRSVAEAVEGAD---IITTVTA-DKA  205 (346)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHCCC---EEEEECC-CCC
T ss_conf             769997470889999999998589868999828879999999998726980899499999972198---8887114-778


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             999999997207899899967986578999999999847994306
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      ..-++.+  ..++||.-|--.|.-.|. .+++...+-.+.--|+|
T Consensus       206 ~~Pil~~--~~v~pGtHInaVGad~Pg-k~ELd~~ll~rA~V~VD  247 (346)
T PRK07589        206 NATILTP--DMIEPGMHINAVGGDCPG-KTELHADILRRARVFVE  247 (346)
T ss_pred             CCCCCCH--HHCCCCCEEEEECCCCCC-CCCCCHHHHHHCCEECC
T ss_conf             8860238--775999579852799998-53079999951977417


No 141
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.
Probab=97.23  E-value=0.0023  Score=44.39  Aligned_cols=123  Identities=17%  Similarity=0.245  Sum_probs=75.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCC-CC-CCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898-599973998999999971221-12-7840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISG-LS-QKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~-~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|.+||+|-.|..+|.+|+..|. ++.++|.+.=....+..+.-. .. -+..-+...++....+. |.+-+...+..-.
T Consensus         1 kVlivG~GglG~~va~~L~~~Gv~~i~ivD~D~v~~~Nl~Rq~~~~~~dvG~~Ka~~a~~~l~~~n-p~v~i~~~~~~~~   79 (143)
T cd01483           1 RVLLVGLGGLGSEIALNLARSGVGKITLIDFDTVELSNLNRQFLARQADIGKPKAEVAARRLNELN-PGVNVTAVPEGIS   79 (143)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHC-CCCEEEEEECCCC
T ss_conf             999999798999999999993797199997898750014642258988949224899999998568-9838999945689


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             9999999972078998999679865789999999998479943067546760
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                       ++..   ...+++-|++||+... +.......+.+.+.++-|+++++.|..
T Consensus        80 -~~~~---~~~~~~~dvvi~~~D~-~~~r~~l~~~~~~~~ip~i~~~~~g~~  126 (143)
T cd01483          80 -EDNL---DDFLDGVDLVIDAIDN-IAVRRALNRACKELGIPVIDAGGLGLG  126 (143)
T ss_pred             -HHHH---HHHHCCCCEEEECCCC-HHHHHHHHHHHHHCCCCEEEEECCCCE
T ss_conf             -6469---9997599999987799-999999999999869988996366768


No 142
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism]
Probab=97.23  E-value=0.018  Score=37.77  Aligned_cols=118  Identities=17%  Similarity=0.275  Sum_probs=74.7

Q ss_pred             EEEEEECCHHHHHHHHHHHH-CCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997-89859-99739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILD-KGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~-~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .||+||-|.||..|+..+++ .|++| .+-||+.+++++..+........+....+.....++++.-++.++   ++  .
T Consensus        19 RVGlIGAG~mG~~ivtQi~~m~Gm~vvaisd~~~~~ak~A~~~ag~~~~~~~e~~~~s~~a~Ai~aGKi~vT---~D--~   93 (438)
T COG4091          19 RVGLIGAGEMGTGIVTQIASMPGMEVVAISDRNLDAAKRAYDRAGGPKIEAVEADDASKMADAIEAGKIAVT---DD--A   93 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCEEEE---CC--H
T ss_conf             998754541106799987506883699984246427889998735872000011116678899862867982---65--3


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH--HHHHHCCCCEE--CCCCCCCC
Q ss_conf             99999997207899899967986578999999--99984799430--67546760
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS--LQLSEKGIYFI--GIGVSGGV  133 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~--~~l~~kgi~fi--d~pVSGG~  133 (475)
                      +     ++-....-|+|||.+ ..|.---+..  ..+..|-+-++  ++-|.=||
T Consensus        94 ~-----~i~~~~~IdvIIdAT-G~p~vGA~~~l~Ai~h~KHlVMmNVEaDvtIGp  142 (438)
T COG4091          94 E-----LIIANDLIDVIIDAT-GVPEVGAKIALEAILHGKHLVMMNVEADVTIGP  142 (438)
T ss_pred             H-----HHHCCCCCEEEEECC-CCCCHHHHHHHHHHHCCCEEEEEEEEECEEECH
T ss_conf             5-----432388604999767-885301475799985677289997540325348


No 143
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=97.22  E-value=0.0018  Score=45.10  Aligned_cols=118  Identities=14%  Similarity=0.195  Sum_probs=77.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8805698157111688999997898-599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+|-++|-|-.+++++.-|.+.|. +++++||++++.+.+.+.......... .   .+....+..+++|+=+.|.|-.
T Consensus        19 ~k~vlIlGaGGaarai~~aL~~~g~~~I~i~nR~~~r~~~l~~~~~~~~~~~~-~---~~~~~~~~~~dliIN~tp~G~~   94 (155)
T cd01065          19 GKKVLILGAGGAARAVAYALAELGAAKIVIVNRTLEKAKALAERFGELGIAIA-Y---LDLEELLAEADLIINTTPVGMK   94 (155)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEE-E---CCHHHHHCCCCEEEECCCCCCC
T ss_conf             99999986758999999999971998228860899999999998501366401-0---4534431568879876778777


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             999999997207899899967986578999999999847994306
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      -..-..--...+.++.+++|.--.. ..| ...+.++++|..+++
T Consensus        95 ~~~~~p~~~~~~~~~~~~~D~iY~P-~~T-~ll~~a~~~g~~~i~  137 (155)
T cd01065          95 PGDELPLPPSLLKPGGVVYDVVYNP-LET-PLLKEARALGAKTID  137 (155)
T ss_pred             CCCCCCCCHHHCCCCCEEEECCCCC-CCC-HHHHHHHHCCCEEEC
T ss_conf             8776767887759986898653178-788-999999998395877


No 144
>PRK08643 acetoin reductase; Validated
Probab=97.19  E-value=0.0077  Score=40.47  Aligned_cols=85  Identities=15%  Similarity=0.317  Sum_probs=64.6

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698--157111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+|  +.+|  |-+-||..+|+.|++.|++|.+.|++.++.+++.++......+..                .+-.-+.+
T Consensus         1 mnK--valVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~----------------~~~~Dvt~   62 (256)
T PRK08643          1 MSK--VALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAI----------------AVKADVSN   62 (256)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCC
T ss_conf             984--999957578899999999998799999996988999999999985399099----------------99805899


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++..++.......+=|++|...
T Consensus        63 ~~~v~~~~~~~~~~~G~iDiLVNnA   87 (256)
T PRK08643         63 RDQVFDAVQQVVDTFGDLNVVVNNA   87 (256)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999829987999899


No 145
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional
Probab=97.17  E-value=0.0007  Score=48.15  Aligned_cols=81  Identities=20%  Similarity=0.371  Sum_probs=56.9

Q ss_pred             CEEEEEECCHHHHHHHH--HHHHCCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             80569815711168899--999789859-997399899999997122112784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSL--NILDKGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~--nL~~~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      .++.+||.|++|++++.  .+.+.||++ .+||.+|+++-.-+     .+-.+...+++++++... ..++-+++||+. 
T Consensus        85 ~~v~lvGaGnLG~AL~~y~gf~~~gf~Iva~FD~dp~kiG~~i-----~gi~V~~i~~L~~~i~~~-~i~iaIiaVP~~-  157 (211)
T PRK05472         85 TNVALVGAGNLGRALLNYNGFKKRGFKIVAAFDVDPEKVGTKI-----GGIPVYHIDELEEVIKEN-DIEIAILTVPAE-  157 (211)
T ss_pred             CEEEEECCCHHHHHHHHCCCHHHCCCEEEEEECCCHHHCCCEE-----CCEEEECHHHHHHHHHHH-CCCEEEEECCHH-
T ss_conf             5089988877999998487623189789999748978859883-----883873499999999981-993899955768-


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999972
Q gi|254780716|r   81 PVDQLIDKLKP   91 (475)
Q Consensus        81 ~v~~vi~~l~~   91 (475)
                      +..+|.+.|..
T Consensus       158 ~AQ~vad~Lv~  168 (211)
T PRK05472        158 AAQEVADRLVE  168 (211)
T ss_pred             HHHHHHHHHHH
T ss_conf             89999999998


No 146
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=97.17  E-value=0.01  Score=39.66  Aligned_cols=115  Identities=14%  Similarity=0.204  Sum_probs=66.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH-H----HHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--
Q ss_conf             88056981571116889999978985999739989-9----9999971221127840328989998605778899997--
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-L----TDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--   75 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~-~----~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--   75 (475)
                      ..+|+|+|+|.=|.+.|+-|.+.|++|.+||.... .    ++.+.+.+-    .+..-...   .+.++..++|+.+  
T Consensus        14 ~kkv~i~GlG~sG~a~a~~L~~~g~~v~~~D~~~~~~~~~~~~~l~~~gi----~~~~g~~~---~~~~~~~d~vv~SPg   86 (458)
T PRK01710         14 NKKVAVVGIGVSNIPLIKFLVKLGAKVTAFDKKSEEELGEISLELKEKGV----NLELGENY---LDKLTGFDVIFKTPS   86 (458)
T ss_pred             CCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCC----EEEECCCH---HHHCCCCCEEEECCC
T ss_conf             99699997878899999999978897999989884314899999985799----89957840---542378888998998


Q ss_pred             CC-CHHHHHHHHH---------HHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             69-9069999999---------997207899899-9679865789999999998479943
Q gi|254780716|r   76 VT-DGDPVDQLID---------KLKPLLSPEDIL-LDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        76 vp-~g~~v~~vi~---------~l~~~l~~g~ii-ID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      +| +.+.+....+         ++.-.+.++.+| |-+||---..|.-++..|+..|..-
T Consensus        87 I~~~~p~~~~a~~~gi~v~~e~el~~~~~~~~~IaVTGTnGKTTTtsmi~~iL~~~g~~~  146 (458)
T PRK01710         87 MRIDSPELVKAKEEGAYITSEMEEFIKYCPAKVFGITGSDGKTTTTTLIYEMLKEEGYKT  146 (458)
T ss_pred             CCCCCHHHHHHHHCCCCEECHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             799899999999879937409999986375877999368984789999999999849975


No 147
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=97.16  E-value=0.0028  Score=43.69  Aligned_cols=89  Identities=18%  Similarity=0.299  Sum_probs=64.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH---HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             8056981571116889999978985999739989---9999997122112784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE---LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~---~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      .+|.+||.|.-|.+-|+||.+.|.+|++-=|..+   +.+.+.+.   ...++ .+.+++|++..   .++|+...|+ +
T Consensus        38 KkI~IiG~GsQG~aqaLNlRDSGldV~~~LR~~si~~k~~Sw~~A---~~~Gf-~V~t~eeai~~---ADvV~~LtPD-~  109 (489)
T PRK05225         38 KKIVIVGCGAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKA---TENGF-KVGTYEELIPQ---ADLVVNLTPD-K  109 (489)
T ss_pred             CEEEEECCCHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHH---HHCCC-CCCCHHHHHHC---CCEEEEECCC-C
T ss_conf             859998036587776524410588569995553033416679999---97799-64678997323---5878870885-5


Q ss_pred             HHHHHHHHHHHCCCCCCEEE
Q ss_conf             99999999972078998999
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILL  100 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiI  100 (475)
                      +-..|++.+.|++++|.++.
T Consensus       110 q~~~v~~~i~p~mk~g~~L~  129 (489)
T PRK05225        110 QHSDVVRAVQPLMKQGAALG  129 (489)
T ss_pred             CHHHHHHHHHHHHCCCCEEE
T ss_conf             14899999987612677211


No 148
>pfam00899 ThiF ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family.
Probab=97.16  E-value=0.0049  Score=41.95  Aligned_cols=124  Identities=18%  Similarity=0.224  Sum_probs=75.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC-CCC-CCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997898-59997399899999997122-112-784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS-GLS-QKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~-~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ++|.+||+|-.|..+|.+|++.|. ++.+.|.+.=....+..+.- ... -+-.-+...++.+..+. |.+-+...+.. 
T Consensus         2 skVlivG~GglG~~~~~~La~~Gvg~i~lvD~D~ve~sNL~Rq~l~~~~diG~~Ka~~~~~~l~~~n-p~~~i~~~~~~-   79 (134)
T pfam00899         2 SRVLVVGAGGLGSPAAEYLARAGVGKLTLVDFDTVELSNLNRQILFTESDIGKPKAEVAKERLRAIN-PDVEVEAYPER-   79 (134)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEECCHHHCCCEEHHHHHHHHHHHC-CCCEEEEEECC-
T ss_conf             8899989888999999999993897499998956763222722423364668810799999999778-99589999256-


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             99999999972078998999679865789999999998479943067546760
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      ...+   .+...++.-|+|||+.- ++..-....+.|.+.++-|+.+++.|-.
T Consensus        80 i~~~---~~~~~~~~~DvVi~~~D-n~~~r~~ln~~c~~~~ip~i~~~~~g~~  128 (134)
T pfam00899        80 LTPE---NLEELLKGADLVVDALD-NFAARYLLNDACVKRGIPLISAGALGFD  128 (134)
T ss_pred             CCHH---HHHHCCCCCCEEEECCC-CHHHHHHHHHHHHHCCCCEEEEECCCCE
T ss_conf             7977---87642644889999989-9999999999999859989995546788


No 149
>PRK06199 ornithine cyclodeaminase; Validated
Probab=97.12  E-value=0.0023  Score=44.34  Aligned_cols=95  Identities=16%  Similarity=0.281  Sum_probs=62.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHC--C-CEEEEEECCHHHHHHHHHHCCCC---CCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             8056981571116889999978--9-85999739989999999712211---2784032898999860577889999769
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDK--G-FRLAVYNKDFELTDVFIKKISGL---SQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~--G-~~V~vydr~~~~~~~l~~~~~~~---~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      ..+|+||.|.++..-.+-+...  . -+|.+|||++++++.|+++....   ...+..+.++++.+...+   +|+++-.
T Consensus       156 ~~lgiIG~G~qAr~~l~Al~~vrp~i~~V~V~~r~~~~a~~fa~~~~~~~~~~~~v~~~~s~eeav~~aD---IVvtaTs  232 (379)
T PRK06199        156 KVVGLVGPGVMGKTIVAAFMAVCPGIDTIKIKGRSQKSLDAFATWVAETYPQITEVVVVDSEEEVVRGSD---IVTYCTS  232 (379)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHCCC---EEEECCC
T ss_conf             7899989639999999999986178888999889999999999999976688850898299999973799---9997777


Q ss_pred             CHH---HHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             906---99999999972078998999679
Q gi|254780716|r   78 DGD---PVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~---~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ...   ...-++.  ...++||..|+-.|
T Consensus       233 ~~~~~ps~~P~~~--~~wlkpGahv~~~g  259 (379)
T PRK06199        233 GEAGDPSAYPYVK--REWVKPGAFLLMPA  259 (379)
T ss_pred             CCCCCCCCCCEEC--HHHCCCCCEEECCC
T ss_conf             8877777784745--99959998894556


No 150
>PRK06046 alanine dehydrogenase; Validated
Probab=97.12  E-value=0.005  Score=41.88  Aligned_cols=114  Identities=17%  Similarity=0.223  Sum_probs=77.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             8056981571116889999978--985999739989999999712211-2784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDK--GFRLAVYNKDFELTDVFIKKISGL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~--G~~V~vydr~~~~~~~l~~~~~~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..+|+||.|.++...++-+..-  =-+|.+|||++++.++|.++.... .-.+..+.++++.++    .++|+++-++.+
T Consensus       130 ~~l~iiG~G~Qa~~~~~al~~v~~i~~i~v~~r~~~~~~~fa~~~~~~~~~~v~~~~~~~~~~~----aDiI~taT~s~~  205 (326)
T PRK06046        130 KVIGIIGAGNQARTQLEALSRVFDLEEVRVYDRTKESCEKFISEMSDFVPCEIVYEEDVEEACD----CDILVTTTPSRK  205 (326)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEECCCHHHHHC----CCEEEEEECCCC
T ss_conf             5589965708899999999973897789999189999999999998655986597399999827----999999828998


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             99999999972078998999679865789999999998479943067
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ++   ++  ...++||..|+-.|...|. .+++...+-.+.--|+|-
T Consensus       206 P~---~~--~~~l~pG~hi~~iG~~~p~-~~Eld~~~l~~a~v~vD~  246 (326)
T PRK06046        206 PV---VK--ADWVKEGTHINAIGADAPG-KQELDPELLKRAKVFVDD  246 (326)
T ss_pred             CE---EC--CCCCCCCCEEEECCCCCCC-HHCCCHHHHHCCCEEEEC
T ss_conf             45---14--4335787177412689866-100799999509889956


No 151
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=97.11  E-value=0.033  Score=35.83  Aligned_cols=111  Identities=14%  Similarity=0.230  Sum_probs=69.4

Q ss_pred             EEEEEECCHHHH-HHHHHHHHCCCEEEEEECCHHH-HHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCH-
Q ss_conf             056981571116-8899999789859997399899-9999971221127840328989998605778899997--6990-
Q gi|254780716|r    5 DIGIIGLGSMGS-NLSLNILDKGFRLAVYNKDFEL-TDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDG-   79 (475)
Q Consensus         5 ~IGiIGLG~MG~-~mA~nL~~~G~~V~vydr~~~~-~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g-   79 (475)
                      +|=|||+|-.|- ++|+-|.++|++|+++|+.... ++.+.+.|-....   + .+++    .++.++.|+.+  +|.. 
T Consensus        10 ~ih~iGigG~GmsalA~~l~~~G~~V~gsD~~~~~~~~~L~~~Gi~v~~---g-~~~~----~l~~~d~vV~Sp~I~~~~   81 (459)
T PRK00421         10 RIHFVGIGGIGMSGLAEVLLNLGYKVSGSDLKESAVTQRLLELGAIIFI---G-HDAE----NIKGADVVVVSSAIKPDN   81 (459)
T ss_pred             EEEEEEECHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCEEEC---C-CCHH----HCCCCCEEEECCCCCCCC
T ss_conf             8999986688899999999968993999889899789999978799977---9-8979----879999999899859989


Q ss_pred             HHHHHHHH---------HHH-HCCCCCC-EEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             69999999---------997-2078998-99967986578999999999847994
Q gi|254780716|r   80 DPVDQLID---------KLK-PLLSPED-ILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        80 ~~v~~vi~---------~l~-~~l~~g~-iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      +.+....+         +++ ..++... |-|-+||---..|.-.+..++..|..
T Consensus        82 p~~~~a~~~gi~v~~~~e~l~~~~~~~~~IaVtGTnGKTTtT~ll~~il~~~g~~  136 (459)
T PRK00421         82 PELVAARELGIPVVRRAEMLAELMRLRTSIAVAGTHGKTTTTSLLAHVLAEAGLD  136 (459)
T ss_pred             HHHHHHHHCCCCEEEHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             9999999879979889999999982596499977888611899999999976998


No 152
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=97.08  E-value=0.0096  Score=39.79  Aligned_cols=116  Identities=15%  Similarity=0.152  Sum_probs=65.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHHH
Q ss_conf             805698157111688999997898599973998999999971221127840328989998605778899997--699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~~   81 (475)
                      .+|.|+|+|.-|.+.|+-|.+.|++|.+||.+++...++.+++-..       .++.+.  .....+.|+.+  +|...+
T Consensus        10 k~v~v~GlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~g~~~-------~~~~~~--~~~~~~~iV~SPGIp~~~p   80 (457)
T PRK01390         10 KTVALFGLGGSGLATARALKAGGAEVIAWDDNPDSVAKAAAAGIAT-------ADLRTA--DWSQFAALVLSPGVPLTHP   80 (457)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCCC-------CCCCCC--CCCCCCEEEECCCCCCCCC
T ss_conf             9899994369999999999978997999939920668998759831-------455412--3203878999998886566


Q ss_pred             -----HHHHHH---------HHH-----HCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             -----999999---------997-----207899899-96798657899999999984799430675
Q gi|254780716|r   82 -----VDQLID---------KLK-----PLLSPEDIL-LDGGNSHFCDTQIRSLQLSEKGIYFIGIG  128 (475)
Q Consensus        82 -----v~~vi~---------~l~-----~~l~~g~ii-ID~sts~~~~t~~~~~~l~~kgi~fid~p  128 (475)
                           +...-+         +|.     .......+| |-+||---..|.-.+..|+..|....-+|
T Consensus        81 ~~~~~v~~a~~~gi~v~seielf~~~~~~~~~~~~iIaVTGTnGKTTTtsli~~iL~~~g~~~~~gG  147 (457)
T PRK01390         81 KPHWTVDLARAAGVEVIGDIELFCRERRAHAPDAPFIAITGTNGKSTTTALIAHLLRQAGRDVQMGG  147 (457)
T ss_pred             CCHHHHHHHHHCCCEEEEHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             7319999999859918600899999987325789889992899649899999999997399869966


No 153
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]
Probab=97.08  E-value=0.016  Score=38.12  Aligned_cols=111  Identities=17%  Similarity=0.274  Sum_probs=65.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHC--CCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             056981571116889999978--985-99973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDK--GFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~--G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +||+||.|..|..+..-+.+.  .++ +.+|||+.++++++.+-..     ...+.++.|++   +.+++++-+- +.++
T Consensus         2 ~vgiVGcGaIG~~l~e~v~~~~~~~e~v~v~D~~~ek~~~~~~~~~-----~~~~s~ide~~---~~~DlvVEaA-S~~A   72 (255)
T COG1712           2 KVGIVGCGAIGKFLLELVRDGRVDFELVAVYDRDEEKAKELEASVG-----RRCVSDIDELI---AEVDLVVEAA-SPEA   72 (255)
T ss_pred             EEEEEECCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCC-----CCCCCCHHHHH---HCCCEEEEEC-CHHH
T ss_conf             5789823378899999986688643699994488788888886038-----87635677773---0244254307-8899


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHH--HHHHHHHHHHHCCCCEECC
Q ss_conf             999999997207899899967986578--9999999998479943067
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFC--DTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~--~t~~~~~~l~~kgi~fid~  127 (475)
                      |.+...++   |+.|.-+|-+|+.-..  .-..+-..+.+.+-..+-.
T Consensus        73 v~e~~~~~---L~~g~d~iV~SVGALad~~l~erl~~lak~~~~rv~~  117 (255)
T COG1712          73 VREYVPKI---LKAGIDVIVMSVGALADEGLRERLRELAKCGGARVYL  117 (255)
T ss_pred             HHHHHHHH---HHCCCCEEEEECHHCCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             99986999---9659988999512206867999999998538947993


No 154
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homol
Probab=97.07  E-value=0.0023  Score=44.28  Aligned_cols=128  Identities=14%  Similarity=0.200  Sum_probs=78.9

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CC--CCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             98805698157111688999997898-59997399899999997122--11--278403289899986057788999976
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GL--SQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~--~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      .+++|-+||+|-.|.+.+.+|+..|. ++.+.|.+.-...++..+.-  ..  .-+-.-+....+.+..+. |.+-+..+
T Consensus        18 ~~s~VlVvG~GGLG~~v~~~La~aGVg~i~ivD~D~Ve~sNL~RQ~l~~~~~~diG~~Ka~~a~~~l~~lN-p~v~i~~~   96 (198)
T cd01485          18 RSAKVLIIGAGALGAEIAKNLVLAGIDSITIVDHRLVSTEDLGSNFFLDAEVSNSGMNRAAASYEFLQELN-PNVKLSIV   96 (198)
T ss_pred             HHCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHC-CCCEEEEE
T ss_conf             70989998778899999999997499869999599635335775750265411168729999999999779-99779998


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             990699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      ...  +....+.....++.-|+|||++- ++..-....+.|.+.++-|+.+.+.|-.
T Consensus        97 ~~~--~~~~~~n~~~~~~~~DlVvd~~d-n~~~r~~in~~c~~~~iPlI~ga~~G~~  150 (198)
T cd01485          97 EED--SLSNDSNIEEYLQKFTLVIATEE-NYERTAKVNDVCRKHHIPFISCATYGLI  150 (198)
T ss_pred             ECC--CCCCHHHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCCCE
T ss_conf             224--45778689999848999999999-9999999999999929988999745668


No 155
>PRK08328 hypothetical protein; Provisional
Probab=97.05  E-value=0.0026  Score=44.01  Aligned_cols=125  Identities=14%  Similarity=0.230  Sum_probs=75.0

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC----CCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             98805698157111688999997898-59997399899999997122----11278403289899986057788999976
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS----GLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~----~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      ++++|.+||+|-.|.+.|.+|+..|. ++.+.|.+.-....+..+--    ..+.. ..+...++-...++ |.+-+..+
T Consensus        26 ~~s~VlvvG~GGlGs~~~~~La~~GvG~i~lvD~D~ve~SNLnRQil~~~~diG~~-~K~~~a~~~l~~iN-p~v~i~~~  103 (230)
T PRK08328         26 KKAKVAVVGVGGLGSPVAYYLAAAGVGTVLLIDEQTPELSNLNRQILHWEEDVGKN-PKPISAKWKLERFN-SDIKIETF  103 (230)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCEEECCCCHHHHHCCHHHHCCC-CHHHHHHHHHHHHC-CCEEEEHH
T ss_conf             55978998878789999999998489868987487875156325540308774771-03999999999759-95057526


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             990699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      +. ....   +.+...++.-|+||||+-. +..-.-..+.|.++++-|+.++++|..
T Consensus       104 ~~-~i~~---~n~~~ll~~~DlViD~tDn-~~tr~~ln~~c~~~~iPlI~g~v~g~~  155 (230)
T PRK08328        104 VG-RLTE---ENIDEVLKGVDVIVDCLDN-FETRYLLDDYAHKKGIPLVHGAVEGMY  155 (230)
T ss_pred             HH-HHHH---HHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHCCCCEEEEEEECCE
T ss_conf             64-4237---7798620059899998899-899999999999839977999966179


No 156
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=97.05  E-value=0.023  Score=36.97  Aligned_cols=115  Identities=15%  Similarity=0.165  Sum_probs=66.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH----HHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CC
Q ss_conf             805698157111688999997898599973998----999999971221127840328989998605778899997--69
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF----ELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VT   77 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~----~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp   77 (475)
                      .+|.|+|+|.-|.+.|+-|.++|++|.++|..+    ...+.+.+++..    +..-..+.+...  +..++|+.+  +|
T Consensus        10 k~i~viGlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~l~~~gi~----~~~g~~~~~~~~--~~~d~vV~SPgI~   83 (450)
T PRK02472         10 KKVLVLGLAKSGYAAAKLLHKLGANVTVNDGKPFSENPAAQELLEEGIK----VICGSHPLELLD--ENFDLMVKNPGIP   83 (450)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCE----EEECCCHHHHCC--CCCCEEEECCCCC
T ss_conf             9899997789999999999988698999848866579899999967998----997888078605--7887999899879


Q ss_pred             CHHH-HHHHHH---------HHHHCCCCCCEEEECCCCC-HHHHHHHHHHHHHCCCCE
Q ss_conf             9069-999999---------9972078998999679865-789999999998479943
Q gi|254780716|r   78 DGDP-VDQLID---------KLKPLLSPEDILLDGGNSH-FCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        78 ~g~~-v~~vi~---------~l~~~l~~g~iiID~sts~-~~~t~~~~~~l~~kgi~f  124 (475)
                      ...+ +....+         +|.-.+.+..+|--+||.. -..|.-.+..|+..|..-
T Consensus        84 ~~~p~~~~a~~~~i~v~~~~el~~~~~~~~~IaVTGTnGKTTTt~ll~~iL~~~g~~~  141 (450)
T PRK02472         84 YDNPMVEEALEKGIPIITEVELAYLISEAPIIGITGSNGKTTTTTLIAEMLNAGGQHG  141 (450)
T ss_pred             CCCHHHHHHHHCCCCEEEHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             9999999999869967438788887515978998279997319999999999749973


No 157
>PRK07454 short chain dehydrogenase; Provisional
Probab=97.04  E-value=0.018  Score=37.76  Aligned_cols=87  Identities=13%  Similarity=0.263  Sum_probs=63.7

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698--157111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++.++.+|  +-+-+|..+|+.|+++|++|.+.+|+.++.+++.++......++                ..+-.-|.+
T Consensus         3 ~~~mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~----------------~~~~~Dvt~   66 (241)
T PRK07454          3 LNSMPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKV----------------AAYSIDLSN   66 (241)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEEECCC
T ss_conf             8999889991758789999999999879989999899999999999999659928----------------999951899


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.+++.++.+......=|++|...
T Consensus        67 ~~~v~~~~~~~~~~~G~iDiLVnNA   91 (241)
T PRK07454         67 PEAIAPGIAELLEQFGCPSVLINNA   91 (241)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             9999999999999759988999889


No 158
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1. Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.
Probab=96.98  E-value=0.0057  Score=41.45  Aligned_cols=124  Identities=17%  Similarity=0.212  Sum_probs=78.3

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCC--CEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-5999739989999999712211278--40328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQK--VIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~--~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .+++|-+||+|-.|.+.|.||+..|. ++.+.|.+.-...++..+.--..+.  ..-+...++.+..+. |.+-+...+.
T Consensus        20 ~~s~VlvvG~GGLG~~v~~~La~aGvg~i~ivD~d~v~~snL~RQ~l~~~~diG~~Ka~~a~~~l~~lN-p~v~i~~~~~   98 (197)
T cd01492          20 RSARILLIGLKGLGAEIAKNLVLSGIGSLTILDDRTVTEEDLGAQFLIPAEDLGQNRAEASLERLRALN-PRVKVSVDTD   98 (197)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHCCCCEECCCCCCCCCHHHHHHHHHHHHC-CCCEEEEEEC
T ss_conf             609599988788999999999983798699998991877773978603233478885999999999738-9972898704


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCC
Q ss_conf             069999999997207899899967986578999999999847994306754676
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGG  132 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG  132 (475)
                        .+.+.-.   ..++.-|+|||++ -+++.-....+.|.+.|+-|+.+.+.|-
T Consensus        99 --~~~~~~~---~~i~~~D~Vvd~~-dn~~~r~~iN~~c~~~~iplI~g~~~g~  146 (197)
T cd01492          99 --DISEKPE---EFFSQFDVVVATE-LSRAELVKINELCRKLGVKFYATGVHGL  146 (197)
T ss_pred             --CCCHHHH---HHHHCCCEEEECC-CCHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             --5857689---9982899999999-9999999999999981997899981375


No 159
>PTZ00082 L-lactate dehydrogenase; Provisional
Probab=96.98  E-value=0.013  Score=38.78  Aligned_cols=105  Identities=13%  Similarity=0.203  Sum_probs=63.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHH---HCCC---CCCCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             998805698157111688999997898-59997399899999997---1221---1278403289899986057788999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIK---KISG---LSQKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~---~~~~---~~~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      |++.+|++||.|..|..+|.-+...+. ++..||+++++++.-..   ++..   ....+.+..+.++    +...++|+
T Consensus         5 ~~~~KV~IIGaG~VG~~~A~~l~~~~l~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~v~~~~dy~~----~~~aDiVV   80 (322)
T PTZ00082          5 IPRKKISLIGSGNIGGVMAYLIQLKNLADVVLFDIVPNIPAGKALDIMHANVMAGSNCKVIGTNSYDD----IAGSDVVI   80 (322)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEECCCHHH----HCCCCEEE
T ss_conf             17982999896989999999996389977999978898008899987663644688857983799999----77999999


Q ss_pred             EECC--------------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             9769--------------------90699999999972078998999679865789999
Q gi|254780716|r   74 MMVT--------------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        74 l~vp--------------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      +..-                    +.+.+.++...+..+- |+.++|-.+  +|-|..-
T Consensus        81 itAG~~~kpg~t~~~~~R~dLl~~Na~I~~~i~~~i~~~~-p~aiiivvs--NPvDv~t  136 (322)
T PTZ00082         81 VTAGLAKAPGKSDDEWNRDDLLPLNAKIMIEVGENIKKYC-PNAFVIVIT--NPLDVMV  136 (322)
T ss_pred             ECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEECC--CCHHHHH
T ss_conf             8988877899987656788999988999999999987409-983599748--9269999


No 160
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=96.96  E-value=0.011  Score=39.42  Aligned_cols=11  Identities=36%  Similarity=0.652  Sum_probs=5.2

Q ss_pred             EEEECCCCHHH
Q ss_conf             89856987467
Q gi|254780716|r  171 CALLGPDGSGH  181 (475)
Q Consensus       171 v~y~G~~GsGh  181 (475)
                      +.-+|.+|++.
T Consensus       125 vlIlGaGGaar  135 (275)
T PRK00258        125 ILLLGAGGAAR  135 (275)
T ss_pred             EEEECCCCHHH
T ss_conf             99988871079


No 161
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of eukaryotic LDHs. Vertebrate LDHs are non-allosteric. This is in contrast to some bacterial LDHs that are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.96  E-value=0.044  Score=34.91  Aligned_cols=103  Identities=20%  Similarity=0.263  Sum_probs=63.4

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHH---CCCC--CCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             805698157111688999997898--599973998999999971---2211--278403289899986057788999976
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKK---ISGL--SQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~---~~~~--~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      .+|++||.|..|..+|..|+.+|.  ++..||+++++++.....   ....  ...+....+.+++    ...++|++..
T Consensus         4 ~Kv~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~h~~~~~~~~~v~~~~d~~~~----~~aDvVVitA   79 (312)
T cd05293           4 NKVTVVGVGQVGMACAISILAKGLADELVLVDVVEDKLKGEAMDLQHGSAFLKNPKIEADKDYSVT----ANSKVVIVTA   79 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCHHHH----CCCCEEEECC
T ss_conf             869998978889999999996699887999938898332688886604012798559937999996----8999999889


Q ss_pred             CC---------------HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             99---------------06999999999720789989996798657899999
Q gi|254780716|r   77 TD---------------GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR  113 (475)
Q Consensus        77 p~---------------g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~  113 (475)
                      -.               .+.+.++...+..+. +..++|-.  ++|-|+...
T Consensus        80 G~~~k~g~~R~dLl~~N~~I~~~i~~~i~~~~-p~~ivivv--sNPvDv~t~  128 (312)
T cd05293          80 GARQNEGESRLDLVQRNVDIFKGIIPKLVKYS-PNAILLVV--SNPVDIMTY  128 (312)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEC--CCCHHHHHH
T ss_conf             99999898889999988999999999988419-98469966--891899999


No 162
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.95  E-value=0.022  Score=37.18  Aligned_cols=122  Identities=16%  Similarity=0.205  Sum_probs=69.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCC
Q ss_conf             998805698157111688999997898599973998999999971221127840328989998605778899997--699
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTD   78 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~   78 (475)
                      |-..+|.++|+|.=|.+.|+-|.++|..|.++|.+.+..+.......      ......+++.+.   .+.|+.+  +|.
T Consensus         1 ~~~KkvlV~GlG~SG~s~a~~L~~~g~~v~~~D~~~~~~~~~~~~~~------~~~~~~~~~~~~---~d~vv~SPGi~~   71 (418)
T PRK00683          1 MGLQRVVVLGLGVTGKSVARFLAQKGVYVIGVDNSLEALQSCPYIHE------RYLEGAEEFPEQ---VDLVVRSPGIKP   71 (418)
T ss_pred             CCCCEEEEEEECHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCHHHH------HCCCCHHHCCCC---CCEEEECCCCCC
T ss_conf             99866999808887999999999782989998298145454614555------405623324234---989998998599


Q ss_pred             HHH-HHHHHH-------H--HH---HCCCCCC-EEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCC
Q ss_conf             069-999999-------9--97---2078998-9996798657899999999984799430675467
Q gi|254780716|r   79 GDP-VDQLID-------K--LK---PLLSPED-ILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSG  131 (475)
Q Consensus        79 g~~-v~~vi~-------~--l~---~~l~~g~-iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSG  131 (475)
                      ..+ +.....       +  |.   +.+.+.. |-|-+||.--..|.-.+..+++.|..-.-+|=-|
T Consensus        72 ~~p~~~~a~~~~i~i~seiel~~~~~~~~~~~~IaITGTNGKTTTt~ll~~iL~~~g~~~~~~GNIG  138 (418)
T PRK00683         72 YHPWVEAAVALKIPVVTDIQLAFQTPEFQRYPSLGITGSTGKTTTILFLEHLLRTLGIPAFAMGNIG  138 (418)
T ss_pred             CCHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCEEHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             8899999998699754079999742441479879997689866099999999986799818880346


No 163
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=96.95  E-value=0.013  Score=38.72  Aligned_cols=126  Identities=16%  Similarity=0.150  Sum_probs=72.5

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEEC-CCHHHHHHHCCCCCEEEEE--CCC-H
Q ss_conf             80569815711168899999789859997399899999997122112784032-8989998605778899997--699-0
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVT-KNLEQMVEAVCKPRKILMM--VTD-G   79 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~-~s~~e~v~~l~~pr~Iil~--vp~-g   79 (475)
                      .+|.++|||.=|..+|+.|.+.|..|.++|..+.. +..... ....+++... -+..+  ......++|+.+  +|- .
T Consensus         8 ~kv~V~GLG~sG~a~a~~L~~~G~~v~v~D~~~~~-~~~~~~-~~~~~~i~~~~g~~~~--~~~~~~d~vV~SPGi~~~~   83 (448)
T COG0771           8 KKVLVLGLGKSGLAAARFLLKLGAEVTVSDDRPAP-EGLAAQ-PLLLEGIEVELGSHDD--EDLAEFDLVVKSPGIPPTH   83 (448)
T ss_pred             CEEEEEECCCCCHHHHHHHHHCCCEEEEECCCCCC-CCHHHH-HHHCCCCEEECCCCCH--HCCCCCCEEEECCCCCCCC
T ss_conf             97999926651099999999779869998389876-532344-4420372231376411--0013477899899999988


Q ss_pred             HHHHHHHH---------HHHHCC--CCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             69999999---------997207--8998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLID---------KLKPLL--SPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~---------~l~~~l--~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      +.+.+...         +|.-..  ++--|-|-+||---..|.-++..+++.|....-+|=.|.+
T Consensus        84 p~v~~A~~~gi~i~~dieL~~r~~~~~p~vaITGTNGKTTTTsli~~~l~~~G~~~~lgGNIG~p  148 (448)
T COG0771          84 PLVEAAKAAGIEIIGDIELFYRLSGEAPIVAITGTNGKTTTTSLIAHLLKAAGLDALLGGNIGTP  148 (448)
T ss_pred             HHHHHHHHCCCCEEEHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEECCCCCCC
T ss_conf             89999998699377488889874489998999799962889999999998559983213516713


No 164
>KOG0068 consensus
Probab=96.94  E-value=0.011  Score=39.25  Aligned_cols=105  Identities=17%  Similarity=0.226  Sum_probs=79.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++|++|+|..|+..|+++-.-|..|..||.-....+ ..+      .++ -.-+++|.   +.+.+.|-+-+|..+.++
T Consensus       147 KTLgvlG~GrIGseVA~r~k~~gm~vI~~dpi~~~~~-~~a------~gv-q~vsl~Ei---l~~ADFitlH~PLtP~T~  215 (406)
T KOG0068         147 KTLGVLGLGRIGSEVAVRAKAMGMHVIGYDPITPMAL-AEA------FGV-QLVSLEEI---LPKADFITLHVPLTPSTE  215 (406)
T ss_pred             CEEEEEECCCCHHHHHHHHHHCCCEEEEECCCCCHHH-HHH------CCC-EEEEHHHH---HHHCCEEEECCCCCCCHH
T ss_conf             6788850462118999999865854886068784677-875------165-45409887---755688998167882143


Q ss_pred             HHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             999-999720789989996798657899999999984
Q gi|254780716|r   84 QLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE  119 (475)
Q Consensus        84 ~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~  119 (475)
                      ..+ ++.+..+++|--||.++-...-|...+-+.+++
T Consensus       216 ~lin~~tfA~mKkGVriIN~aRGGvVDe~ALv~Al~s  252 (406)
T KOG0068         216 KLLNDETFAKMKKGVRIINVARGGVVDEPALVRALDS  252 (406)
T ss_pred             HCCCHHHHHHHHCCCEEEEECCCCEECHHHHHHHHHC
T ss_conf             1138789998607858998247752063999988852


No 165
>pfam02629 CoA_binding CoA binding domain. This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.
Probab=96.93  E-value=0.0066  Score=40.99  Aligned_cols=80  Identities=15%  Similarity=0.246  Sum_probs=60.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHH-CCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             8805698157111688999997-89859-997399899999997122112784032898999860577889999769906
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILD-KGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~-~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ..++.+||.|+.|..++.|.-+ .||.+ .+||.+|++.-       ..-.++..+.+++++++.. .+++.+++||+. 
T Consensus         3 ~~~v~liG~g~lG~al~~~~~~~~~~~i~~vfdv~p~~~G-------~~i~gipv~~~l~~~~~~~-~idiaii~VP~~-   73 (96)
T pfam02629         3 DTKVAVIGASGLGIQGLYHFIQLLGYGIKMVFGVNPRKGG-------TEVGGIPVYKSVDELEEDT-GVDVAVITVPAP-   73 (96)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCC-------CEECCEEEECCHHHHHHCC-CCCEEEEEECHH-
T ss_conf             7749999989827888776887714861899806924277-------5888998431087774155-887899994789-


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999972
Q gi|254780716|r   81 PVDQLIDKLKP   91 (475)
Q Consensus        81 ~v~~vi~~l~~   91 (475)
                      .+.++++++..
T Consensus        74 ~a~~~~~~~v~   84 (96)
T pfam02629        74 FAQEAIDELVD   84 (96)
T ss_pred             HHHHHHHHHHH
T ss_conf             98999999998


No 166
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=96.91  E-value=0.0035  Score=42.96  Aligned_cols=12  Identities=33%  Similarity=0.576  Sum_probs=6.3

Q ss_pred             EEEECCCCHHHH
Q ss_conf             898569874678
Q gi|254780716|r  171 CALLGPDGSGHF  182 (475)
Q Consensus       171 v~y~G~~GsGh~  182 (475)
                      +.-+|.+|++.-
T Consensus       130 vlilGaGGaa~a  141 (284)
T PRK12549        130 VVQLGAGGAGAA  141 (284)
T ss_pred             EEEECCCCHHHH
T ss_conf             899656616899


No 167
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramoylalanine-D-glutamate ligase (MurD). MurD catalyses the addition of d-glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-l-alanine. ; GO: 0005524 ATP binding, 0008764 UDP-N-acetylmuramoylalanine-D-glutamate ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=96.89  E-value=0.019  Score=37.53  Aligned_cols=129  Identities=22%  Similarity=0.250  Sum_probs=79.0

Q ss_pred             EEEEEECCHHHH--HHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHH
Q ss_conf             056981571116--88999997898599973998999999971221127840328989998605778899997--69906
Q gi|254780716|r    5 DIGIIGLGSMGS--NLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~--~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~   80 (475)
                      +|.|+|||.=|.  ++|+.|.++|..|.++|..+....+...................+-.......++|+.+  ||-..
T Consensus         1 ~i~i~GlG~tG~G~a~a~~L~~~g~~~~~~D~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~vv~SPGi~~~h   80 (476)
T TIGR01087         1 KILILGLGKTGRGVAVARFLKKKGAEVTVTDDDPEEELERSKGQLKLSEGVVLYTGGKDDLEDLNNADLVVLSPGIPPDH   80 (476)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCEEEEECCCCCCCC
T ss_conf             97899867510789999999972987999984522134311331245564135326753101233420799789898677


Q ss_pred             H-HHHHHH---------HHHHCCC----CCCEE-EECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             9-999999---------9972078----99899-9679865789999999998479943067546760
Q gi|254780716|r   81 P-VDQLID---------KLKPLLS----PEDIL-LDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        81 ~-v~~vi~---------~l~~~l~----~g~ii-ID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      + +.+...         +|.-.+.    +..+| |-|||---..|.-.+..|++.|+..+-||=.|.|
T Consensus        81 p~~~~a~~~g~~v~gdi~L~~~~~~~~~~~~~~aITGTnGKtTTT~L~~~~L~~~G~~a~~gGNIG~p  148 (476)
T TIGR01087        81 PLVQAAAKRGIPVVGDIELALRLVDFPEPAKVVAITGTNGKTTTTSLLYHLLKAAGLKAVLGGNIGTP  148 (476)
T ss_pred             HHHHHHHHCCCEEEEHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCH
T ss_conf             79999996698089867999974157898737999726860799999999998469977862578812


No 168
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=96.85  E-value=0.014  Score=38.46  Aligned_cols=114  Identities=14%  Similarity=0.191  Sum_probs=79.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      |++-++|+|+.|..+|+-|..-|=+|.|.=|+.....+..+.+-    .+...+.+++   .+...|+||=.||+==.+ 
T Consensus       153 S~v~VlGfGRtG~tiAr~f~aLGA~V~V~AR~~~dlARI~E~g~----~P~~~~~L~~---~v~e~DIviNTiPaLvlt-  224 (288)
T TIGR02853       153 SNVMVLGFGRTGMTIARTFSALGARVSVGARSSADLARITEMGL----EPVPLNKLEE---KVAEIDIVINTIPALVLT-  224 (288)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCC----CCCCHHHHHH---HHCCCCEEEECCCCCCCC-
T ss_conf             34578844705689999997269805753178367899999606----8827167887---650002477067630036-


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE-CCCCCC
Q ss_conf             999999720789989996798657899999999984799430-675467
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI-GIGVSG  131 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi-d~pVSG  131 (475)
                         ..++..|.+..+|||..+ .|-=|.=  +.++++|+.-+ -.|.=|
T Consensus       225 ---~~~l~~lp~~AviiDLAS-~PGGtDF--~yAk~~Gi~A~LAPGLPG  267 (288)
T TIGR02853       225 ---KDVLSKLPKHAVIIDLAS-KPGGTDF--EYAKKRGIKALLAPGLPG  267 (288)
T ss_pred             ---HHHHHHCCCCCEEEEECC-CCCCCCH--HHHHHCCCEEEECCCCCC
T ss_conf             ---589952685848997327-8487376--989862982897187878


No 169
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.84  E-value=0.041  Score=35.13  Aligned_cols=118  Identities=13%  Similarity=0.169  Sum_probs=66.6

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCH
Q ss_conf             98805698157111688999997898599973998999999971221127840328989998605778899997--6990
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDG   79 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g   79 (475)
                      ++ +|.++|||.=|.+.|+-|.+.|.+|.+||..........+....  ..+. .....+   .++..+.|+.+  +|..
T Consensus        17 ~~-kvlV~GlG~SG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~--~~~~-~~~~~~---~~~~~d~vV~SPGI~~~   89 (476)
T PRK00141         17 RG-RVLVAGAGVSGLGIAKMLSELGCDVVVADDNETQRHMLIEVVDV--ADIS-TAQASD---ALDSYSIVVTSPGWRPD   89 (476)
T ss_pred             CC-CEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCC--CEEC-CCCHHH---HHCCCCEEEECCCCCCC
T ss_conf             99-88999227889999999997899799998998703578874798--5651-553065---64689999989978997


Q ss_pred             H-HHHHHHH---------HHHHCC-------CCCC-EEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             6-9999999---------997207-------8998-99967986578999999999847994306
Q gi|254780716|r   80 D-PVDQLID---------KLKPLL-------SPED-ILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        80 ~-~v~~vi~---------~l~~~l-------~~g~-iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      . .+.....         ++.-.+       .+.. |-|-+||---..|.-.+..|++.|..-.-
T Consensus        90 ~p~l~~a~~~gi~viseiel~~~~~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~  154 (476)
T PRK00141         90 SPLLVDAQSAGLEVIGDVELAWRLDQAGVFGEPRTWLAVTGTNGKTTTTAMLAAMMQAGGFAAVA  154 (476)
T ss_pred             CHHHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99999999879957719999998611643367776388968996798999999999837997289


No 170
>PRK10206 putative dehydrogenase; Provisional
Probab=96.80  E-value=0.058  Score=34.03  Aligned_cols=114  Identities=11%  Similarity=0.189  Sum_probs=76.8

Q ss_pred             CCCCEEEEEECCHHHHHHHHH-HHH--CCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698157111688999-997--89859997399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLN-ILD--KGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~n-L~~--~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+- ++|+||.|..|...-.- |+.  ..+.|.+..+..++.++..+..    ..+..+.+++|+.+. +..+.|+++.|
T Consensus         1 m~i-rvaiiG~G~~~~~fH~P~i~~~~~~~~v~~v~~~~~~~~~~a~~~----~~~~~~~~~~~ll~~-~~id~V~i~tP   74 (345)
T PRK10206          1 MVI-NCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIY----SHIHFTSDLDEVLND-PDVKLVVVCTH   74 (345)
T ss_pred             CEE-EEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHC----CCCCEECCHHHHHCC-CCCCEEEECCC
T ss_conf             924-799992649999998999963899579999978876188888776----998122899999549-99999998799


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             9069999999997207899899967-986578999999999847994
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDG-GNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~-sts~~~~t~~~~~~l~~kgi~  123 (475)
                      +..+.+-+..-|..+   -.++++= =+.+..+..++.+.++++|+.
T Consensus        75 ~~~H~~~a~~al~aG---khV~~EKP~~~~~~ea~~l~~~a~~~g~~  118 (345)
T PRK10206         75 ADSHFEYAKRALEAG---KNVLVEKPFTPTLAQAKELFALAKSKGLT  118 (345)
T ss_pred             CHHHHHHHHHHHHCC---CCEEEECCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             578999999999789---92898036649899999999999970997


No 171
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating; InterPro: IPR006113   6-Phosphogluconate dehydrogenase (1.1.1.44 from EC) (6PGD) is an oxidative carboxylase that catalyses the decarboxylating reduction of 6-phosphogluconate into ribulose 5-phosphate in the presence of NADP. This reaction is a component of the hexose mono-phosphate shunt and pentose phosphate pathways (PPP) , . Prokaryotic and eukaryotic 6PGD are proteins of about 470 amino acids whose sequence are highly conserved . The protein is a homodimer in which the monomers act independently : each contains a large, mainly alpha-helical domain and a smaller beta-alpha-beta domain, containing a mixed parallel and anti-parallel 6-stranded beta sheet . NADP is bound in a cleft in the small domain, the substrate binding in an adjacent pocket .    This model does not specify whether the cofactor is NADP only, NAD only, or both.; GO: 0004616 phosphogluconate dehydrogenase (decarboxylating) activity, 0050661 NADP binding, 0006098 pentose-phosphate shunt.
Probab=96.80  E-value=0.0024  Score=44.16  Aligned_cols=124  Identities=14%  Similarity=0.253  Sum_probs=88.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHH---HHHHCCCEEEHHHHHHHHHHHHHC-CC-CCCCCCCHH
Q ss_conf             9999999999999999999999996110145667988999---985189468537899999998708-88-520007989
Q gi|254780716|r  320 VKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA---RIWRAGCIIRSQILNDIVKSLTED-PS-STNLLNIPS  394 (475)
Q Consensus       320 i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia---~iW~~GCIIrs~lL~~i~~~~~~~-~~-l~~Ll~~~~  394 (475)
                      ++.+||-+-.+=|=-.++.-.+|+..     .+|...+|+   .-|+. --+.|.|++=.+++|... ++ ...|  .+.
T Consensus       183 VKMVHNGIEYGDMQLI~EAY~~lK~~-----L~L~~~~i~~vF~~WN~-g~L~SYLIeIT~~IL~~kD~~TG~pL--vd~  254 (480)
T TIGR00873       183 VKMVHNGIEYGDMQLIAEAYDILKEG-----LGLSNEEIAEVFTEWNN-GELDSYLIEITADILAKKDEDTGKPL--VDK  254 (480)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHH-----HCCCHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHCCCCCCCCCE--EHH
T ss_conf             53257671177798999999999865-----18888899999855237-77642688999998621350027512--311


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHH-HCCCCCHHHHHHHHHHCCC-CCEEEE
Q ss_conf             999999524769999999998399847999999-99986-2178875899998761045-732242
Q gi|254780716|r  395 ISEKVKKTIPSLRRIVVTCTENGYPVPSLSAAL-SYFDT-FIHDRGTANLIQAQRDFFG-SHGFDR  457 (475)
Q Consensus       395 ~~~~i~~~~~~lr~vv~~~i~~gip~P~lsssL-~y~~~-~~~~~~~~nliqaqRD~FG-aH~~~r  457 (475)
                      |.+.-..+.++ |||+..|++.|+|++.+..|+ +.+.| ....|     ++|+|-+=| --..+.
T Consensus       255 ILD~AgQKGTG-kWT~~~ALd~G~P~tlI~EsVfAR~lSs~K~~R-----~~A~~~l~g~p~~~~~  314 (480)
T TIGR00873       255 ILDTAGQKGTG-KWTAIDALDLGVPLTLITESVFARYLSSLKEER-----VAASKLLSGDPLAEEK  314 (480)
T ss_pred             EECCCCCCCCC-HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH-----HHHHHHCCCCCCCCCC
T ss_conf             00334688674-157667653389820799999999884128999-----9999734889656778


No 172
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.76  E-value=0.062  Score=33.82  Aligned_cols=117  Identities=14%  Similarity=0.269  Sum_probs=65.4

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH--HHHHHHHHCCCCCCCCEEC-CCHHHHHHHCCCCCEEEEE--CC
Q ss_conf             88056981571116889999978985999739989--9999997122112784032-8989998605778899997--69
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE--LTDVFIKKISGLSQKVIVT-KNLEQMVEAVCKPRKILMM--VT   77 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~--~~~~l~~~~~~~~~~~~~~-~s~~e~v~~l~~pr~Iil~--vp   77 (475)
                      ..+|.|+|+|.-|.+.|+-|.++|++|.+||.+++  ....+.+..    .++... ....+.  ....+++|+.+  +|
T Consensus         5 ~k~v~viGlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~----~~i~~~~g~~~~~--~~~~~d~vV~SPgI~   78 (445)
T PRK04308          5 NKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMF----DGLVFYTGRLKDA--LDNGFDILALSPGIS   78 (445)
T ss_pred             CCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCC----CCCEEEECCCHHH--HCCCCCEEEECCCCC
T ss_conf             9989999989999999999997899199997999953189997436----9968993786365--015999999899538


Q ss_pred             CHHH-HHHHHH---------HHH-HCCC-C-CCEE-EECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             9069-999999---------997-2078-9-9899-96798657899999999984799430
Q gi|254780716|r   78 DGDP-VDQLID---------KLK-PLLS-P-EDIL-LDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        78 ~g~~-v~~vi~---------~l~-~~l~-~-g~ii-ID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                      ...+ +....+         +++ ..++ + ..+| |-+||---..|.-.+..+++.|....
T Consensus        79 ~~~p~l~~a~~~gi~i~~~~el~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~  140 (445)
T PRK04308         79 ERQPDIEAFKQNGGRVLGDIELLADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTV  140 (445)
T ss_pred             CCCHHHHHHHHCCCCEECHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999997599571599999999841699579994899837799999999997599629


No 173
>PRK06349 homoserine dehydrogenase; Provisional
Probab=96.74  E-value=0.019  Score=37.57  Aligned_cols=167  Identities=19%  Similarity=0.339  Sum_probs=95.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--------CCE---EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCC
Q ss_conf             9988056981571116889999978--------985---99973998999999971221127840328989998605778
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--------GFR---LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--------G~~---V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~p   69 (475)
                      |++-+||++|+|+-|++.++-|.++        |.+   +.+.+|+.++...+      .........++.++++.- ..
T Consensus         1 M~~ikIgl~G~GtVG~gv~~il~~~~~~i~~~~g~~~~i~~i~~r~~~k~r~~------~~~~~~~t~d~~~i~~d~-~i   73 (432)
T PRK06349          1 MKPLKVGLLGLGTVGSGVVRILEENAEEIAARAGRPIEIKKVAVRDLEKDRGV------DLSGYLLTTDPEELVNDP-DI   73 (432)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC------CCCCCEEECCHHHHHCCC-CC
T ss_conf             95538999987806999999999809999998699769999996897535589------998555547999994389-99


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCH-HHHHHHHHHHHHCCCC-EECCCCCCCCCCCCCCCEEEEECC
Q ss_conf             89999769906999999999720789989996798657-8999999999847994-306754676000356843788454
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHF-CDTQIRSLQLSEKGIY-FIGIGVSGGVKGARSGASLMVGGN  147 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~-~~t~~~~~~l~~kgi~-fid~pVSGG~~gA~~G~slMvGG~  147 (475)
                      ++|+=++...++..+.+.   ..|+.|.-||-.--.-. ..-.++.+.++++|+. +.++-|.||..             
T Consensus        74 divVEliGG~~~A~~~i~---~AL~~GkhVVTANKallA~~g~eL~~lA~~~gv~l~fEAaV~GGIP-------------  137 (432)
T PRK06349         74 DIVVELMGGIEPARELIL---AALEAGKHVVTANKALLAVHGNELFAAAEEKGVDLYFEAAVAGGIP-------------  137 (432)
T ss_pred             CEEEEECCCCHHHHHHHH---HHHHCCCCEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCH-------------
T ss_conf             899996699507999999---9998599689258799986799999999871964999632246612-------------


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEE-CC-CCHHHHH--HHHHHHHHHHHHHHHHHHH
Q ss_conf             899988899999875015678618985-69-8746789--8877678788899989999
Q gi|254780716|r  148 EKAYNRVENILLSISAKYQNSPCCALL-GP-DGSGHFV--KMIHNGIEYANMQLIADIY  202 (475)
Q Consensus       148 ~~~~~~~~piL~~iaak~~~~~cv~y~-G~-~GsGh~v--KMVhNgIey~~mq~iaE~~  202 (475)
                           -++++-+.++...     +.-+ |= .|.-.|.  +|-.+|..|..  ++.||=
T Consensus       138 -----iI~~l~~~l~~~~-----i~~i~GIlNGTtNyILt~M~~~g~~f~~--aL~eAQ  184 (432)
T PRK06349        138 -----IIKALREGLAANR-----ITRVMGIVNGTTNYILTKMTEEGLSFED--ALKEAQ  184 (432)
T ss_pred             -----HHHHHHHHHHCCC-----CEEEEEEECCCHHHHHHHHHHCCCCHHH--HHHHHH
T ss_conf             -----0699987640477-----4377676247367999999871999999--999999


No 174
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=96.71  E-value=0.026  Score=36.54  Aligned_cols=83  Identities=17%  Similarity=0.362  Sum_probs=61.6

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|+++|++|..++|++++.+++.++......++                ..+-.-+.+.+.+
T Consensus         6 Kv~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~----------------~~~~~Dl~~~~~~   69 (246)
T PRK05653          6 KTALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEA----------------ALLVFDVTDEAAV   69 (246)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEEECCCHHHH
T ss_conf             889993897589999999999879999999799999999999999659948----------------9999728999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+.....+=|++|...
T Consensus        70 ~~~~~~~~~~~g~iDilvnnA   90 (246)
T PRK05653         70 RALIEAAVERFGGLDVLVNNA   90 (246)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999749986999899


No 175
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=96.71  E-value=0.024  Score=36.80  Aligned_cols=82  Identities=22%  Similarity=0.395  Sum_probs=61.2

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|++|++.|.+|.++||+.++.+++.++-.....++                ..+-.-|.+.+.++
T Consensus         5 valITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~----------------~~~~~Dv~d~~~v~   68 (250)
T TIGR03206         5 TAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNA----------------QAFACDITDRDSVD   68 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHHH
T ss_conf             99996857689999999999879999999798899999999999539928----------------99994489999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+.....+=|++|...
T Consensus        69 ~~v~~~~~~~G~iDilvnnA   88 (250)
T TIGR03206        69 TAVAAAEQALGPVDVLVNNA   88 (250)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999759997999898


No 176
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=96.70  E-value=0.0081  Score=40.31  Aligned_cols=126  Identities=16%  Similarity=0.199  Sum_probs=72.1

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC-CC-CCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-59997399899999997122-11-27840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS-GL-SQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~-~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .+++|.+||+|-.|.+.|.+|++.|. ++.+.|.+.=....+..+.- .+ .-+-.-+...++.+..+ .|.+-+...+.
T Consensus        20 ~~s~VlivG~GGlGs~~~~~La~~Gvg~i~lvD~D~ve~sNLnRQ~l~~~~diG~~K~~~a~~~l~~i-Np~i~i~~~~~   98 (228)
T cd00757          20 KNARVLVVGAGGLGSPAAEYLAAAGVGKLGLVDDDVVELSNLQRQILHTEADVGQPKAEAAAERLRAI-NPDVEIEAYNE   98 (228)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHEECHHHCCCCHHHHHHHHHHHH-CCCCCCEEHHH
T ss_conf             64978998877889999999998399758999787455676422102378668789599999999854-88753031321


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             0699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      . ...   +.+.+.++.-|+||||+- ++..-.-..+.+.+.++-++.+++.|-.
T Consensus        99 ~-i~~---~~~~~~~~~~DlVid~~D-n~~~R~~ln~~~~~~~iP~i~g~~~g~~  148 (228)
T cd00757          99 R-LDA---ENAEELIAGYDLVLDCTD-NFATRYLINDACVKLGKPLVSGAVLGFE  148 (228)
T ss_pred             C-CCH---HHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHCCCCEEEEEECCCE
T ss_conf             0-057---569988737989998779-9889999999999839988999740028


No 177
>PTZ00117 malate dehydrogenase; Provisional
Probab=96.68  E-value=0.028  Score=36.34  Aligned_cols=103  Identities=19%  Similarity=0.298  Sum_probs=60.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHH---HCCCCC---CCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             998805698157111688999997898-59997399899999997---122112---78403289899986057788999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIK---KISGLS---QKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~---~~~~~~---~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      |.|  |++||.|..|..+|..|+..+. ++..+|+++++++.-.-   ......   ..+.+..+.++    +...++|+
T Consensus         1 M~K--V~IIGaG~VG~~~A~~l~~~~~~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~i~~~~dy~~----~~daDiVV   74 (313)
T PTZ00117          1 MKK--ISIIGSGQIGAIVGLLLLQENLGDVYLYDVIEGVPQGKALDLKHFSTIIGVNANILGTNNYED----IKDSDVIV   74 (313)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHH----HCCCCEEE
T ss_conf             978--999897989999999997089987999958898308899887724203689857983799999----68999999


Q ss_pred             EECCC---------------HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             97699---------------0699999999972078998999679865789999
Q gi|254780716|r   74 MMVTD---------------GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        74 l~vp~---------------g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      +..-.               .+.+.++...+..+. ++.++|-.+  +|-|..-
T Consensus        75 itAG~~rk~g~tR~dLl~~N~~I~~~i~~~i~~~~-p~aiiivvt--NPvDimt  125 (313)
T PTZ00117         75 ITAGVQRKEGMTREDLIGVNGKIMKSVAESVKKHC-PNAFVICVS--NPLDIMV  125 (313)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC-CCEEEEECC--CCHHHHH
T ss_conf             89899899799889999876777888887762358-980899789--9489999


No 178
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=96.65  E-value=0.067  Score=33.56  Aligned_cols=126  Identities=21%  Similarity=0.252  Sum_probs=72.8

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHC-CCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             99880569815-71116889999978-98599-97399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDK-GFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~-G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+. +|+++|. |+||+.++.-+.+. ++.+. ++|+.....               .-.++.++... +         +
T Consensus         1 m~i-kI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~i~~~~~~~---------------~g~~~~~~~~~-~---------~   54 (265)
T PRK00048          1 MMI-KVGVAGASGRMGRELIEAVEAAEDLELVAALDRPGSPL---------------VGQDAGELAGL-G---------K   54 (265)
T ss_pred             CCE-EEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---------------CCCCHHHHCCC-C---------C
T ss_conf             945-99998888877999999998689979999994689723---------------36535665276-7---------6


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             90699999999972078998999679865789999999998479943067546760003568437884548999888999
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENI  157 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~pi  157 (475)
                      .+..   +.+.+...+.+-|++||.  +.|+.+....+.+.+.++.++ .|++|              -+++.++.++. 
T Consensus        55 ~~~~---~~~~l~~~~~~~DVvIDF--S~p~~~~~~~~~~~~~~~~~V-iGTTG--------------~~~~~~~~i~~-  113 (265)
T PRK00048         55 LGVP---ITDDLEAVLDDFDVLIDF--TTPEATLENLEFALEHGKPLV-IGTTG--------------FTEEQLAALRE-  113 (265)
T ss_pred             CCCE---ECCCHHHHHCCCCEEEEC--CCHHHHHHHHHHHHHCCCCEE-EEECC--------------CCHHHHHHHHH-
T ss_conf             7843---117898860559989989--988999999999997499779-96089--------------99899999997-


Q ss_pred             HHHHHCCCCCCCEEEEECCCCHH
Q ss_conf             99875015678618985698746
Q gi|254780716|r  158 LLSISAKYQNSPCCALLGPDGSG  180 (475)
Q Consensus       158 L~~iaak~~~~~cv~y~G~~GsG  180 (475)
                         .+.+..    |.|...-.-|
T Consensus       114 ---~s~~ip----il~apNfSlG  129 (265)
T PRK00048        114 ---AAKKIP----VVIAPNFSVG  129 (265)
T ss_pred             ---HCCCCC----EEEECCHHHH
T ss_conf             ---465887----8997855899


No 179
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated
Probab=96.64  E-value=0.01  Score=39.59  Aligned_cols=126  Identities=13%  Similarity=0.238  Sum_probs=75.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC----CCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             98805698157111688999997898-59997399899999997122----11278403289899986057788999976
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS----GLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~----~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      .+++|-+||+|-.|.+.|..|++.|. ++.+.|++.=....+..+--    ...+...-+...++....+. |.+-+..+
T Consensus        23 ~~a~VlVvGaGGLGs~~a~~La~aGVG~i~ivD~D~Ve~SNL~RQ~L~~e~Dig~~~pKa~aA~~~L~~iN-p~v~I~~~  101 (339)
T PRK07688         23 REKHVLIIGAGALGTANAEMLVRAGVGKVTIVDRDYVEWSNLQRQQLYTESDVKNNLPKAVAAKKRLEEIN-SEVRVEAI  101 (339)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCC-CCCEEEEE
T ss_conf             62978998777777999999998489829998099924667886506562133226377999999998349-98605876


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             990699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      +.. ...+-+.++   ++.-|+|||++- +++.-.-....|.+.++-++-+++.|..
T Consensus       102 ~~~-l~~~n~~~l---i~~~DlViD~tD-Nf~tR~liNd~c~~~~~PlV~ga~~g~~  153 (339)
T PRK07688        102 VQD-VTAEELEEL---VTNVDVIIDATD-NFETRFIVNDAAQKYSIPWIYGACVGSY  153 (339)
T ss_pred             ECC-CCHHHHHHH---HHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEEEECCE
T ss_conf             003-998999999---851889998788-9999999999999959998999884468


No 180
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=96.64  E-value=0.049  Score=34.59  Aligned_cols=85  Identities=18%  Similarity=0.260  Sum_probs=59.7

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCE--EEEEC
Q ss_conf             998805698--15711168899999789859997399899999997122112784032898999860577889--99976
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRK--ILMMV   76 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~--Iil~v   76 (475)
                      |.|  +.+|  |-+-+|..+|+.|++.|++|.+.||+.++.+++.++.....                ...++  +-.-|
T Consensus         1 mnK--valITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~----------------~~~~~~~~~~Dv   62 (259)
T PRK12384          1 MNK--VAVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEY----------------GEGMAYGFGADA   62 (259)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHC----------------CCCEEEEEECCC
T ss_conf             997--89994688689999999999879999999798899999999998624----------------886089998327


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             990699999999972078998999679
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.+.++.+++.+.....+=|++|...
T Consensus        63 ~~~~~v~~~~~~~~~~~G~iDilVnnA   89 (259)
T PRK12384         63 TSEQSVLALSRGVDEIFGRVDLLVYSA   89 (259)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999999999829971999899


No 181
>KOG2305 consensus
Probab=96.64  E-value=0.01  Score=39.54  Aligned_cols=199  Identities=17%  Similarity=0.186  Sum_probs=124.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH----------CCCC---------CCCCEECCCHHH
Q ss_conf             998805698157111688999997898599973998999999971----------2211---------278403289899
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK----------ISGL---------SQKVIVTKNLEQ   61 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~----------~~~~---------~~~~~~~~s~~e   61 (475)
                      |+-.+||++|-|..|+.-|.-++..||.|..||..++......++          ...+         -.-+.++.+++|
T Consensus         1 ms~~ki~ivgSgl~g~~WAmlFAs~GyqVqlYDI~e~Ql~~ALen~~Kel~~Lee~g~lrGnlsa~eqla~is~t~~l~E   80 (313)
T KOG2305           1 MSFGKIAIVGSGLVGSSWAMLFASSGYQVQLYDILEKQLQTALENVEKELRKLEEHGLLRGNLSADEQLALISGTTSLNE   80 (313)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCHHH
T ss_conf             98650467623231225999986067269976235999999999999999999972101267648888888708864999


Q ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCE
Q ss_conf             98605778899997699069999999997207899899967986578999999999847994306754676000356843
Q gi|254780716|r   62 MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGAS  141 (475)
Q Consensus        62 ~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~s  141 (475)
                      ++...-   .|--|+|..-....-+..-+..+-...+|+-.|||.+.-+.--+- +..+.-..+.-||-----    =|.
T Consensus        81 ~vk~Ai---~iQEcvpE~L~lkk~ly~qlD~i~d~~tIlaSSTSt~mpS~~s~g-L~~k~q~lvaHPvNPPyf----iPL  152 (313)
T KOG2305          81 LVKGAI---HIQECVPEDLNLKKQLYKQLDEIADPTTILASSTSTFMPSKFSAG-LINKEQCLVAHPVNPPYF----IPL  152 (313)
T ss_pred             HHHHHH---HHHHHCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHH-HHHHHHEEEECCCCCCCC----CCH
T ss_conf             986334---688616576678999999998754886587226442576777566-652443257457999741----201


Q ss_pred             --EE--EECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             --78--84548999888999998750156786189856987467898877678788899989999999964289978999
Q gi|254780716|r  142 --LM--VGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEIS  217 (475)
Q Consensus       142 --lM--vGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~  217 (475)
                        +.  +=-+.++.++...+++.+..+.     |.+--+.+-     -+.|-|.|++   +.|.+.+... +.++..++-
T Consensus       153 vElVPaPwTsp~tVdrt~~lM~sigq~p-----V~l~rei~G-----f~lnriq~Ai---lne~wrLvas-Gil~v~dvD  218 (313)
T KOG2305         153 VELVPAPWTSPDTVDRTRALMRSIGQEP-----VTLKREILG-----FALNRIQYAI---LNETWRLVAS-GILNVNDVD  218 (313)
T ss_pred             HEECCCCCCCHHHHHHHHHHHHHHCCCC-----CCCCCCCCC-----CEECCCCHHH---HHHHHHHHHC-CCCCHHHHH
T ss_conf             1013688788027899999999837777-----544340114-----2421331889---9999999870-676522299


Q ss_pred             HHHH
Q ss_conf             9998
Q gi|254780716|r  218 HLFS  221 (475)
Q Consensus       218 ~vf~  221 (475)
                      .|+.
T Consensus       219 ~VmS  222 (313)
T KOG2305         219 AVMS  222 (313)
T ss_pred             HHHH
T ss_conf             9986


No 182
>pfam06408 consensus
Probab=96.64  E-value=0.075  Score=33.20  Aligned_cols=150  Identities=18%  Similarity=0.147  Sum_probs=93.6

Q ss_pred             EEEEEECCHHHHHHHHHHHHC-C---CEEEEEECCHHHH--HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             056981571116889999978-9---8599973998999--999971221127840328989998605778899997699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDK-G---FRLAVYNKDFELT--DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~-G---~~V~vydr~~~~~--~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .|-+||.|..|+.+--=|.++ .   -++.+-|...++.  +.+.+.+      +                +.|..-|+.
T Consensus         3 ~Iv~iGfGSIgq~~LPLl~rH~~~~~~~Itiid~~d~~~~~~~~~~~G------i----------------~fi~~~lT~   60 (471)
T pfam06408         3 PILMIGFGSIGRGTLPLIERHFKFDRSNIVVIDPRDTKKDRKLLAEKG------I----------------RFVQTAVTK   60 (471)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCHHHEEEECCCCCHHHHHHHHHCC------C----------------EEEECCCCH
T ss_conf             779987571674206788876078878989976787545667787569------7----------------688614587


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC---CCCCCCCCCCCEEEEECCHHHHHHHH
Q ss_conf             069999999997207899899967986578999999999847994306754---67600035684378845489998889
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV---SGGVKGARSGASLMVGGNEKAYNRVE  155 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV---SGG~~gA~~G~slMvGG~~~~~~~~~  155 (475)
                       +.-++++..++.....||.+||.+..  -++..+-+.|.++|+.|+|.-|   .|+.......++     .+..|..-+
T Consensus        61 -eNy~~~L~~~L~~gg~gdflvnLSvn--iss~~ii~~C~e~GvlYldT~iEpW~g~y~d~~~~p~-----~RTnYalre  132 (471)
T pfam06408        61 -DNYKNVLDPLLKGGGGQGFCVNLSVD--TSSLDLMRLCREHGVLYVDTVVEPWLGFYFDADADNE-----ARTNYALRE  132 (471)
T ss_pred             -HHHHHHHHHHHHCCCCCCEEEEEECC--CCHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCHH-----HHHHHHHHH
T ss_conf             -88999999986267778879980115--7889999999980987755440356886667779855-----666699999


Q ss_pred             HHHHHHHCCCCCCC-EEEEECC--CCHHHHHHH
Q ss_conf             99998750156786-1898569--874678988
Q gi|254780716|r  156 NILLSISAKYQNSP-CCALLGP--DGSGHFVKM  185 (475)
Q Consensus       156 piL~~iaak~~~~~-cv~y~G~--~GsGh~vKM  185 (475)
                      .+++..++. .++| +|.-+|-  +=--||||-
T Consensus       133 ~~r~~~~~~-~~GpTAv~~hGANPGlVShfvKq  164 (471)
T pfam06408       133 TVRELKRDW-PGGPTAVSTCGANPGMVSWFVKQ  164 (471)
T ss_pred             HHHHHHHHC-CCCCEEEEECCCCCHHHHHHHHH
T ss_conf             999999657-99980777468995189999999


No 183
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Ubiquitin-E1 is a single-chain protein with a weakly conserved two-fold repeat. This CD represents the first repeat of Ub-E1.
Probab=96.63  E-value=0.029  Score=36.25  Aligned_cols=122  Identities=13%  Similarity=0.135  Sum_probs=76.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCC--EECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698157111688999997898-59997399899999997122112784--032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKV--IVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~--~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |.+++|=+||+|-.|..+|+||+-.|. .+.++|-+.-..+++..+.--..+.+  .-+....+..+.+. |.+=+...+
T Consensus        17 l~~s~Vli~G~~glg~Ei~Knlvl~Gv~~i~i~D~~~v~~~dl~~qf~~~~~dvg~~ra~~~~~~l~~lN-p~v~v~~~~   95 (286)
T cd01491          17 LQKSNVLISGLGGLGVEIAKNLILAGVKSVTLHDTKPCSWSDLSSQFYLREEDIGKNRAEASQARLAELN-PYVPVTVST   95 (286)
T ss_pred             HHHCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHCCCCCCCCHHHCCCCHHHHHHHHHHHHC-CCCEEEECC
T ss_conf             9759299999876399999999973996599995996886776347225777857888999999999648-982589635


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCC
Q ss_conf             9069999999997207899899967986578999999999847994306754676
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGG  132 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG  132 (475)
                      . .. +      ...+.+-++||-+. ..+....+..+.|++.++.|+.+.+.|-
T Consensus        96 ~-~~-~------~~~~~~fdvVv~t~-~~~~~~~~iN~~cR~~~i~Fi~~~~~G~  141 (286)
T cd01491          96 G-PL-T------TDELLKFQVVVLTD-ASLEDQLKINEFCHSPGIKFISADTRGL  141 (286)
T ss_pred             C-CC-C------HHHHCCCCEEEEEC-CCHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             7-77-8------88853888899918-9989999998888775981999505775


No 184
>PRK08862 short chain dehydrogenase; Provisional
Probab=96.62  E-value=0.027  Score=36.42  Aligned_cols=81  Identities=17%  Similarity=0.269  Sum_probs=57.4

Q ss_pred             EEEE-E-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698-1-5711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII-G-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI-G-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +-+| | -+-+|..+|++|++.|.+|.++||++++.++..++.......+                ..+-..+.+.+.++
T Consensus         7 v~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g~~~----------------~~~~~d~~~~~~v~   70 (227)
T PRK08862          7 IILITSAGSVLGRTISCHFARLGATLILCDQDQSALNDTYEQCSALTDNV----------------YSYQLKDFSQESIR   70 (227)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHHH
T ss_conf             99997988799999999999879999999699999999999999758974----------------89995166199999


Q ss_pred             HHHHHHHHCCCC-CCEEEEC
Q ss_conf             999999720789-9899967
Q gi|254780716|r   84 QLIDKLKPLLSP-EDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~-g~iiID~  102 (475)
                      +.++.+...... -|++|..
T Consensus        71 ~~~~~i~~~~g~~iDvLVNN   90 (227)
T PRK08862         71 HLFDAIEQQFNRAPDVLVNN   90 (227)
T ss_pred             HHHHHHHHHHCCCCEEEEEC
T ss_conf             99999999958997499856


No 185
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1. APPBP1 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. ABPP1 contains part of the adenylation domain.
Probab=96.62  E-value=0.0072  Score=40.68  Aligned_cols=127  Identities=10%  Similarity=0.093  Sum_probs=80.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCC--EECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698157111688999997898-59997399899999997122112784--032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKV--IVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~--~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |.+++|-+||++-.|.-+|+||+-.|. .|.++|-+.-...++-.+.--..+.+  .-+....+....|. |.+-+..++
T Consensus        18 l~~s~VLiiG~~glG~EiaKNLvLaGV~svti~D~~~v~~~DLg~nFfl~~~diGk~Raea~~~~L~eLN-p~V~v~~~~   96 (425)
T cd01493          18 LESAHVCLLNATATGTEILKNLVLPGIGSFTIVDGSKVDEEDLGNNFFLDASSLGKSRAEATCELLQELN-PDVNGSAVE   96 (425)
T ss_pred             HHHCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHCCCCCCCCHHHCCCHHHHHHHHHHHHHC-CCCCEEEEE
T ss_conf             9769399999971199999872132897699995991878885766156677858839999999999847-868547870


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCC
Q ss_conf             906999999999720789989996798657899999999984799430675467
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSG  131 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSG  131 (475)
                      .  ..+++++.-...+..=++||- ++.......+..+.|++++|.|+-+-+.|
T Consensus        97 ~--~~~~~~~~~~~~~~~f~vVV~-t~~~~~~~~~in~~cr~~~i~fI~~~~~G  147 (425)
T cd01493          97 E--SPEALLDNDPSFFSQFTVVIA-TNLPESTLLRLADVLWSANIPLLYVRSYG  147 (425)
T ss_pred             C--CHHHHHHCCHHHHCCCCEEEE-ECCCHHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             6--878864268767528338998-28899999999999998699789998244


No 186
>PRK09134 short chain dehydrogenase; Provisional
Probab=96.62  E-value=0.037  Score=35.43  Aligned_cols=87  Identities=21%  Similarity=0.470  Sum_probs=58.5

Q ss_pred             CCCCEEEEE-E-CCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698-1-571116889999978985999-7399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII-G-LGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI-G-LG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |.+.++.+| | -+-+|..+|+.|++.|++|.+ |+++.++.+++.++.........                .+-.-+.
T Consensus         6 ~~~~KvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~----------------~~~~Dl~   69 (256)
T PRK09134          6 MAAPRAALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAV----------------ALQADLA   69 (256)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEE----------------EEECCCC
T ss_conf             999997999488678999999999987998999849998999999999996499189----------------9975589


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.++++++.......+=|++|...
T Consensus        70 ~~~~~~~~v~~~~~~~G~iDiLVnNA   95 (256)
T PRK09134         70 DEAQVRALVARASAALGPITLLVNNA   95 (256)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999999999999829987899887


No 187
>PRK07831 short chain dehydrogenase; Provisional
Probab=96.61  E-value=0.042  Score=35.07  Aligned_cols=85  Identities=16%  Similarity=0.214  Sum_probs=57.7

Q ss_pred             EEEEE-ECC-H-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698-157-1-11688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII-GLG-S-MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI-GLG-~-MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+| |-+ . ||..+|++|++.|.+|.+.||+.++.++..++-......              .+...+..-|.+.+.
T Consensus        17 KvalVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~--------------~~v~~~~~Dvt~~~~   82 (261)
T PRK07831         17 KVVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGL--------------GRVEGVVCDVTSEAQ   82 (261)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCC--------------CEEEEEECCCCCHHH
T ss_conf             849994999647899999999987998999808777789999999984387--------------728999756899999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.+++.+...+..=|++|...
T Consensus        83 v~~~v~~~~~~~G~iDiLVNNA  104 (261)
T PRK07831         83 VDALIDAAVERLGRLDVLVNNA  104 (261)
T ss_pred             HHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999829986999888


No 188
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=96.60  E-value=0.079  Score=33.02  Aligned_cols=91  Identities=15%  Similarity=0.088  Sum_probs=60.6

Q ss_pred             EEE-CCHHHHHHHHHHHHCCCEEEEEECCHHH--HHHHHHHCCCCCCCCE-ECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             981-5711168899999789859997399899--9999971221127840-32898999860577889999769906999
Q gi|254780716|r    8 IIG-LGSMGSNLSLNILDKGFRLAVYNKDFEL--TDVFIKKISGLSQKVI-VTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         8 iIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~--~~~l~~~~~~~~~~~~-~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.| -|..|+++++.|+++|++|.+..|++++  .+++...+..   -+. -..+++.+..+++..+.|+.++|..... 
T Consensus         3 V~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~~~~l~~~gve---~v~gD~~d~~sl~~al~gvd~v~~~~~~~~~~-   78 (232)
T pfam05368         3 VFGATGYQGGSVVRASLKAGHPVRALVRDPKSELAKSLKAAGVE---LVEGDLDDHESLVEALKGVDVVFSVTGFWLSK-   78 (232)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCE---EEEECCCCHHHHHHHHCCCCEEEEECCCCCCH-
T ss_conf             98968289999999998589938999718736656666417988---99906888789999967998899915887417-


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             99999972078998999679865789999999998479943
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                                            .....++..+.+++.|+..
T Consensus        79 ----------------------~~~~~~~~~~AA~~aGVk~   97 (232)
T pfam05368        79 ----------------------EIEDGKKLADAAKEAGVKH   97 (232)
T ss_pred             ----------------------HHHHHHHHHHHHHHCCCCC
T ss_conf             ----------------------7999999999999739983


No 189
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=96.60  E-value=0.0096  Score=39.77  Aligned_cols=114  Identities=16%  Similarity=0.179  Sum_probs=65.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157111688999997898-5999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-++|-|=++.+.+.-|++.|. +++++||+.++.+++.+........+. .....++.. .+..++|+=+.|.|-..
T Consensus       127 ~~vlilGAGGAarAv~~aL~~~g~~~i~V~NRt~~ra~~La~~~~~~~~~~~-~~~~~~~~~-~~~~dliINaTp~Gm~~  204 (283)
T COG0169         127 KRVLILGAGGAARAVAFALAEAGAKRITVVNRTRERAEELADLFGELGAAVE-AAALADLEG-LEEADLLINATPVGMAG  204 (283)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCC-CCCCCCCCC-CCCCCEEEECCCCCCCC
T ss_conf             8899989768999999999986998799995888999999998645056311-024554123-55457899788787778


Q ss_pred             HH---HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99---999997207899899967986578999999999847994
Q gi|254780716|r   83 DQ---LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        83 ~~---vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      ..   .+.  ...+.++.++.|+=-. |..| ..-++++++|..
T Consensus       205 ~~~~~~~~--~~~l~~~~~v~D~vY~-P~~T-plL~~A~~~G~~  244 (283)
T COG0169         205 PEGDSPVP--AELLPKGAIVYDVVYN-PLET-PLLREARAQGAK  244 (283)
T ss_pred             CCCCCCCC--HHHCCCCCEEEEECCC-CCCC-HHHHHHHHCCCC
T ss_conf             87888886--7766867789981118-8788-899999985990


No 190
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional
Probab=96.60  E-value=0.016  Score=38.21  Aligned_cols=141  Identities=14%  Similarity=0.186  Sum_probs=79.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC-C-CCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-59997399899999997122-1-127840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS-G-LSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~-~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .+++|.+||+|-.|.+.|.+|+..|. ++.+.|.+.=....+..+.- . ..-+..-+...++.+..+ .|.+-+..++.
T Consensus        31 ~~s~VlivG~GGlG~~~~~~La~aGvg~i~lvD~D~ve~sNLnRQ~l~~~~diG~~Kv~~a~~~l~~i-np~i~i~~~~~  109 (245)
T PRK05690         31 KAARVLVVGLGGLGCAAAQYLAAAGVGTLTLVDFDTVSLSNLQRQVLHDDATIGQPKVESAKAALARI-NPHIAIETINA  109 (245)
T ss_pred             HHCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHH-CCCCCEEEEHH
T ss_conf             71978998777778999999998599659999688678886788864598778988799999999975-88752263331


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC--EEEEECCHHHHHH
Q ss_conf             06999999999720789989996798657899999999984799430675467600035684--3788454899988
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA--SLMVGGNEKAYNR  153 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~--slMvGG~~~~~~~  153 (475)
                       ....+.   +.+.++.-|+|||++- ++..-....+.|.+.++-|+.+++.|..     |.  .++++.+..-|+-
T Consensus       110 -~i~~~n---~~~li~~~DlViD~~D-n~~~R~~ln~~c~~~~~P~v~g~~~g~~-----Gqv~~~~p~~~~pC~~C  176 (245)
T PRK05690        110 -RLDDDE---LAALIAAHDLVLDCTD-NVATRNQLNAACFAAKKPLVSGAAIRME-----GQVTVFTYQDNEPCYRC  176 (245)
T ss_pred             -CCCHHH---HHHHHHCCCEEEECCC-CHHHHHHHHHHHHHCCCCEEEEEEEEEE-----EEEEEEEECCCCCCHHH
T ss_conf             -448889---9887507888998789-9999999999999719987987788658-----99999970799970554


No 191
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
Probab=96.59  E-value=0.01  Score=39.64  Aligned_cols=99  Identities=17%  Similarity=0.272  Sum_probs=70.7

Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC-CCCCCCC-CCC-------CC-CE
Q ss_conf             99976990699999999972078998999679865789999999998479943067-5467600-035-------68-43
Q gi|254780716|r   72 ILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI-GVSGGVK-GAR-------SG-AS  141 (475)
Q Consensus        72 Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~-pVSGG~~-gA~-------~G-~s  141 (475)
                      |++++|-+ ++.+++.++.|+++++.||-|.|.+--.-.....+.+..+-.+|+.. |+.|++. |..       .| .+
T Consensus         1 Vvla~Pv~-~~~~~~~~i~~~l~~~~ivTDvgS~K~~v~~~~~~~l~~~~~~fV~gHPmAGsE~sG~~aa~~~Lf~~~~~   79 (673)
T PRK11861          1 VLLAAPVA-QTGPLLARIAPFLDASTIVTDAGSTKSDVVAAARAALGARIGQFVPGHPIAGRESSGVDAALADLYVGRNV   79 (673)
T ss_pred             CEEECCHH-HHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCCHHHHHHHHHHHCCCEE
T ss_conf             98963789-99999999861679996897785366999999998616678848555872887522677764788579859


Q ss_pred             EE---EECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCC
Q ss_conf             78---8454899988899999875015678618985698
Q gi|254780716|r  142 LM---VGGNEKAYNRVENILLSISAKYQNSPCCALLGPD  177 (475)
Q Consensus       142 lM---vGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~  177 (475)
                      ++   ...+.++.++++.+++++.++      +.++-+.
T Consensus        80 iltp~~~~~~~~~~~~~~~w~~~Ga~------v~~m~~~  112 (673)
T PRK11861         80 VLCALPENAPDALARVEAMWRAARAD------VRAMSAE  112 (673)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCE------EEECCHH
T ss_conf             99559999899999999999984998------9983879


No 192
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.58  E-value=0.054  Score=34.27  Aligned_cols=101  Identities=15%  Similarity=0.207  Sum_probs=61.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHH---CCCCCC-CCEECCCHHHHHHHCCCCCEEEEECC-
Q ss_conf             05698157111688999997898--599973998999999971---221127-84032898999860577889999769-
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKK---ISGLSQ-KVIVTKNLEQMVEAVCKPRKILMMVT-   77 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~---~~~~~~-~~~~~~s~~e~v~~l~~pr~Iil~vp-   77 (475)
                      +|++||.|..|.++|..|+.++.  ++..||+++++++..+..   ...... ......+.++    ++..++|++..- 
T Consensus         2 KI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~~~~----l~daDvVVitaG~   77 (308)
T cd05292           2 KVAIVGAGFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGDYAD----CKGADVVVITAGA   77 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHH----HCCCCEEEECCCC
T ss_conf             799999488899999999867998879999188984512568766241036881684099999----7799999989999


Q ss_pred             --------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             --------------90699999999972078998999679865789999
Q gi|254780716|r   78 --------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        78 --------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                                    +.+.+.++...+.++- ++.+++-.+|  |-|...
T Consensus        78 ~rk~g~tR~dll~~Na~I~~~i~~~i~~~~-p~~ivivvsN--PvDv~t  123 (308)
T cd05292          78 NQKPGETRLDLLKRNVAIFKEIIPQILKYA-PDAILLVVTN--PVDVLT  123 (308)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEECCC--CHHHHH
T ss_conf             999899878999888999999999998419-9808997279--547899


No 193
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]
Probab=96.58  E-value=0.02  Score=37.37  Aligned_cols=96  Identities=13%  Similarity=0.231  Sum_probs=47.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEE--ECCCHHHH
Q ss_conf             0569815711168899999789859997399899999997122112784032898999860577889999--76990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILM--MVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil--~vp~g~~v   82 (475)
                      ++-+||=|+.|.+-|+=..--|-+|.+.|++.++.+.+-+......  -+...+...+.+.+.+.+++|-  .+|..++-
T Consensus       170 kv~iiGGGvvgtnaAkiA~glgA~Vtild~n~~rl~~ldd~f~~rv--~~~~st~~~iee~v~~aDlvIgaVLIpgakaP  247 (371)
T COG0686         170 KVVVLGGGVVGTNAAKIAIGLGADVTILDLNIDRLRQLDDLFGGRV--HTLYSTPSNIEEAVKKADLVIGAVLIPGAKAP  247 (371)
T ss_pred             CEEEECCCCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCEE--EEEECCHHHHHHHHHHCCEEEEEEEECCCCCC
T ss_conf             0899877612406999972368706999527788764067657666--99975899999874312679888884588786


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      .-|..+++..++||.+|||.
T Consensus       248 kLvt~e~vk~MkpGsVivDV  267 (371)
T COG0686         248 KLVTREMVKQMKPGSVIVDV  267 (371)
T ss_pred             EEHHHHHHHHCCCCCEEEEE
T ss_conf             01069999744798589999


No 194
>PRK06223 malate dehydrogenase; Reviewed
Probab=96.57  E-value=0.048  Score=34.59  Aligned_cols=101  Identities=16%  Similarity=0.273  Sum_probs=60.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCC---CC---CCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             05698157111688999997898--59997399899999997122---11---278403289899986057788999976
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKIS---GL---SQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~---~~---~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      +|++||.|..|..+|..|+.+|.  ++..+|+++++++.......   ..   ...+.+..+.++    +...++|++.-
T Consensus         2 KI~IiGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~----~~daDiVVita   77 (312)
T PRK06223          2 KISIIGAGNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAESSAVDGFDAKITGTNDYAD----IAGSDVVIITA   77 (312)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEECCCHHH----HCCCCEEEEEC
T ss_conf             79999969899999999985799874899769997336798887651433688847983788899----57999999906


Q ss_pred             --C--CH-----------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             --9--90-----------699999999972078998999679865789999
Q gi|254780716|r   77 --T--DG-----------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        77 --p--~g-----------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                        |  .|           +.+.++...+.++- ++.+++--+  +|-|+.-
T Consensus        78 g~~rk~g~tR~dll~~N~~I~k~i~~~i~~~~-p~~iilvvs--NPvDv~t  125 (312)
T PRK06223         78 GVPRKPGMSRDDLLGINAKIMKDVGEGIKKYA-PDAIVIVIT--NPVDAMT  125 (312)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEEC--CCHHHHH
T ss_conf             77899998868999987899999999998409-981899936--9368999


No 195
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional
Probab=96.57  E-value=0.012  Score=38.99  Aligned_cols=199  Identities=14%  Similarity=0.215  Sum_probs=101.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCC----EECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             98805698157111688999997898-59997399899999997122112784----03289899986057788999976
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKV----IVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~----~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      .+++|-+||+|-.|.+.|..|++.|. ++.+.|++.=....+..+.--....+    .-+...++....++ |.+-+..+
T Consensus        23 ~~s~VlIVGaGGLGs~~a~~La~aGVG~l~ivD~D~Ve~SNL~RQ~L~~~~Dig~~k~Ka~aA~~~L~~iN-p~v~I~~~  101 (337)
T PRK12475         23 REKHVLIIGAGALGAANAEALVRAGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQYKPKAIAAAEHLRKIN-SEVEIVPV  101 (337)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHC-CCCCEEEE
T ss_conf             63969999777778999999998289869998499831446745300222121557488999999998449-99744751


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHH
Q ss_conf             99069999999997207899899967986578999999999847994306754676000356843788454899988899
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVEN  156 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~p  156 (475)
                      ... ...+-+.+   .++.-|+|||++- +++.-.-+...|.+.++-++-+++.|...-.   .++.+| +.       |
T Consensus       102 ~~~-l~~~n~~~---li~~~DlViD~tD-Nf~tR~liNd~c~~~~~PlV~ga~~g~~G~~---~~~~p~-~t-------p  165 (337)
T PRK12475        102 VTD-VTVEEMEE---LIKEVDLIIDATD-NFDTRLLINDISQKYNIPWIYGGCVGSYGVT---YTIIPG-KT-------P  165 (337)
T ss_pred             HHC-CCHHHHHH---HHHHCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEEEECCEEEE---EEECCC-CC-------C
T ss_conf             311-99799999---9861889998888-9999999999999969998998870568899---987799-98-------7


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
Q ss_conf             99987501567861898569874678988776787888999899999999642899789999998606884
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGK  227 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~  227 (475)
                      -+.++=......+.|.-.|--|..  +-||      |.||+ .|+..+|-. .+-....-.-.|+-|+...
T Consensus       166 CyrClf~~p~~~~tC~~~GVlgp~--~gii------gs~qa-~EaiK~l~g-~~~~l~~~ll~~D~~~~~~  226 (337)
T PRK12475        166 CFRCLMEHPVGGATCDTAGIIQPA--VQIV------VAHQV-AEALKILVE-DFEALRETMLSFDIWNNQN  226 (337)
T ss_pred             CHHHCCCCCCCCCCCCCCCCCCCH--HHHH------HHHHH-HHHHHHHHC-CCCCCCCCEEEEECCCCEE
T ss_conf             341157999989986457766333--8899------99999-999999848-9975658689999777879


No 196
>PTZ00325 malate dehydrogenase; Provisional
Probab=96.56  E-value=0.052  Score=34.39  Aligned_cols=103  Identities=17%  Similarity=0.192  Sum_probs=58.7

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHH-HHCCCCCCC-CEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             99880569815-7111688999997898--5999739989999999-712211278-40328989998605778899997
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDKGF--RLAVYNKDFELTDVFI-KKISGLSQK-VIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~-~~~~~~~~~-~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      |.|  |++||. |..|..+|..|..+|.  ++..+|.++.+.+.+- ......... .....+..|   .++..++|+++
T Consensus         1 m~K--V~IIGA~G~VG~s~A~~l~~~~~~~elvL~Di~~a~g~a~Dl~~~~~~~~~~~~~~~~~~e---~~~~aDIVVit   75 (313)
T PTZ00325          1 MFK--VAVLGAAGGIGQPLSLLLKRNPYVSTLSLYDIVGAPGVAADLSHIPSPAKVTGYAKGELHK---AVDGADVVLIV   75 (313)
T ss_pred             CCE--EEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCCCEECCCCHHH---HHCCCCEEEEC
T ss_conf             938--9998999869999999998389977799980897266898886755535665452798889---84899899988


Q ss_pred             CC---------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH
Q ss_conf             69---------------9069999999997207899899967986578999
Q gi|254780716|r   76 VT---------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ  111 (475)
Q Consensus        76 vp---------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~  111 (475)
                      --               +.+.+.++...+..+- +..++|-.|  +|-|+.
T Consensus        76 aG~~rkpg~tR~dLl~~N~~I~~~i~~~i~~~~-~~aiiivvt--NPvD~m  123 (313)
T PTZ00325         76 AGVPRKPGMTRDDLFNTNAGIVRDLVLACASSA-PKAIFGIIT--NPVNST  123 (313)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEECC--CCHHHH
T ss_conf             898899789689999970699999999999769-980999736--824799


No 197
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.56  E-value=0.032  Score=35.94  Aligned_cols=77  Identities=19%  Similarity=0.256  Sum_probs=57.9

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
Q ss_conf             57111688999997898599973998999999971221127840328989998605778899997699069999999997
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLK   90 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~   90 (475)
                      -.-+|..+|+.|++.|++|.+.+|+.++.+++.++....+...                ..+-.-|.+.+.++++++.+.
T Consensus        15 s~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~----------------~~~~~Dvtd~~~v~~~v~~~~   78 (238)
T PRK07666         15 GRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKA----------------VIATADVSDYEEVTTAIETLK   78 (238)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEEECCCHHHHHHHHHHHH
T ss_conf             7789999999999879989999899999999999999559927----------------999930799999999999999


Q ss_pred             HCCCCCCEEEECC
Q ss_conf             2078998999679
Q gi|254780716|r   91 PLLSPEDILLDGG  103 (475)
Q Consensus        91 ~~l~~g~iiID~s  103 (475)
                      ..+..=||+|...
T Consensus        79 ~~~G~iDiLVNNA   91 (238)
T PRK07666         79 NGLGSIDILINNA   91 (238)
T ss_pred             HHHCCCCEEEECC
T ss_conf             9819987899847


No 198
>KOG2711 consensus
Probab=96.55  E-value=0.029  Score=36.19  Aligned_cols=98  Identities=16%  Similarity=0.264  Sum_probs=66.3

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHC--CC-----EEEEEECC------HHHHHHHHHH---------CCCCCCCCEECCCH
Q ss_conf             988056981571116889999978--98-----59997399------8999999971---------22112784032898
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDK--GF-----RLAVYNKD------FELTDVFIKK---------ISGLSQKVIVTKNL   59 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~--G~-----~V~vydr~------~~~~~~l~~~---------~~~~~~~~~~~~s~   59 (475)
                      .+..|++||.|+.|+.+|+.+.++  ++     .|..|-+.      .++..+.+..         +.....++.+..++
T Consensus        20 ~~~kV~ivGsGnWGsaiaki~~~n~~~~~~f~~~Vrmwv~ee~i~~~~~~L~eiIN~~heN~KYlpg~~lP~NvvAv~dl   99 (372)
T KOG2711          20 DPLKVCIVGSGNWGSAIAKIVGENVKEFPIFDPQVRMWVFEEEINGEAEKLTEIINSRHENVKYLPGIKLPENVVAVPDL   99 (372)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEECCHH
T ss_conf             75379998168089999999865254055667303677750133770578998751556342336786599776765239


Q ss_pred             HHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99986057788999976990699999999972078998999679
Q gi|254780716|r   60 EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        60 ~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+   ++.+.++++..||+ +-+.+++++|..+.+++...|-+.
T Consensus       100 ~e---a~~dADilvf~vPh-Qf~~~ic~~l~g~vk~~~~aISL~  139 (372)
T KOG2711         100 VE---AAKDADILVFVVPH-QFIPRICEQLKGYVKPGATAISLI  139 (372)
T ss_pred             HH---HHCCCCEEEEECCH-HHHHHHHHHHHCCCCCCCEEEEEE
T ss_conf             98---84338889994871-547999999854257998078854


No 199
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.55  E-value=0.034  Score=35.70  Aligned_cols=114  Identities=14%  Similarity=0.142  Sum_probs=64.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH-----HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--C
Q ss_conf             8056981571116889999978985999739989-----99999971221127840328989998605778899997--6
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--V   76 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~-----~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--v   76 (475)
                      .+|+++|||.=|.+.|+-|.+.|++|.++|-..+     ..+.+...+.    .+..-....++.   +..+.|+.+  +
T Consensus        15 k~v~V~GlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~l~~~g~----~~~~g~~~~~~~---~~~d~vV~SPGI   87 (481)
T PRK01438         15 LRVVVAGLGVSGFPAADALHELGASVTVVADGDDDRSRERAALLEVLGA----TVRLGDGETTLP---EGTELVVTSPGW   87 (481)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCC----EEEECCCHHHHH---CCCCEEEECCCC
T ss_conf             9899995758899999999967998999979987448689998885498----899688756662---489999989978


Q ss_pred             CCHHH-HHHHHH---------HHHH-CC----CCCC-EEEECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             99069-999999---------9972-07----8998-999679865789999999998479943
Q gi|254780716|r   77 TDGDP-VDQLID---------KLKP-LL----SPED-ILLDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        77 p~g~~-v~~vi~---------~l~~-~l----~~g~-iiID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      |...+ +....+         +|.- .+    .+.. |-|-+||---..|.-.+..|+..|..-
T Consensus        88 ~~~~p~~~~a~~~gi~i~~eiel~~~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~  151 (481)
T PRK01438         88 RPTHPLLAAAAEAGIPVWGDVELAWRLRDPDGTPAPWLAVTGTNGKTTTVQMLASILRAAGLRA  151 (481)
T ss_pred             CCCCHHHHHHHHCCCCEECHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             9989999999986993861899999875213688878999389974609999999999669970


No 200
>PRK07576 short chain dehydrogenase; Provisional
Probab=96.53  E-value=0.087  Score=32.71  Aligned_cols=81  Identities=16%  Similarity=0.241  Sum_probs=58.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.+|+.++.++..++-......+                ..+-.-|.+.+.++
T Consensus        10 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~~----------------~~~~~Dv~~~~~~~   73 (260)
T PRK07576         10 NVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPEA----------------LGVSADVRDYAAVE   73 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHHH
T ss_conf             89995896199999999999879999999798899999999999539948----------------99993189999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      ++++.+......=|++|..
T Consensus        74 ~~~~~~~~~~G~iDiLVnn   92 (260)
T PRK07576         74 AAFAAIADEFGPIDVLVSG   92 (260)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999984999899989


No 201
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NAD(P)+. This subfamily includes glutamate, leucine, phenylalanine, and valine DHs. Glutamate DH is a multi-domain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms.  Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent.  As in other NAD+-dependent DHs, monomers in this family have 2 domains separated by a deep cleft. Here the c-terminal domain contains a modified NAD-binding Rossmann fold with 7 rather than the usual 6 beta strands and one strand anti-parral
Probab=96.51  E-value=0.057  Score=34.08  Aligned_cols=115  Identities=20%  Similarity=0.164  Sum_probs=67.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEE-EEEECC----------HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCE
Q ss_conf             880569815711168899999789859-997399----------899999997122112784032898999860577889
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRL-AVYNKD----------FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRK   71 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V-~vydr~----------~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~   71 (475)
                      ..+|.+-|+|+.|+..|+.|.+.|.+| .+-|.+          .+..+...+.+..........-+.+++..  -.+++
T Consensus        23 g~~vaVqGfGnVG~~~a~~l~~~GakvvavsD~~G~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~DI  100 (217)
T cd05211          23 GLTVAVQGLGNVGWGLAKKLAEEGGKVLAVSDPDGYIYDPGITTEELINYAVALGGSARVKVQDYFPGEAILG--LDVDI  100 (217)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCC--CCCCE
T ss_conf             9999998988999999999998599899998578717789998699999999818965366653059865003--67768


Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             9997699069999999997207899899967986578999999999847994306
Q gi|254780716|r   72 ILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        72 Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      ++-|-..+....+....|    + -++|+.+.|...  |.+..+.|.++||.++=
T Consensus       101 liPaAl~~~I~~~~a~~i----~-ak~I~EgAN~P~--t~ea~~iL~~rgI~viP  148 (217)
T cd05211         101 FAPCALGNVIDLENAKKL----K-AKVVAEGANNPT--TDEALRILHERGIVVAP  148 (217)
T ss_pred             EEECCCCCCCCHHHHHHH----C-CEEEECCCCCCC--CHHHHHHHHHCCCEEEC
T ss_conf             964244588798999871----7-728950678998--97899999978998947


No 202
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236    This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis. Shorter forms not in this group include SerA from Escherichia coli. ; GO: 0004617 phosphoglycerate dehydrogenase activity, 0006564 L-serine biosynthetic process.
Probab=96.50  E-value=0.026  Score=36.61  Aligned_cols=111  Identities=18%  Similarity=0.257  Sum_probs=85.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH--HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8056981571116889999978985999739989--99999971221127840328989998605778899997699069
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE--LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~--~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ..+|++|+|+.|..++.+...-|..+..||.--.  +.+.+         ++....++.++...   .+++-+-.|-.+.
T Consensus       140 ~~~g~~g~g~~g~~~~~~~~~~~~~~~~~dp~~~~~~~~~~---------g~~~~~~~~~~~~~---~d~~~~h~p~~~~  207 (535)
T TIGR01327       140 KTLGVIGLGRIGSEVAKRAKAFGMKVLAYDPYLPPERAEKL---------GVELLADLDELLAR---ADFITLHTPLTPE  207 (535)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCEEEEECCCCCHHHHHHH---------CHHHHHHHHHHHHH---CCEEEEECCCCCH
T ss_conf             20001112301146766544312046752565663346550---------21333207888632---4535763366602


Q ss_pred             HHHHHH-HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             999999-997207899899967986578999999999847994306
Q gi|254780716|r   82 VDQLID-KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        82 v~~vi~-~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      +...+. +-+..++++-++++|.....-+.....+.+....+.-..
T Consensus       208 ~~~~~~~~~~~~~~~~~~~~~~~~gg~~~~~~l~~~~~~g~~~~~~  253 (535)
T TIGR01327       208 TKGLIGAEELAKLKPGVIIVNCARGGLIDEAALYEALEEGHVGGAA  253 (535)
T ss_pred             HHHHCCHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCCHHHHE
T ss_conf             3321032566640476069850346632068899876313100100


No 203
>PRK06181 short chain dehydrogenase; Provisional
Probab=96.48  E-value=0.033  Score=35.79  Aligned_cols=77  Identities=17%  Similarity=0.323  Sum_probs=57.4

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
Q ss_conf             57111688999997898599973998999999971221127840328989998605778899997699069999999997
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLK   90 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~   90 (475)
                      -.-+|..+|+.|+++|++|.+.+|++++.+++.++....+..+.                .+-.-|.+.+.++++++.+.
T Consensus        10 ssGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g~~~~----------------~~~~Dvs~~~~~~~~~~~~~   73 (263)
T PRK06181         10 SEGIGRALAVRLARAGARLVLAARNEERLASLAQELANYGAEAL----------------VVATDVSDAEACERLIEAAV   73 (263)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEEECCCCHHHHHHHHHHHH
T ss_conf             01999999999998799899998899999999999995499679----------------99807999999999999999


Q ss_pred             HCCCCCCEEEECC
Q ss_conf             2078998999679
Q gi|254780716|r   91 PLLSPEDILLDGG  103 (475)
Q Consensus        91 ~~l~~g~iiID~s  103 (475)
                      ....+=|++|...
T Consensus        74 ~~~G~iDiLVNNA   86 (263)
T PRK06181         74 AHFGGIDILVNNA   86 (263)
T ss_pred             HHHCCCCEEEECC
T ss_conf             9829964899878


No 204
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.48  E-value=0.047  Score=34.70  Aligned_cols=71  Identities=18%  Similarity=0.168  Sum_probs=41.5

Q ss_pred             EEEEEE-CCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             056981-57111688999997898--599973998999999971221127840328989998605778899997
Q gi|254780716|r    5 DIGIIG-LGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         5 ~IGiIG-LG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      +|++|| .|+.|..+|..|..+|.  ++..+|.+..+.+.+-=.+......+.++....+..++++..++|++.
T Consensus         2 KV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~~~~~~~~~~~~l~daDiVVit   75 (310)
T cd01337           2 KVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGADVVVIP   75 (310)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHCCCCEEEEC
T ss_conf             89999999818999999997299977699982774266755321656568512570887466774799999987


No 205
>PRK08223 hypothetical protein; Validated
Probab=96.48  E-value=0.026  Score=36.62  Aligned_cols=137  Identities=15%  Similarity=0.162  Sum_probs=80.7

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHC-CCCC-CCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             988056981571116889999978985-999739989999999712-2112-7840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKI-SGLS-QKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~-~~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .++.|.+||+|-.|++.|..|++.|+- +.+-|.+.=....+..+. .... -+-.-+...++.+..++ |.+-+...+.
T Consensus        26 ~~s~VlVvG~GGlGs~~a~~LAraGVG~i~lvD~D~velSNLnRQi~~~~~diG~~Kveva~e~l~~IN-P~v~V~~~~~  104 (287)
T PRK08223         26 RNSRVAIAGLGGVGGVHLLTLARLGIGKFNIADFDVFELVNSNRQYGAMMSSNGRPKVEVMREIALDIN-PELEIRAFPE  104 (287)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHCCCHHHCCCCHHHHHHHHHHHHC-CCCEEEEECC
T ss_conf             559689993675579999999982897599974998463440222344743449858999999999869-8987999587


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH-HHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECC
Q ss_conf             06999999999720789989996798657899999-999984799430675467600035684-3788454
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR-SLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGN  147 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~-~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~  147 (475)
                      . ...+-+++++   +.-|+|||++-.+--+++.. ...|...|+-++-+++-|-+.    -. .+++||.
T Consensus       105 ~-lt~~N~~~~l---~~~DvVvDg~DnF~~~tR~ll~~ac~~~giP~v~~a~l~f~g----q~~vF~P~g~  167 (287)
T PRK08223        105 G-IGKENLDTFL---DGVDVYVDGLDFFVFDIRRLLFREAQARGIPALTAAPLGFST----AWLVFDPGGM  167 (287)
T ss_pred             C-CCHHHHHHHH---HCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCC----EEEEECCCCC
T ss_conf             8-9989999998---679999979667883189999999998599849831541030----6999889997


No 206
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.48  E-value=0.093  Score=32.50  Aligned_cols=122  Identities=15%  Similarity=0.164  Sum_probs=67.4

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCH--HHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHH-
Q ss_conf             5698157111688999997898599973998--999999971221127840328989998605778899997--69906-
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFRLAVYNKDF--ELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGD-   80 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~--~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~-   80 (475)
                      .=++|+|.-|.+.|+-|.++|++|.+||...  ...+.+.++....  .+..-....+.   +..++.|+.+  +|... 
T Consensus        10 ~LV~G~G~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~~~~~~i--~~~~g~~~~~~---~~~~d~vv~SPgI~~~~p   84 (448)
T PRK03803         10 RIVVGLGKSGMSLVRFLARQGYQFAVTDTRENPPELATLRRDYPQV--EVRCGELDAEF---LCQAEEIIVSPGLALATP   84 (448)
T ss_pred             EEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHCCCC--EEEECCCCHHH---HCCCCEEEECCCCCCCCH
T ss_conf             8999989999999999997889599991899916799999747997--79978889778---078999998997299999


Q ss_pred             HHHHHHH---------HHHHCCCCCCEEEECCCCCHH-HHHHHHHHHHHCCCCEECCCCCCC
Q ss_conf             9999999---------997207899899967986578-999999999847994306754676
Q gi|254780716|r   81 PVDQLID---------KLKPLLSPEDILLDGGNSHFC-DTQIRSLQLSEKGIYFIGIGVSGG  132 (475)
Q Consensus        81 ~v~~vi~---------~l~~~l~~g~iiID~sts~~~-~t~~~~~~l~~kgi~fid~pVSGG  132 (475)
                      .+....+         +++....+..+|--+||..-. .|.-.+..+++.|....-+|-.|.
T Consensus        85 ~~~~a~~~~i~i~~e~el~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~gGNiG~  146 (448)
T PRK03803         85 ALQAAAAAGIKISGDIELFARAAKAPIVAITGSNAKSTVTTLVGEMAKAAGKRVAVGGNLGT  146 (448)
T ss_pred             HHHHHHHCCCCEECHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             99999985996831999986217898899858998388999999999865983799403276


No 207
>PRK07775 short chain dehydrogenase; Provisional
Probab=96.44  E-value=0.038  Score=35.34  Aligned_cols=78  Identities=19%  Similarity=0.365  Sum_probs=56.9

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|++.|++|.+..|+.++.+++.++.......+.                .+-+-|.+.+.+++.++.+
T Consensus        18 AssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~~----------------~~~~Dvtd~~~v~~~v~~~   81 (275)
T PRK07775         18 ASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEAV----------------AFPLDVTDPDSVKSFVAQA   81 (275)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEEECCCCHHHHHHHHHHH
T ss_conf             235999999999998799899998989999999999996499489----------------9991289999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      ...+.+=|++|...
T Consensus        82 ~~~~G~iDiLVnNA   95 (275)
T PRK07775         82 TEALGDIEVLVSGA   95 (275)
T ss_pred             HHHHCCCCEEEECC
T ss_conf             99859965999767


No 208
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Probab=96.43  E-value=0.018  Score=37.79  Aligned_cols=117  Identities=18%  Similarity=0.126  Sum_probs=53.9

Q ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCE--ECCCCCCCCCCCCC---C-
Q ss_conf             788999976-99069999999997207899899-9679865789999999998479943--06754676000356---8-
Q gi|254780716|r   68 KPRKILMMV-TDGDPVDQLIDKLKPLLSPEDIL-LDGGNSHFCDTQIRSLQLSEKGIYF--IGIGVSGGVKGARS---G-  139 (475)
Q Consensus        68 ~pr~Iil~v-p~g~~v~~vi~~l~~~l~~g~ii-ID~sts~~~~t~~~~~~l~~kgi~f--id~pVSGG~~gA~~---G-  139 (475)
                      ..++|...= |..+...+.++++..  ..+||+ |-+.-.++.|..++.+..+......  +.||--|-...-++   | 
T Consensus       103 ~tkiI~S~H~~~~~~l~~~~~~~~~--~~aDivKia~~A~~~~D~~~l~~~~~~~~~p~Iai~MGe~G~lSRiL~~~~g~  180 (477)
T PRK09310        103 KIKIILSYHTSEHEDIPQLYNEMLA--SQADYYKIAVSSTSSTDLLNIIQQKRSLPENTTVLCMGNHGIPSRILSPLLQN  180 (477)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHH--HCCCEEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEECCCCCCC
T ss_conf             9779998249983039999999986--07998999840387778999999997289986999717787021000022267


Q ss_pred             CE-E--EEECCHH-----HHHHHH-HHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             43-7--8845489-----998889-9999875015678618985698746789887767
Q gi|254780716|r  140 AS-L--MVGGNEK-----AYNRVE-NILLSISAKYQNSPCCALLGPDGSGHFVKMIHNG  189 (475)
Q Consensus       140 ~s-l--MvGG~~~-----~~~~~~-piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNg  189 (475)
                      +. .  +..+++.     +++++. --+..+..+   .+-+.-+|.+=+-..-=.+||.
T Consensus       181 ~~t~a~~~~~~~~aPGQ~t~~~l~~y~~~~~~~~---tk~fgviG~PI~HS~SP~lHN~  236 (477)
T PRK09310        181 AFNYAAGIGAPPVAPGQLSLEHLLFYNYANLSAQ---SHIYGLIGDPVDRSISHLSHNP  236 (477)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC---CCEEEEECCCHHHCCCHHHHHH
T ss_conf             6412455566668988777999998776056856---7489998176231338999999


No 209
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=96.42  E-value=0.041  Score=35.14  Aligned_cols=82  Identities=20%  Similarity=0.400  Sum_probs=59.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.||+.++.++++++.......+.                .+-.-|.+.+.++
T Consensus        12 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~----------------~~~~Dvtd~~~v~   75 (278)
T PRK08277         12 VAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAI----------------ALKADVLDKESLE   75 (278)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHH
T ss_conf             899958674899999999998799899997988999999999984599099----------------9982489999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        76 ~~~~~~~~~~G~iDiLVNnA   95 (278)
T PRK08277         76 QARQQILKDFGRCDILINGA   95 (278)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999849988899889


No 210
>PRK07024 short chain dehydrogenase; Provisional
Probab=96.42  E-value=0.083  Score=32.88  Aligned_cols=83  Identities=16%  Similarity=0.246  Sum_probs=60.6

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             998805698157-1116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |++ +|=+.|-. -+|..+|+.|+++|++|.+.+|+.++.+++.++...  ..+                ..+-+-|.+.
T Consensus         1 M~~-~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~~--~~~----------------~~~~~Dv~d~   61 (256)
T PRK07024          1 MPL-KVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLPK--ARV----------------SVYAADVRDA   61 (256)
T ss_pred             CCC-EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--CCE----------------EEEEECCCCH
T ss_conf             999-899984602999999999998899899998988999999997679--976----------------9998117999


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEC
Q ss_conf             69999999997207899899967
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~  102 (475)
                      +.++++++.+......-|++|..
T Consensus        62 ~~~~~~~~~~~~~~g~iDilinN   84 (256)
T PRK07024         62 DALAAAAADFIAAHGCPDVVIAN   84 (256)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999999983998799988


No 211
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated
Probab=96.42  E-value=0.1  Score=32.24  Aligned_cols=120  Identities=15%  Similarity=0.120  Sum_probs=93.3

Q ss_pred             CCEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             880569815-7111688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.|-+.|+ |.-|+--++++.+-|.+|.+- .+|.|       +......+..+++++|.++.. .++.-++.||+..+
T Consensus         8 ~trv~vqGiTG~~g~~h~~~m~~yGT~iVaG-VtPgk-------gG~~~~gvPVf~tV~eAv~~~-~~d~svIfVPp~~a   78 (289)
T PRK05678          8 DTKVIVQGITGKQGTFHTEQMLAYGTKIVGG-VTPGK-------GGTTHLGLPVFNTVKEAVEAT-GATASVIYVPPPFA   78 (289)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHCCCEEEE-ECCCC-------CCEEEECCCCCCCHHHHHHHC-CCCEEEEEECHHHH
T ss_conf             9839998788837779999999868956999-77997-------851765833306599998612-88869997078999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             9999999972078998999679865789999999998479943067546760
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      .|.+++-+-..+  ..+++-+--....|+.+..+.++++|.+.++.---|--
T Consensus        79 ~dAi~EAi~agI--~~iV~ITEgiP~~D~~~i~~~a~~~g~riIGPNc~GiI  128 (289)
T PRK05678         79 ADAILEAIDAGI--DLIVCITEGIPVLDMLEVKRYLKGKKTRLIGPNCPGII  128 (289)
T ss_pred             HHHHHHHHHCCC--CEEEEECCCCCHHHHHHHHHHHHHCCCEEECCCCCEEE
T ss_conf             999999986799--88999438997888999999873079889889997016


No 212
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=96.40  E-value=0.048  Score=34.62  Aligned_cols=82  Identities=18%  Similarity=0.260  Sum_probs=60.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.||+.++.++.+++.......+                ..+..-+.+.+.++
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~Dvt~~~~v~   75 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEA----------------HGYVCDVTDEDGIQ   75 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHHH
T ss_conf             89995857689999999999869999999599899999999999549917----------------99993289999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+...+..=|++|...
T Consensus        76 ~~~~~~~~~~g~iDiLVnNA   95 (265)
T PRK07097         76 AMVAQIEKEVGVIDILVNNA   95 (265)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999829998999899


No 213
>PRK08644 thiamine biosynthesis protein ThiF; Provisional
Probab=96.39  E-value=0.029  Score=36.24  Aligned_cols=120  Identities=17%  Similarity=0.226  Sum_probs=69.5

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             98805698157111688999997898-5999739989999999712211-278403289899986057788999976990
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      ++++|-+||+|-.|.+.|..|++.|. ++.+.|.+.=....+..+.-.. .-+-.-+...++....++ |.+-+..++.-
T Consensus        26 ~~s~VlivG~GGLG~~~a~~La~aGVG~i~lvD~D~Ve~SNL~RQ~~~~~diG~~Ka~~a~~~l~~iN-p~v~I~~~~~~  104 (209)
T PRK08644         26 KKAKVGIAGAGGLGSNIAVALARSGVGNLKLVDFDVVEPSNLNRQQYFISQIGMFKVEALKENLLRIN-PFVKIEVHQVK  104 (209)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCEECCCCCCCCCCCHHHCCCCHHHHHHHHHHHHC-CCEEEEEEECC
T ss_conf             62968998887889999999999389818998899901541103756787759756999999987448-98289997224


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHH-HCCCCEECC
Q ss_conf             699999999972078998999679865789999999998-479943067
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS-EKGIYFIGI  127 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~-~kgi~fid~  127 (475)
                       ...+-+.++   ++.-|+||||+-. +..-..+.+.+. ..++-++.+
T Consensus       105 -l~~~n~~~l---~~~~DiViDctDN-~~tR~li~~~c~~~~~~plV~a  148 (209)
T PRK08644        105 -IDEDNIEEL---FKDCDIVVEAFDN-AETKAMLVETVLEKKGKKVVSA  148 (209)
T ss_pred             -CCHHHHHHH---HHCCCEEEECCCC-HHHHHHHHHHHHHHCCCCEEEE
T ss_conf             -898999999---8579999999999-9999999999999779968999


No 214
>PRK06180 short chain dehydrogenase; Provisional
Probab=96.39  E-value=0.093  Score=32.52  Aligned_cols=84  Identities=21%  Similarity=0.326  Sum_probs=62.1

Q ss_pred             CCCCEEEEE-EC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698-15-7111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII-GL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI-GL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+..++-+| |- .=+|..+|+.|+++|++|.+..|+.++.+++.+....   ..                ..+.+-|.+
T Consensus         1 M~~~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~~~~~---~~----------------~~~~~Dvtd   61 (277)
T PRK06180          1 MASMKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEALHPG---RA----------------LARVLDVTD   61 (277)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC---CE----------------EEEEEECCC
T ss_conf             99998899917873999999999998799999998999999999986799---57----------------999983799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++.+.....+=|++|...
T Consensus        62 ~~~v~~~v~~~~~~~G~iDvLVNNA   86 (277)
T PRK06180         62 FDAIDGVVADAEATVGPIDVLVNNA   86 (277)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999819986999899


No 215
>PRK07677 short chain dehydrogenase; Provisional
Probab=96.39  E-value=0.044  Score=34.92  Aligned_cols=81  Identities=20%  Similarity=0.332  Sum_probs=58.5

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+++.++-......+                ..+-.-|.+.+.++
T Consensus         5 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~----------------~~~~~Dv~~~~~v~   68 (254)
T PRK07677          5 VVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQV----------------LTVQMDVRNPDDVQ   68 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHH
T ss_conf             89995876789999999999879999999699999999999998569909----------------99980389999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      .+++.+......=|++|..
T Consensus        69 ~~v~~~~~~~g~iDiLVnN   87 (254)
T PRK07677         69 KMIEQIDEKFGRIDALINN   87 (254)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999983998889975


No 216
>PRK12749 quinate/shikimate dehydrogenase; Reviewed
Probab=96.38  E-value=0.037  Score=35.49  Aligned_cols=13  Identities=15%  Similarity=0.056  Sum_probs=5.5

Q ss_pred             EEECCHHHHHHHH
Q ss_conf             9739989999999
Q gi|254780716|r   31 VYNKDFELTDVFI   43 (475)
Q Consensus        31 vydr~~~~~~~l~   43 (475)
                      .++..++..++++
T Consensus        41 ~~~v~~~~l~~~~   53 (288)
T PRK12749         41 AFEVDNDSFPGAI   53 (288)
T ss_pred             EEECCHHHHHHHH
T ss_conf             8877888899999


No 217
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.36  E-value=0.11  Score=32.01  Aligned_cols=121  Identities=14%  Similarity=0.162  Sum_probs=65.4

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHCCCCCCCCE-ECCCHHHHHHHCCCCCEEEEE--C
Q ss_conf             9880569815711168899999789859997399--8999999971221127840-328989998605778899997--6
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKD--FELTDVFIKKISGLSQKVI-VTKNLEQMVEAVCKPRKILMM--V   76 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~--~~~~~~l~~~~~~~~~~~~-~~~s~~e~v~~l~~pr~Iil~--v   76 (475)
                      ++++|-++|+|.=|.+.|+-|.+.|++|.++|..  ++..+.+.+++...  .+. +..+. +.   ++..+.|+.+  +
T Consensus         6 ~~k~vlV~GlG~sG~a~a~~L~~~G~~V~~~D~~~~~~~~~~l~~~~~~~--~~~~g~~~~-~~---~~~~d~vV~SPGI   79 (501)
T PRK02006          6 QRPMVLVLGLGESGLAMARWCARHGCRLRVADTREAPPNLAALQAEGIDA--EFVGGAFDP-AL---LDGVELVALSPGL   79 (501)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCC--EEECCCCCH-HH---HCCCCEEEECCEE
T ss_conf             89839998336889999999997898499998999986199998608981--897788986-78---4689999989900


Q ss_pred             C-CHHHHHHHH-----------H------HHHHCCCC-----CCEE-EECCCCCHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             9-906999999-----------9------99720789-----9899-96798657899999999984799430675
Q gi|254780716|r   77 T-DGDPVDQLI-----------D------KLKPLLSP-----EDIL-LDGGNSHFCDTQIRSLQLSEKGIYFIGIG  128 (475)
Q Consensus        77 p-~g~~v~~vi-----------~------~l~~~l~~-----g~ii-ID~sts~~~~t~~~~~~l~~kgi~fid~p  128 (475)
                      | ..+.+..++           .      ..++.+..     ..+| |-+||---..|.-.+..|+..|....-+|
T Consensus        80 ~p~~p~~~~~l~~A~~~gi~i~~eiel~~~~~~~~~~~~~~~~~iIaVTGTnGKTTTt~li~~iL~~~g~~~~~~G  155 (501)
T PRK02006         80 SPLEPALAALLAAARERGIPVWGELELFAQALAALGASRGYAPKVLAITGTNGKTTTTSLTGLLCERAGKKVAVAG  155 (501)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             8888543199999998799587689999988763022235687489993899668799999999997699746525


No 218
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenas
Probab=96.33  E-value=0.071  Score=33.36  Aligned_cols=100  Identities=22%  Similarity=0.273  Sum_probs=60.5

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC---C-CC--CCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             5698157111688999997898-59997399899999997122---1-12--7840328989998605778899997699
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS---G-LS--QKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~---~-~~--~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++||.|..|..+|..|+.+|. ++..+|+++++++..+....   . ..  ..+.+..+.++    ++..++|+++--.
T Consensus         1 V~IIGaG~VG~~~a~~l~~~~~~el~L~D~~~~~a~g~a~DL~~~~~~~~~~~~v~~~~d~~~----~~daDvvVitaG~   76 (300)
T cd01339           1 ISIIGAGNVGATLAQLLALKELGDVVLLDIVEGLPQGKALDISQAAPILGSDTKVTGTNDYED----IAGSDVVVITAGI   76 (300)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHH----HCCCCEEEEECCC
T ss_conf             989896888999999998579967999809998005798877613201589858994788799----4799899990677


Q ss_pred             ----H-----------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             ----0-----------699999999972078998999679865789999
Q gi|254780716|r   79 ----G-----------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        79 ----g-----------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                          |           +.+.++...+..+- |..+++-.+  +|-|+.-
T Consensus        77 ~~k~g~tR~dLl~~N~~I~~~i~~~i~~~~-p~~i~lvvs--NPvDv~t  122 (300)
T cd01339          77 PRKPGMSRDDLLGTNAKIVKEVAENIKKYA-PNAIVIVVT--NPLDVMT  122 (300)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEECC--CCHHHHH
T ss_conf             899899889999988999999999999659-984899827--9389999


No 219
>PRK07774 short chain dehydrogenase; Provisional
Probab=96.33  E-value=0.047  Score=34.69  Aligned_cols=82  Identities=18%  Similarity=0.291  Sum_probs=60.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||++++.++..++-........                .+-.-|.+.+.++
T Consensus         8 ~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~----------------~~~~Dv~~~~~v~   71 (250)
T PRK07774          8 VAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAI----------------AVQVDVSDPDSAK   71 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHH
T ss_conf             899979768899999999998699999997988999999999985598499----------------9982589999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++........=|++|...
T Consensus        72 ~~~~~~~~~fG~iDilVNnA   91 (250)
T PRK07774         72 AMADRTVSAFGGIDYLVNNA   91 (250)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999839998999888


No 220
>PRK06346 consensus
Probab=96.32  E-value=0.045  Score=34.85  Aligned_cols=83  Identities=16%  Similarity=0.325  Sum_probs=61.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +-+|  |-+-+|..+|+.|++.|.+|.+.||+.++.+++.++.......+                ..+..-|.+.+.++
T Consensus         7 v~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~----------------~~~~~Dv~~~~~v~   70 (251)
T PRK06346          7 VAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTA----------------IAVVANVTKQEDIE   70 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE----------------EEEECCCCCHHHHH
T ss_conf             89994757889999999999879989999798999999999999639908----------------99977889899999


Q ss_pred             HHHHHHHHCCCCCCEEEECCC
Q ss_conf             999999720789989996798
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~st  104 (475)
                      .++++......+=|++|...-
T Consensus        71 ~~i~~~~~~fg~iDiLVnNAg   91 (251)
T PRK06346         71 NMVDTAVDTYGTLDILVNNAG   91 (251)
T ss_pred             HHHHHHHHHCCCCCEEEECCC
T ss_conf             999999998299979998998


No 221
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=96.31  E-value=0.06  Score=33.94  Aligned_cols=82  Identities=10%  Similarity=0.257  Sum_probs=60.2

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|++++.++..++.......+                ..+..-|.+.+.++
T Consensus        16 ~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~----------------~~~~~Dv~~~~~v~   79 (259)
T PRK06124         16 VALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAA----------------EALVFDISDEEAVA   79 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHHH
T ss_conf             89992867489999999999879999999698899999999999659958----------------99995179999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+......=|++|...
T Consensus        80 ~~~~~~~~~~g~iDiLVnnA   99 (259)
T PRK06124         80 AAFARIDAEHGRLDILVNNV   99 (259)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999759997999898


No 222
>COG5495 Uncharacterized conserved protein [Function unknown]
Probab=96.31  E-value=0.11  Score=31.83  Aligned_cols=181  Identities=14%  Similarity=0.177  Sum_probs=92.0

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157111688999997898599-9739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ..|||||.|..|.....+-.+.++... +-.|++.+++.+.+...         ..+.|+..+.+.-..++..+|+. ..
T Consensus        11 ~~v~~igtGrl~ra~~~ra~h~~~~cs~i~srS~~~a~~LaE~~~---------a~p~d~~~~ael~~~vfv~vpd~-~~   80 (289)
T COG5495          11 VVVGIVGTGRLGRAALLRADHVVVACSAISSRSRDRAQNLAETYV---------APPLDVAKSAELLLLVFVDVPDA-LY   80 (289)
T ss_pred             EEEEEEECCHHHHHHHHHHHHHHEEEHHHHHCCHHHHHHHHHHCC---------CCCCCHHHCHHHHCEEEECCCHH-HH
T ss_conf             588876044278999987400321211343217899862044217---------99510120734515478626088-88


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE----ECCCCCCCCCCCC--CCCEEEE-ECCHHHHHHHH
Q ss_conf             999999972078998999679865789999999998479943----0675467600035--6843788-45489998889
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF----IGIGVSGGVKGAR--SGASLMV-GGNEKAYNRVE  155 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~f----id~pVSGG~~gA~--~G~slMv-GG~~~~~~~~~  155 (475)
                      -.|...  ..-.||.|++-||-..-.   .+-+.+...|.--    --+--||-++.+.  .+..+.+ -+|+--|..++
T Consensus        81 ~~vaa~--~~~rpg~iv~HcSga~~~---~il~~~gr~g~~~asiHP~f~Fsgl~edl~rl~d~~~~i~eaD~~g~ai~~  155 (289)
T COG5495          81 SGVAAT--SLNRPGTIVAHCSGANGS---GILAPLGRQGCIPASIHPAFSFSGLDEDLSRLKDTIFGITEADDVGYAIVQ  155 (289)
T ss_pred             HHHHHH--CCCCCCEEEEECCCCCCH---HHHHHHHHCCCCCCEECCCHHCCCCHHHHHHCCCCEEEEECCCCCCCHHHH
T ss_conf             888876--046898389974688740---454254215875300052110368888998654347865305655528999


Q ss_pred             HHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHC
Q ss_conf             999987501567861898569874678988776787888---999899999999642
Q gi|254780716|r  156 NILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYAN---MQLIADIYGILRDSL  209 (475)
Q Consensus       156 piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~---mq~iaE~~~~l~~~~  209 (475)
                      .+-..|+    ++|.|.   +.+.   -|+.|-+--|+-   .-+++|+..+.+-.+
T Consensus       156 ~la~emg----g~~f~V---~~~~---r~lYHaaa~~asnf~v~~l~~a~~i~~aag  202 (289)
T COG5495         156 SLALEMG----GEPFCV---REEA---RILYHAAAVHASNFIVTVLADALEIYRAAG  202 (289)
T ss_pred             HHHHHHC----CCCEEE---CHHH---HHHHHHHHHHHHCCHHHHHHHHHHHHHHHC
T ss_conf             9999838----984452---5567---899887777641019999998999999845


No 223
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342   The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants . It is a seven-step pathway which converts phosphoenolpyruvate and erythrose 4-phosphate to chorismate, the common precursor for the synthesis of folic acid, ubiquinone, vitamins E and K, and aromatic amino acids. Since this pathway is absent in metazoans, which must therefore obtain the essential amino acids phenylalanine and tryptophan from their diet, the enzymes in this pathway are important targets for the development of novel herbicides and antimicrobial compounds.   This entry represents shikimate 5-dehydrogenases from prokaryotes and functionally equivalent C-terminal domains from larger, multifunctional proteins, the majority of which have an N-terminal quinate dehydrogenase domain. These multifunctional proteins occur in plants, chlamydiae, planctomycetes and a limited number of marine proteobacteria. Shikimate 5-dehydrogenase catalyses the fourth step of the shikimate pathway, which is the NADP-dependent reduction of 3-dehydroshikimate to shikimate .   Structural studies suggests that some shikimate dehydrogenases are monmers while others form homodimers , . Each shikimate dehydrogenase monomer forms a compact two-domain alpha/beta sandwich with a deep interdomain cleft. The N-terminal substrate-binding domain forms a three layer alpha-beta-alpha sandwich, while the C-terminal NADP-binding domain forms a nearly typical Rossman fold. The active site is thought to be located within the interdomain cleft, with substrate binding causing a conformational change which closes the active site cleft, forming a productive active site.; GO: 0004764 shikimate 5-dehydrogenase activity, 0050661 NADP binding.
Probab=96.29  E-value=0.016  Score=38.12  Aligned_cols=120  Identities=17%  Similarity=0.228  Sum_probs=81.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHCCC---CCCCCEECCCHHHHHHHCCC--CCEEEEEC
Q ss_conf             88056981571116889999978-98599973998999999971221---12784032898999860577--88999976
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISG---LSQKVIVTKNLEQMVEAVCK--PRKILMMV   76 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~-G~~V~vydr~~~~~~~l~~~~~~---~~~~~~~~~s~~e~v~~l~~--pr~Iil~v   76 (475)
                      ..+|-+||-|==++++|..|.+. +-+|.+.|||.+|++++++..+.   ..-+-..+-+.+|+-  +++  -++||=+.
T Consensus       121 ~~~~li~GAGGAa~a~a~~L~~~t~~~~~i~NRT~~ka~~La~~~~~kln~~~G~~~~~~~~~~~--l~~G~~DlIINAT  198 (286)
T TIGR00507       121 NQRVLIIGAGGAAKAVALELLKATDCNVIIANRTVEKAEELAERFQRKLNKKYGEIQAFSLDEVP--LHKGKVDLIINAT  198 (286)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCEEEEECCCCC--CCCCCEEEEEECC
T ss_conf             97799994286789999999860099789982877899999999898853424853652113355--5578567998546


Q ss_pred             CCHHH--HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCC-CCEEC
Q ss_conf             99069--9999999972078998999679865789999999998479-94306
Q gi|254780716|r   77 TDGDP--VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG-IYFIG  126 (475)
Q Consensus        77 p~g~~--v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kg-i~fid  126 (475)
                      |.|=.  ++++ .=....++++.++.|+-...-.+|- .-++|+++| ..++|
T Consensus       199 s~G~~~~~~~~-~v~~~~~~~~~~v~D~~Y~p~t~Tp-fl~~Ak~~g~~~~~d  249 (286)
T TIGR00507       199 SAGMSGNIDEP-PVPAELLKEGKLVYDLVYNPLTETP-FLKEAKKRGLTKVID  249 (286)
T ss_pred             CCCCCCCCCCC-CCCHHHCCCCCEEEECCCCCCCCCH-HHHHHHHCCCCCCCC
T ss_conf             77888898874-5685341688689951468865577-899998768856545


No 224
>PRK06949 short chain dehydrogenase; Provisional
Probab=96.28  E-value=0.1  Score=32.17  Aligned_cols=82  Identities=15%  Similarity=0.214  Sum_probs=61.1

Q ss_pred             EEEEECCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             56981571-11688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIGLGS-MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIGLG~-MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +=+-|-+. +|..+|+.|++.|.+|.+.+|+.++.+++.++-.......                ..+-.-|.+.+.++.
T Consensus        12 alVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~----------------~~~~~Dv~~~~~v~~   75 (258)
T PRK06949         12 ALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAA----------------HVVSLDVTDYQSIKA   75 (258)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHHH
T ss_conf             9995857799999999999879999999698899999999999659928----------------999826899999999


Q ss_pred             HHHHHHHCCCCCCEEEECC
Q ss_conf             9999972078998999679
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~s  103 (475)
                      +++.+...+.+=||+|...
T Consensus        76 ~v~~~~~~~G~iDiLVnnA   94 (258)
T PRK06949         76 AVAHAETEAGTIDILVNNS   94 (258)
T ss_pred             HHHHHHHHHCCCCEEEECC
T ss_conf             9999999849998999899


No 225
>PRK07890 short chain dehydrogenase; Provisional
Probab=96.28  E-value=0.058  Score=34.00  Aligned_cols=83  Identities=18%  Similarity=0.319  Sum_probs=61.3

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.++..++-......+.                .+-.-|.+.+.+
T Consensus         6 K~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~----------------~~~~Dv~~~~~~   69 (258)
T PRK07890          6 KVVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRRAL----------------AVVTDITDEAQV   69 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8899968565899999999998799899997989999999999996499589----------------998169999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+......=|++|...
T Consensus        70 ~~~v~~~~~~fG~iDiLVnnA   90 (258)
T PRK07890         70 ANLVDAALERFGRVDVLVNNA   90 (258)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999849998999868


No 226
>PRK06482 short chain dehydrogenase; Provisional
Probab=96.28  E-value=0.11  Score=32.09  Aligned_cols=82  Identities=21%  Similarity=0.314  Sum_probs=60.4

Q ss_pred             CCCCEEEEE-E-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698-1-57111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII-G-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI-G-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+|  +-|| | -+-+|..+|+.++++|+.|.+..|++++.+++.+...   .++                .++-+-|.+
T Consensus         1 M~K--v~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~~~---~~~----------------~~~~~Dvt~   59 (276)
T PRK06482          1 MTK--TWFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKARYG---ERL----------------WVLQLDVTD   59 (276)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---CCE----------------EEEEEECCC
T ss_conf             997--89991586599999999999889989999789899999998669---957----------------999953799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++........=|++|...
T Consensus        60 ~~~v~~~v~~~~~~~G~iDvLVNNA   84 (276)
T PRK06482         60 TAAVRAVVDRAFAELGRIDVVVSNA   84 (276)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             9999999999999809987887468


No 227
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=96.28  E-value=0.055  Score=34.20  Aligned_cols=83  Identities=16%  Similarity=0.250  Sum_probs=60.6

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.|+++++.++..++-......+                ..+-.-|.+.+.++
T Consensus        11 ~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~----------------~~~~~Dvtd~~~v~   74 (254)
T PRK08085         11 NILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKA----------------HAAAFNVTHKQEIE   74 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE----------------EEEECCCCCHHHHH
T ss_conf             89996856789999999999869999999698899999999998449818----------------99982689999999


Q ss_pred             HHHHHHHHCCCCCCEEEECCC
Q ss_conf             999999720789989996798
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~st  104 (475)
                      ..++.+.....+=|++|...-
T Consensus        75 ~~v~~~~~~~G~iDilVnNAG   95 (254)
T PRK08085         75 AAIEHIEKDIGPIDVLINNAG   95 (254)
T ss_pred             HHHHHHHHHHCCCCEEEECCC
T ss_conf             999999998399869998986


No 228
>COG2344 AT-rich DNA-binding protein [General function prediction only]
Probab=96.25  E-value=0.016  Score=38.16  Aligned_cols=81  Identities=20%  Similarity=0.337  Sum_probs=54.2

Q ss_pred             CEEEEEECCHHHHHHHHH-HH-HCCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999-99-789859-997399899999997122112784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLN-IL-DKGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~n-L~-~~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      .++-+||.|++|.+++.. +. ++|+++ .+||.+++++-..+..     -.+....++++++... ..++.+++||+. 
T Consensus        85 tnviiVG~GnlG~All~Y~f~~~~~~~iv~~FDv~~~~VG~~~~~-----v~V~~~d~le~~v~~~-dv~iaiLtVPa~-  157 (211)
T COG2344          85 TNVIIVGVGNLGRALLNYNFSKKNGMKIVAAFDVDPDKVGTKIGD-----VPVYDLDDLEKFVKKN-DVEIAILTVPAE-  157 (211)
T ss_pred             EEEEEECCCHHHHHHHCCCCHHHCCCEEEEEECCCHHHHCCCCCC-----EEEECHHHHHHHHHHC-CCCEEEEECCHH-
T ss_conf             348999057088898607423326935999961787883752488-----1455268888898861-761899973489-


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999972
Q gi|254780716|r   81 PVDQLIDKLKP   91 (475)
Q Consensus        81 ~v~~vi~~l~~   91 (475)
                      ...++.+.|..
T Consensus       158 ~AQ~vad~Lv~  168 (211)
T COG2344         158 HAQEVADRLVK  168 (211)
T ss_pred             HHHHHHHHHHH
T ss_conf             89999999998


No 229
>PRK12939 short chain dehydrogenase; Provisional
Probab=96.25  E-value=0.066  Score=33.60  Aligned_cols=83  Identities=12%  Similarity=0.168  Sum_probs=59.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|++|.+.+|+.++.++..++.......+.                .+-.-|.+.+.+
T Consensus         8 KvalVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~----------------~~~~Dv~~~~~~   71 (250)
T PRK12939          8 KRALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAH----------------AIAADLADPASV   71 (250)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEEECCCCHHHH
T ss_conf             8799958366899999999998799999996988999999999995599099----------------999248999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+++........=|++|...
T Consensus        72 ~~~~~~~~~~~g~iDiLVNNA   92 (250)
T PRK12939         72 QRFFDAAAAALGGLDGLVNNA   92 (250)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999749997999887


No 230
>PRK05866 short chain dehydrogenase; Provisional
Probab=96.24  E-value=0.045  Score=34.84  Aligned_cols=76  Identities=18%  Similarity=0.324  Sum_probs=56.8

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHH
Q ss_conf             71116889999978985999739989999999712211278403289899986057788999976990699999999972
Q gi|254780716|r   12 GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKP   91 (475)
Q Consensus        12 G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~   91 (475)
                      .-+|..+|+.|++.|.+|.+.+|+.++.+++.++....+..+.                .+-.-|.+.+.++++++.+..
T Consensus        50 sGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~~~----------------~~~~Dvtd~~~v~~~v~~~~~  113 (290)
T PRK05866         50 SGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGDAM----------------AIPCDLSDLDAVDALVADVEE  113 (290)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHHHHHHHHHH
T ss_conf             0999999999998699899998999999999999996499089----------------997788989999999999999


Q ss_pred             CCCCCCEEEECC
Q ss_conf             078998999679
Q gi|254780716|r   92 LLSPEDILLDGG  103 (475)
Q Consensus        92 ~l~~g~iiID~s  103 (475)
                      ....=||+|...
T Consensus       114 ~~G~iDiLVNNA  125 (290)
T PRK05866        114 RIGGVDILINNA  125 (290)
T ss_pred             HHCCCCEEEECC
T ss_conf             859988899757


No 231
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=96.23  E-value=0.073  Score=33.26  Aligned_cols=83  Identities=13%  Similarity=0.185  Sum_probs=59.5

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|+++|++|.+.+|+.++.++..++......++                ..+-.-+.+.+.+
T Consensus         7 K~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~----------------~~~~~Dl~~~~~~   70 (253)
T PRK12826          7 RVALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKA----------------RAYQVDVRDRAAL   70 (253)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCE----------------EEEEEECCCHHHH
T ss_conf             889994897789999999999879989999898899999999998509958----------------9999517999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+.....+=|++|...
T Consensus        71 ~~~~~~~~~~~g~iD~lvnnA   91 (253)
T PRK12826         71 KALVAAGVERFGRLDILVANA   91 (253)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999839987899899


No 232
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=96.23  E-value=0.13  Score=31.52  Aligned_cols=52  Identities=15%  Similarity=0.210  Sum_probs=27.8

Q ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHH-HHHHHHHH
Q ss_conf             35684378845489998889999987501567861898569874678-98877678
Q gi|254780716|r  136 ARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF-VKMIHNGI  190 (475)
Q Consensus       136 A~~G~slMvGG~~~~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~-vKMVhNgI  190 (475)
                      -..|..+++=|+++..++....|.   .+...-.-|.-+|.+--|.+ +|+..+++
T Consensus       203 l~~gD~l~vig~~~~i~~~~~~~g---~~~~~~~~v~I~Ggg~ig~~la~~L~~~~  255 (455)
T PRK09496        203 IEAGDEVFFVAASEHIRRVMSELG---RLEKPVKRIMIAGGGNIGLYLAKLLEKGY  255 (455)
T ss_pred             EECCCEEEEEECHHHHHHHHHHHC---CCCCCCCEEEEECCCHHHHHHHHHHHCCC
T ss_conf             733889999925776999999858---65466651899878699999999874088


No 233
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=96.22  E-value=0.037  Score=35.47  Aligned_cols=173  Identities=18%  Similarity=0.322  Sum_probs=100.5

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             116889999978985999739989-9999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFE-LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~-~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
                      .|+++|+.|++.|.+|.+.+++.+ +++++.++....+-...                .+-+=|.+.+.++++++++...
T Consensus        10 IG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~----------------~~~~dvs~~~~~~~~~~~~~~~   73 (238)
T TIGR01830        10 IGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAA----------------GVVLDVSDREDVKALVEEAEEE   73 (238)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEE----------------EEEECCCCHHHHHHHHHHHHHH
T ss_conf             679999999867995999659825788899999985697599----------------9960388889999999999998


Q ss_pred             CCCCCEEEEC------------CCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             7899899967------------9865789999999998479943067546760003568437884548999888999998
Q gi|254780716|r   93 LSPEDILLDG------------GNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        93 l~~g~iiID~------------sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
                      +. =||+|.=            +-..|++.++..-                                +.+|.-++.+++.
T Consensus        74 ~G-iDiLVNNAGITrD~Ll~RMk~edWd~Vi~~NL--------------------------------~g~F~~t~~v~~~  120 (238)
T TIGR01830        74 LG-IDILVNNAGITRDNLLMRMKEEDWDAVINVNL--------------------------------KGVFNLTQAVLRP  120 (238)
T ss_pred             HC-CEEEEECCCCCCCCHHCCCCHHHHHHHHHHHH--------------------------------HHHHHHHHHHHHH
T ss_conf             29-90899787413430100488556899998612--------------------------------6687888998898


Q ss_pred             HHCCCCCC-----CEEEEECCCCHHHHHH----HH----------------HH-----HHHHHHHHHHHHHH--H-----
Q ss_conf             75015678-----6189856987467898----87----------------76-----78788899989999--9-----
Q gi|254780716|r  161 ISAKYQNS-----PCCALLGPDGSGHFVK----MI----------------HN-----GIEYANMQLIADIY--G-----  203 (475)
Q Consensus       161 iaak~~~~-----~cv~y~G~~GsGh~vK----MV----------------hN-----gIey~~mq~iaE~~--~-----  203 (475)
                      |-.+=.|.     .=|..+|.+|...|.=    ||                -|     -|+=-|-..+.|--  .     
T Consensus       121 M~K~R~GrIINisSVVG~~GN~GQaNYaASKAG~IGftKSlAkElasRnItVNaVAPGFI~TdMT~~L~e~~~~~~l~~I  200 (238)
T TIGR01830       121 MIKQRSGRIINISSVVGLMGNAGQANYAASKAGVIGFTKSLAKELASRNITVNAVAPGFIETDMTDKLSEKVKKAMLSQI  200 (238)
T ss_pred             HHHHCCCCEEEEEEHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHCCHHHHHHHHHCC
T ss_conf             87506743486100200006874267888875589999999986036870588874899897000216988999998527


Q ss_pred             HHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             99964289978999999860688443079999999997
Q gi|254780716|r  204 ILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS  241 (475)
Q Consensus       204 ~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~  241 (475)
                      .|++. + .|+|||.+-... -++..||   ||-++|.
T Consensus       201 PLgR~-G-~pEeVA~~v~FL-ASd~AsY---ITGqv~~  232 (238)
T TIGR01830       201 PLGRF-G-TPEEVANAVAFL-ASDEASY---ITGQVIH  232 (238)
T ss_pred             CCCCC-C-CHHHHHHHHHHH-CCCCCCC---CCCCEEE
T ss_conf             72326-7-765699999973-2512474---2551663


No 234
>PRK07832 short chain dehydrogenase; Provisional
Probab=96.21  E-value=0.062  Score=33.79  Aligned_cols=77  Identities=14%  Similarity=0.226  Sum_probs=55.2

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHH
Q ss_conf             71116889999978985999739989999999712211278403289899986057788999976990699999999972
Q gi|254780716|r   12 GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKP   91 (475)
Q Consensus        12 G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~   91 (475)
                      +-+|..+|+.|++.|++|.+.||+.++.+++.++.........               ..+-+-|.+.+.++++.+.+..
T Consensus        10 sGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~---------------~~~~~Dvsd~~~v~~~~~~~~~   74 (272)
T PRK07832         10 SGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGTVP---------------EHRALDISDYDAVAAFAADIHA   74 (272)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE---------------EEEECCCCCHHHHHHHHHHHHH
T ss_conf             1999999999998899899998988999999999984589714---------------7885668999999999999999


Q ss_pred             CCCCCCEEEECC
Q ss_conf             078998999679
Q gi|254780716|r   92 LLSPEDILLDGG  103 (475)
Q Consensus        92 ~l~~g~iiID~s  103 (475)
                      ...+=|++|...
T Consensus        75 ~~g~iDiLiNNA   86 (272)
T PRK07832         75 AHPSMDVVMNIA   86 (272)
T ss_pred             HCCCCCEEEECC
T ss_conf             729988899878


No 235
>KOG2012 consensus
Probab=96.21  E-value=0.028  Score=36.33  Aligned_cols=120  Identities=16%  Similarity=0.208  Sum_probs=77.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCC---CCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             998805698157111688999997898-59997399899999997122112---78403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLS---QKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~---~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |..++|=+.|||-.|.-+|+|+.-.|. .|..||..+-...++..+.--..   ..-++..+.+-+++ |+.  -|-..+
T Consensus        35 m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf~L~E~DigknRA~as~~~Lae-LN~--yV~V~v  111 (1013)
T KOG2012          35 MQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQFYLSEEDIGKNRAEASVEKLAE-LNN--YVPVVV  111 (1013)
T ss_pred             HHHCCEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCEEEEHHHCCCCHHHHHHHHHHH-HHC--CEEEEE
T ss_conf             75186887627753289986671204504785078765387622450633886087668889999998-626--522697


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCC
Q ss_conf             9906999999999720789989996798657899999999984799430675467
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSG  131 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSG  131 (475)
                      -++..++       ..|+.=++||-+ +....+..++...|.+.||.||.|-+-|
T Consensus       112 ~t~~~~~-------e~L~~FqvVVlt-~~~le~q~~i~~fch~~~i~fi~ad~RG  158 (1013)
T KOG2012         112 LTGPLTE-------EFLSDFQVVVLT-DASLEEQLKINDFCHSHGIAFIAADTRG  158 (1013)
T ss_pred             ECCCCCH-------HHHHCCCEEEEE-CCCHHHHHHHHHHHHHCCEEEEEECCCH
T ss_conf             1476618-------787377189996-5746888879888876481899831310


No 236
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.21  E-value=0.064  Score=33.71  Aligned_cols=78  Identities=17%  Similarity=0.253  Sum_probs=56.6

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|+++|.+|.+.||+.++.++..++.......+                ..+..-|.+.+.+++.++.+
T Consensus        13 as~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~----------------~~~~~Dv~~~~~v~~~~~~~   76 (253)
T PRK08217         13 GAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEA----------------EVYAANVTDEEDVEATFAQI   76 (253)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHHHHHHHH
T ss_conf             87789999999999879989999799999999999999659948----------------99982479999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      .....+=|++|...
T Consensus        77 ~~~~g~iD~lVnNA   90 (253)
T PRK08217         77 AEDFGQLNGLINNA   90 (253)
T ss_pred             HHHHCCCCEEEECC
T ss_conf             99839985999857


No 237
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=96.20  E-value=0.038  Score=35.37  Aligned_cols=104  Identities=14%  Similarity=0.259  Sum_probs=61.7

Q ss_pred             EEEEEECC-HHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHC---CCC-C-CCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             05698157-111688999997898--5999739989999999712---211-2-78403289899986057788999976
Q gi|254780716|r    5 DIGIIGLG-SMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKI---SGL-S-QKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         5 ~IGiIGLG-~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~---~~~-~-~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      +|++||.| +.|+.+|..|+.+|+  ++..+|+++++++......   ... . .......+.++    ++..++|+++-
T Consensus         2 KV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~~~a~g~alDl~~~~~~~~~~~~~~~~~~~~----~~daDiVVita   77 (142)
T pfam00056         2 KVAVVGAGGGVGSSLAFALALQGLADELVLVDINKDKAEGVAMDLSHGSTFLSVPGIVGGDDYEA----LKDADVVVITA   77 (142)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCCCCCCEEECCCCHHH----HCCCCEEEEEC
T ss_conf             89998987789999999997479663478850577641179999861443478876974883888----37899999815


Q ss_pred             CC---------------HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             99---------------0699999999972078998999679865789999999
Q gi|254780716|r   77 TD---------------GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL  115 (475)
Q Consensus        77 p~---------------g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~  115 (475)
                      -.               .+.+.++...+..+- +..++|--  ++|-|+.....
T Consensus        78 G~~~k~g~~R~dll~~Na~I~~~i~~~i~~~~-p~~ivivv--tNPvDvmt~~~  128 (142)
T pfam00056        78 GVPRKPGMTRLDLLNRNAGIFKDIVPAIAKSA-PDAIVLVV--SNPVDILTYIA  128 (142)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-CCEEEEEE--CCCHHHHHHHH
T ss_conf             77789998778999974699999999999769-98199994--59468899999


No 238
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=96.20  E-value=0.11  Score=31.99  Aligned_cols=44  Identities=14%  Similarity=0.258  Sum_probs=34.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHCCC
Q ss_conf             805698157111688999997-898599973998999999971221
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILD-KGFRLAVYNKDFELTDVFIKKISG   48 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~-~G~~V~vydr~~~~~~~l~~~~~~   48 (475)
                      ..|+++|+|-.| .||.-+++ .|.+|+++|++.+|.+...+.++.
T Consensus       168 ~~V~I~G~GGlG-h~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd  212 (339)
T COG1064         168 KWVAVVGAGGLG-HMAVQYAKAMGAEVIAITRSEEKLELAKKLGAD  212 (339)
T ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             899998774899-999999998699699995787799999984882


No 239
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine
Probab=96.20  E-value=0.091  Score=32.59  Aligned_cols=100  Identities=18%  Similarity=0.317  Sum_probs=59.9

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCC---C-CCCCC-EECCCHHHHHHHCCCCCEEEEEC-
Q ss_conf             05698157111688999997898--59997399899999997122---1-12784-03289899986057788999976-
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKIS---G-LSQKV-IVTKNLEQMVEAVCKPRKILMMV-   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~~---~-~~~~~-~~~~s~~e~v~~l~~pr~Iil~v-   76 (475)
                      +|++||.|+.|..+|..|+.++.  ++..+|+++++++..+....   . ..... ....+.++    ++..++|++.- 
T Consensus         2 KI~IIGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~G~a~DL~~~~~~~~~~~~i~~~~~~~----~~~aDvvVitAG   77 (306)
T cd05291           2 KVVIIGAGHVGSSFAYSLVNQGIADELVLIDINEEKAEGEALDLEDALAFLPSPVKIKAGDYSD----CKDADIVVITAG   77 (306)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHH----HCCCCEEEECCC
T ss_conf             5999996988999999998579987799981898701769998870133059973996088788----478999999067


Q ss_pred             -C-------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH
Q ss_conf             -9-------------9069999999997207899899967986578999
Q gi|254780716|r   77 -T-------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ  111 (475)
Q Consensus        77 -p-------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~  111 (475)
                       |             +.+.+.++...+..+ .+..++|-.+|  |-|+.
T Consensus        78 ~~rk~g~~R~dLl~~N~~I~k~i~~~i~~~-~p~aivivvtN--PvDvm  123 (306)
T cd05291          78 APQKPGETRLDLLEKNAKIMKSIVPKIKAS-GFDGIFLVASN--PVDVI  123 (306)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHC-CCCCEEEEECC--CHHHH
T ss_conf             667999987899997899999999998722-99718999358--16789


No 240
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion]
Probab=96.19  E-value=0.098  Score=32.32  Aligned_cols=220  Identities=13%  Similarity=0.139  Sum_probs=128.2

Q ss_pred             CEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             80569815-71116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+-+-|. |.||...+..+++-|..+.+ ..+|-+       +.........+++++|.++.. ..+.-++.||...+.
T Consensus         9 tkvivqGitg~~gtfh~~~~l~yGt~~V~-GvtPgk-------gG~~~~g~PVf~tV~EA~~~~-~a~~svI~Vp~~~aa   79 (293)
T COG0074           9 TKVIVQGITGKQGTFHTEQMLAYGTKIVG-GVTPGK-------GGQTILGLPVFNTVEEAVKET-GANASVIFVPPPFAA   79 (293)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHCCCEEE-CCCCCC-------CCEEECCCCHHHHHHHHHHHH-CCCEEEEECCCHHHH
T ss_conf             74898336542003889999972985664-236897-------743883754789999998702-897799964817789


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             99999997207899899967986578999999999847994306754676000356843788454899988899999875
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSIS  162 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~ia  162 (475)
                      |++++-+-..+  .-+++-.-+....|+.+..++++++|...++.---|.-..-.....+|+|                 
T Consensus        80 dai~EAida~i--~liv~ITEgIP~~D~~~~~~~a~~~g~~iiGPncpGiI~Pg~~kiGimp~-----------------  140 (293)
T COG0074          80 DAILEAIDAGI--KLVVIITEGIPVLDMLELKRYAREKGTRLIGPNCPGIITPGECKIGIMPG-----------------  140 (293)
T ss_pred             HHHHHHHHCCC--CEEEEEECCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCEEEECHH-----------------
T ss_conf             99999985799--57999959998889999999998669799879999637478533510523-----------------


Q ss_pred             CCCCCCCEEEEECCCCHHHHH--HHHHHHHHHHHHHH--HHHHHHHHHHHCCCCHHHHHHHHHHCCC-------CCCCHH
Q ss_conf             015678618985698746789--88776787888999--8999999996428997899999986068-------844307
Q gi|254780716|r  163 AKYQNSPCCALLGPDGSGHFV--KMIHNGIEYANMQL--IADIYGILRDSLNKNPLEISHLFSKWDT-------GKLSSY  231 (475)
Q Consensus       163 ak~~~~~cv~y~G~~GsGh~v--KMVhNgIey~~mq~--iaE~~~~l~~~~~~~~~~i~~vf~~w~~-------~~~~sy  231 (475)
                       +....-+|..++.+|..-|=  ..+++   .++=|.  |+=+=+   ...+.+..+..+.|++=-+       |+...-
T Consensus       141 -~i~~~G~IGiVSrSGTLTyE~~~qlt~---~G~GqS~~IGiGGD---pi~Gt~fid~L~~fe~Dp~T~~ivmiGEiGG~  213 (293)
T COG0074         141 -NIYKPGNIGIVSRSGTLTYEAVSQLTE---AGLGQSTAIGIGGD---PIPGTSFIDALEMFEADPETEAIVMIGEIGGP  213 (293)
T ss_pred             -HHCCCCCEEEEECCCCHHHHHHHHHHH---CCCCEEEEEEECCC---CCCCCCHHHHHHHHHCCCCCEEEEEEECCCCC
T ss_conf             -405788569996686639999999976---38855899985788---76881599999986458674079999267993


Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHCCCCCC
Q ss_conf             99999999974056799952001023336
Q gi|254780716|r  232 LIKITAEILSSSDTITGMPIIDVICDKAS  260 (475)
Q Consensus       232 Ll~i~~~il~~k~~~~g~~lid~i~d~~~  260 (475)
                      -=|-.++.++.+  ..+.|++-.|...-.
T Consensus       214 aEe~AA~~i~~~--~~~KPVVa~iaG~ta  240 (293)
T COG0074         214 AEEEAAEYIKAN--ATRKPVVAYIAGRTA  240 (293)
T ss_pred             HHHHHHHHHHHH--CCCCCEEEEEECCCC
T ss_conf             899999999963--468986999843679


No 241
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=96.16  E-value=0.04  Score=35.22  Aligned_cols=125  Identities=18%  Similarity=0.223  Sum_probs=73.1

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCC--CCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             8805698157111688999997898-599973998999999971221127--8403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQ--KVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~--~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      +++|-+||+|-.|.+.|..|+..|. ++.+.|.+.=...++..+---..+  +-.-+...++....++ |.+-+..++. 
T Consensus       138 ~a~VlivG~GGLGs~~a~yLA~aGVG~i~lvD~D~Ve~SNL~RQil~~~~diG~~Ka~~a~~~L~~~N-p~i~i~~~~~-  215 (379)
T PRK08762        138 RARVLLIGAGGLGSPAAFYLAAAGVGHLRIADHDVVDRSNLQRQILHTEDSVGQPKVDSAAQRIAALN-PRVQVEAVQT-  215 (379)
T ss_pred             HCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHCCCCCHHHCCCHHHHHHHHHHHHHC-CCCCEEEEHH-
T ss_conf             39789988875579999999983797589762886133450112574643355558999999999868-9973385021-


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      ....+.+.++   ++.-|+||||+-. +..-.-....|.+.++-++.+.+.|.+
T Consensus       216 ~l~~~n~~~l---i~~~DlViDctDN-~~tR~liN~~c~~~~~PlV~ga~~g~~  265 (379)
T PRK08762        216 RVTSSNVEAL---LQDVDVVVDGADN-FPARYLLNDACVKLGKPLVYGAVQRFE  265 (379)
T ss_pred             CCCHHHHHHH---HHHCCEEEECCCC-HHHHHHHHHHHHHHCCCEEEEEEECCE
T ss_conf             0898999999---8628899986887-788999999999979997999884469


No 242
>PRK05650 short chain dehydrogenase; Provisional
Probab=96.15  E-value=0.061  Score=33.85  Aligned_cols=75  Identities=16%  Similarity=0.181  Sum_probs=56.0

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHH
Q ss_conf             71116889999978985999739989999999712211278403289899986057788999976990699999999972
Q gi|254780716|r   12 GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKP   91 (475)
Q Consensus        12 G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~   91 (475)
                      .-+|..+|+.|+++|++|.+.||+.++.+++.++.......+                ..+-+-|.+.+.++++++.+..
T Consensus        10 sGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~----------------~~~~~Dvt~~~~~~~~~~~v~~   73 (270)
T PRK05650         10 SGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDG----------------FYQRCDVRDYSQLTALAQACEE   73 (270)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHHHHHHHHHH
T ss_conf             499999999999889989999798899999999998449928----------------9998458999999999999999


Q ss_pred             CCCCCCEEEEC
Q ss_conf             07899899967
Q gi|254780716|r   92 LLSPEDILLDG  102 (475)
Q Consensus        92 ~l~~g~iiID~  102 (475)
                      ...+=|++|..
T Consensus        74 ~~g~iDiLVNN   84 (270)
T PRK05650         74 KWGGIDVIVNN   84 (270)
T ss_pred             HHCCCCEEEEC
T ss_conf             83997789624


No 243
>PRK08251 short chain dehydrogenase; Provisional
Probab=96.14  E-value=0.069  Score=33.48  Aligned_cols=86  Identities=17%  Similarity=0.208  Sum_probs=59.1

Q ss_pred             CCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             8805698157-111688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +.+|=+.|-+ -+|..+|+.|+++|++|.+..|+.++.+++.++......+...              ..+-+-|.+.+.
T Consensus         2 ~K~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~~~~~v--------------~~~~~Dvsd~~~   67 (248)
T PRK08251          2 RQKILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEELKAELLARYPGIKV--------------AVAALDVNDHDQ   67 (248)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEE--------------EEEECCCCCHHH
T ss_conf             998999478639999999999987998999989888999999999873799739--------------999786786899


Q ss_pred             HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             999999997207899899967
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~  102 (475)
                      ++++++.+...+..=|++|..
T Consensus        68 v~~~~~~~~~~~g~iD~lvnN   88 (248)
T PRK08251         68 VFEVFAEFSDELGGLDRVIVN   88 (248)
T ss_pred             HHHHHHHHHHHHCCCCEEEEC
T ss_conf             999999999980999899985


No 244
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids 
Probab=96.10  E-value=0.14  Score=31.31  Aligned_cols=121  Identities=18%  Similarity=0.261  Sum_probs=70.0

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEE-EEE-------C---CHHHHHHHHHHCCCCCCCCEEC--CCHHHHHHHCCCC
Q ss_conf             8805698157111688999997898599-973-------9---9899999997122112784032--8989998605778
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLA-VYN-------K---DFELTDVFIKKISGLSQKVIVT--KNLEQMVEAVCKP   69 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~-vyd-------r---~~~~~~~l~~~~~~~~~~~~~~--~s~~e~v~~l~~p   69 (475)
                      ...|.+-|+|+.|+..|+.|.+.|..|. +-|       .   +.+...+..++..... .....  -+.+++..  ..+
T Consensus        31 g~~v~IqG~GnVG~~~a~~L~~~Gakvv~vsD~~G~i~~~~Gld~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~--~~~  107 (227)
T cd01076          31 GARVAIQGFGNVGSHAARFLHEAGAKVVAVSDSDGTIYNPDGLDVPALLAYKKEHGSVL-GFPGAERITNEELLE--LDC  107 (227)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCC-CCCCCCCCCCCCHHC--CCC
T ss_conf             99999989889999999999987995999984787388888899999999999659802-678875389623104--788


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC--CCCC
Q ss_conf             899997699069999999997207899899967986578999999999847994306754--6760
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV--SGGV  133 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV--SGG~  133 (475)
                      ++.+-|-..+....+....    + .-.+|+.+.|...  |.+..+.|.++||.++=--+  +||+
T Consensus       108 DI~iP~A~~~~I~~~~a~~----l-~ak~I~EgAN~p~--t~~A~~~L~~rgI~viPD~laNaGGV  166 (227)
T cd01076         108 DILIPAALENQITADNADR----I-KAKIIVEAANGPT--TPEADEILHERGVLVVPDILANAGGV  166 (227)
T ss_pred             CEEEECCCCCCCCHHHHHH----C-CCEEEEECCCCCC--CHHHHHHHHHCCCEEECCHHHCCCCE
T ss_conf             7898777669779999854----4-7619984578998--98899999988698968077448774


No 245
>COG0579 Predicted dehydrogenase [General function prediction only]
Probab=96.09  E-value=0.021  Score=37.22  Aligned_cols=114  Identities=15%  Similarity=0.174  Sum_probs=73.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             99880569815711168899999789--8599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG--FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G--~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++.++-+||-|.||..+|.-|.+-+  ++|.+..+...-...--...+...-.. ...++.++-        +=+|+.-
T Consensus         1 ~~~~DvvIIGgGI~G~a~a~~Ls~~~p~~~V~llEk~~~~a~~sS~~NSgviHag-~~y~p~slk--------a~l~~~g   71 (429)
T COG0579           1 MMDYDVVIIGGGIMGAATAYELSEYEPDLSVALLEKEDGVAQESSSNNSGVIHAG-LYYTPGSLK--------AKLCVAG   71 (429)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCEECC-CCCCCCCHH--------HHHHHHH
T ss_conf             9832299989738989999999973889659999705765333456765344255-448985513--------3999999


Q ss_pred             HHHHHHHHHHH-HHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             06999999999-7207899899967986578999999999847994
Q gi|254780716|r   79 GDPVDQLIDKL-KPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY  123 (475)
Q Consensus        79 g~~v~~vi~~l-~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~  123 (475)
                      .....++..++ .|+...|.+++-.+-.....-..+++++.+.|+.
T Consensus        72 ~~~~~~~~kq~~~~f~~~g~l~vA~~e~e~~~L~~l~~~~~~ngv~  117 (429)
T COG0579          72 NINEFAICKQLGIPFINCGKLSVATGEEEVERLEKLYERGKANGVF  117 (429)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999998498612368089997827789999999988657986


No 246
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=96.08  E-value=0.15  Score=31.02  Aligned_cols=116  Identities=16%  Similarity=0.187  Sum_probs=65.6

Q ss_pred             EEEECCHHHHHHHHHHHHCCCEEEEEECCHH-----HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCH
Q ss_conf             6981571116889999978985999739989-----99999971221127840328989998605778899997--6990
Q gi|254780716|r    7 GIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDG   79 (475)
Q Consensus         7 GiIGLG~MG~~mA~nL~~~G~~V~vydr~~~-----~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g   79 (475)
                      -++|||.-|.+.|+-|.++|++|.+||....     ..+.+.+++-....+  ...++.++...++.++.|+.+  +|..
T Consensus         4 ~V~GlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~L~~~gi~~~~g--~~~~~~~~~~~~~~~d~vV~SPGI~~~   81 (459)
T PRK02705          4 HVIGLGRSGIAAARLLKAQGWEVVVSERNDSPELLERQQELEQEGITVELG--KPLELESFQPWLDQPDLVVVSPGIPWD   81 (459)
T ss_pred             EEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEC--CCCCCCCHHHHCCCCCEEEECCCCCCC
T ss_conf             999548999999999997899599998989923478999998759869816--766643013311678889989964998


Q ss_pred             H-HHHHHHH---------HHH-HCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             6-9999999---------997-207899899-9679865789999999998479943
Q gi|254780716|r   80 D-PVDQLID---------KLK-PLLSPEDIL-LDGGNSHFCDTQIRSLQLSEKGIYF  124 (475)
Q Consensus        80 ~-~v~~vi~---------~l~-~~l~~g~ii-ID~sts~~~~t~~~~~~l~~kgi~f  124 (475)
                      . .+....+         ++. ..++...+| |-+||---..|.-.+..++..|..-
T Consensus        82 ~p~~~~a~~~gi~i~~eiel~~~~~~~~~~IaVTGTnGKTTTt~ll~~iL~~~g~~~  138 (459)
T PRK02705         82 HPTLVELREKGIEVIGEMELAWRALKHIPWVGITGTNGKTTVTHLLAHILQAAGLNA  138 (459)
T ss_pred             CHHHHHHHHCCCCEECHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             999999998799721499999998504975777178972789999999999839985


No 247
>PRK05717 oxidoreductase; Validated
Probab=96.08  E-value=0.093  Score=32.51  Aligned_cols=78  Identities=15%  Similarity=0.231  Sum_probs=58.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|++|++.|.+|.+.||++++.+++.++..   .                .+..+-.-|.+.+.++
T Consensus        12 valITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~---~----------------~~~~~~~Dvt~~~~v~   72 (255)
T PRK05717         12 VALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKALG---E----------------NAWFIAMDVADEAQVA   72 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---C----------------CEEEEEEECCCHHHHH
T ss_conf             89995878889999999999879989999698899999999848---9----------------7589993079999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      +.++.+.....+=|++|..
T Consensus        73 ~~i~~~~~~~G~id~lvnN   91 (255)
T PRK05717         73 AGVAEVLGQFGRLDALVCN   91 (255)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999982999899987


No 248
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes. Members of this subfamily are tetrameric NAD-dependent 2-hydroxycarboxylate dehydrogenases including LDHs, L-2-hydroxyisocaproate dehydrogenases (L-HicDH), and LDH-like malate dehydrogenases (MDH). Dehydrogenases catalyze the conversion of carbonyl compounds to alcohols or amino acids. LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. L-HicDH catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of prot
Probab=96.07  E-value=0.092  Score=32.54  Aligned_cols=99  Identities=20%  Similarity=0.354  Sum_probs=59.4

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHC---CCC--CCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             5698157111688999997898--5999739989999999712---211--27840328989998605778899997699
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKKI---SGL--SQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~~---~~~--~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++||.|..|..+|..|+.++.  ++..||+++++++......   ...  ........+.++    +...++|++..-.
T Consensus         1 V~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~~~~~~~~~----~~daDvvVitaG~   76 (300)
T cd00300           1 ITIIGAGNVGAAVAFALIAKGLASELVLVDVNEEKAKGDALDLSHASAFLATGTIVRGGDYAD----AADADIVVITAGA   76 (300)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEECCCCHHH----HCCCCEEEECCCC
T ss_conf             989896889999999998679988799981899811568888772563468853982798899----6799999987898


Q ss_pred             ----H-----------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH
Q ss_conf             ----0-----------69999999997207899899967986578999
Q gi|254780716|r   79 ----G-----------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ  111 (475)
Q Consensus        79 ----g-----------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~  111 (475)
                          |           +.+.++...+..+ .++.+++-.||  |-|+.
T Consensus        77 ~rkpg~tR~dll~~Na~I~k~i~~~i~~~-~p~~ivivvtN--PvDv~  121 (300)
T cd00300          77 PRKPGETRLDLINRNAPILRSVITNLKKY-GPDAIILVVSN--PVDIL  121 (300)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHC-CCCCEEEECCC--CHHHH
T ss_conf             99979988999998889999999999841-99718998579--66999


No 249
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=96.06  E-value=0.14  Score=31.29  Aligned_cols=89  Identities=21%  Similarity=0.267  Sum_probs=54.6

Q ss_pred             EEEEEEC-CHHHHHHHHHHHH-CCCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             0569815-7111688999997-89859-9973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILD-KGFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~-~G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|++.|. |+||+.+++.+.+ .++.+ .+.++......               ..+..++..            +.+- 
T Consensus         2 kV~i~Ga~GrMG~~i~~~i~~~~~~~lv~~~~~~~~~~~---------------~~d~~~~~~------------~~~~-   53 (122)
T pfam01113         2 KVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLL---------------GSDAGELAG------------PLGV-   53 (122)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCC---------------CCCCCCCCC------------CCCC-
T ss_conf             899988988789999999985899689999943896122---------------543100146------------7871-


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             99999999720789989996798657899999999984799430
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                        .+...+.....+-|++||.|  +|+.+....+.+.+.|+.++
T Consensus        54 --~~~~~~~~~~~~~DVvIDFS--~p~~~~~~~~~~~~~~~~~V   93 (122)
T pfam01113        54 --PVTDDLEEVLADADVLIDFT--TPEATLENLELALKHGKPLV   93 (122)
T ss_pred             --EECCCHHHHCCCCCEEEEEC--CHHHHHHHHHHHHHCCCCEE
T ss_conf             --11244777515788899906--87899999999996799889


No 250
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=96.05  E-value=0.15  Score=30.92  Aligned_cols=44  Identities=11%  Similarity=0.183  Sum_probs=33.4

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC
Q ss_conf             805698157111688999997898-59997399899999997122
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS   47 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~   47 (475)
                      .++.++|.|.+|...+.-+...|. +|.+-|++++|.+...+-++
T Consensus       122 ~~V~V~G~G~iGl~~~~~a~~~Ga~~Vi~~d~~~~rl~~a~~~Ga  166 (280)
T TIGR03366       122 RRVLVVGAGMLGLTAAAAAAAAGAARVVAADPSPDRRELALSFGA  166 (280)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCC
T ss_conf             989999078689999999998499879999199899999997399


No 251
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]
Probab=96.05  E-value=0.03  Score=36.10  Aligned_cols=106  Identities=14%  Similarity=0.256  Sum_probs=68.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC---CHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCCCCCCCCHHHH
Q ss_conf             9999999999999999999999996110145667---9889999851894685378999999987088852000798999
Q gi|254780716|r  320 VKDLENALYASTILSFTQGFWVIGKSSEKYSWSL---SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSIS  396 (475)
Q Consensus       320 i~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l---~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l~~Ll~~~~~~  396 (475)
                      ++.+++.+-.+-+-..+....+|+..     .++   .+++|+.-|+.| -+.|.|++-..++|........--+.+.|.
T Consensus       182 VKmVHNGIEYgDMQlIaE~Y~ilk~~-----lgls~~ei~~vF~~WN~g-eL~SYLIeIT~~IL~~kD~~~~kplvd~IL  255 (473)
T COG0362         182 VKMVHNGIEYGDMQLIAEAYDILKDG-----LGLSAEEIAEVFEEWNKG-ELDSYLIEITADILRKKDEEGGKPLVDKIL  255 (473)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHHHH-----CCCCHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             21014571488899999999999975-----499989999999986267-604799999999986408666873699998


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH-HHHHH
Q ss_conf             9999524769999999998399847999999-99986
Q gi|254780716|r  397 EKVKKTIPSLRRIVVTCTENGYPVPSLSAAL-SYFDT  432 (475)
Q Consensus       397 ~~i~~~~~~lr~vv~~~i~~gip~P~lsssL-~y~~~  432 (475)
                      +.-.....+ ||++..+.+.|+|+|.+..|. +.+.+
T Consensus       256 D~AgQKGTG-kWt~~~AldlGvP~t~I~eaVfAR~lS  291 (473)
T COG0362         256 DKAGQKGTG-KWTVISALDLGVPLTLITEAVFARYLS  291 (473)
T ss_pred             HHHCCCCCC-HHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             873478765-413987997199808999999999998


No 252
>PRK08265 short chain dehydrogenase; Provisional
Probab=96.03  E-value=0.091  Score=32.59  Aligned_cols=80  Identities=16%  Similarity=0.285  Sum_probs=58.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|++|.+.||+.++.+++.++...   .+                ..+-.-|.+.+.+
T Consensus         7 KvalVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~---~~----------------~~~~~Dv~~~~~i   67 (261)
T PRK08265          7 KVAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAASLGE---RA----------------RFIATDITDDAAI   67 (261)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC---CE----------------EEEECCCCCHHHH
T ss_conf             9899948776899999999998799899997988999999998199---72----------------8998138999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+......=|++|...
T Consensus        68 ~~~~~~~~~~fG~iDiLVNNA   88 (261)
T PRK08265         68 ERAVATAVARFGGLDILVNLA   88 (261)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999819987899857


No 253
>PRK07479 consensus
Probab=96.01  E-value=0.096  Score=32.41  Aligned_cols=83  Identities=14%  Similarity=0.291  Sum_probs=59.6

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|++|.+.||++++.+++.++......++.                .+-.-|.+.+.+
T Consensus         6 K~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g~~~~----------------~~~~Dv~~~~~~   69 (252)
T PRK07479          6 KVAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAGGNAI----------------AVAADVSRGADV   69 (252)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8899938876899999999998799999997989999999999985399789----------------999258999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+.....+=|++|...
T Consensus        70 ~~~~~~~~~~~G~iD~lVnnA   90 (252)
T PRK07479         70 EALVEAALEAFGRVDIVVNNA   90 (252)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999819985999899


No 254
>PRK06172 short chain dehydrogenase; Provisional
Probab=96.01  E-value=0.09  Score=32.62  Aligned_cols=83  Identities=16%  Similarity=0.231  Sum_probs=58.6

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|.++|+.|++.|.+|.+.||++++.++..++.......+                ..+-.-|.+.+.+
T Consensus         8 KvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~Dvs~~~~v   71 (253)
T PRK06172          8 QVALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEA----------------LFIACDVTRDAEV   71 (253)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHH
T ss_conf             989993757689999999999879989999798899999999999649937----------------9998189999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +..++++.....+=|++|...
T Consensus        72 ~~~~~~~~~~~G~iDiLVNNA   92 (253)
T PRK06172         72 KALVEKTIAAYGRLDYAFNNA   92 (253)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999829999999898


No 255
>PRK05867 short chain dehydrogenase; Provisional
Probab=96.01  E-value=0.081  Score=32.94  Aligned_cols=82  Identities=17%  Similarity=0.312  Sum_probs=58.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+++.++.......+.                .+-.-|.+.+.++
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~~----------------~~~~Dvt~~~~v~   74 (253)
T PRK05867         11 RALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVV----------------PVCCDVSQHQQVT   74 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHH
T ss_conf             899979565999999999998699999997988999999999984599199----------------9983699999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+...+..=|++|...
T Consensus        75 ~~v~~~~~~~G~iDiLVnNA   94 (253)
T PRK05867         75 SMLDQVTAELGGIDIAVCNA   94 (253)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999959985999899


No 256
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional
Probab=96.01  E-value=0.16  Score=30.79  Aligned_cols=18  Identities=17%  Similarity=0.392  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHCCCC
Q ss_conf             247699999999983998
Q gi|254780716|r  402 TIPSLRRIVVTCTENGYP  419 (475)
Q Consensus       402 ~~~~lr~vv~~~i~~gip  419 (475)
                      ..+..|+++.++-+.|..
T Consensus       670 G~DvarKllILARe~g~~  687 (810)
T PRK09466        670 GRDVMRKLLILAREAGLE  687 (810)
T ss_pred             CCCHHHHHHHHHHHHCCC
T ss_conf             975899999999985877


No 257
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=96.00  E-value=0.085  Score=32.79  Aligned_cols=82  Identities=17%  Similarity=0.265  Sum_probs=58.3

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|..|++.|.+|.+.+|+.++.++..++-......+.                .+-.-|.+.+.++
T Consensus        13 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~----------------~~~~Dv~~~~~~~   76 (255)
T PRK06113         13 CAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAF----------------ACRCDITSEQELS   76 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHH
T ss_conf             899958877899999999998799999996988999999999996599089----------------9983689999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ..++.+......=|++|...
T Consensus        77 ~~v~~~~~~~G~iDilVnNA   96 (255)
T PRK06113         77 ALADFAVSKLGKVDILVNNA   96 (255)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999819988999878


No 258
>PRK09242 tropinone reductase; Provisional
Probab=95.98  E-value=0.14  Score=31.28  Aligned_cols=84  Identities=12%  Similarity=0.174  Sum_probs=58.0

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+...++..........              ..+-.-|.+.+.++
T Consensus        12 ~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~--------------~~~~~Dv~~~~~~~   77 (258)
T PRK09242         12 TALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPEREL--------------HGLAADVSDDEDRR   77 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEE--------------EEEEEECCCHHHHH
T ss_conf             9999484868999999999987998999969889999999999864479729--------------99993079999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        78 ~~~~~~~~~~g~iDiLVnnA   97 (258)
T PRK09242         78 AILDWVEDHWDGLHILVNNA   97 (258)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999749997999899


No 259
>PRK07062 short chain dehydrogenase; Provisional
Probab=95.97  E-value=0.11  Score=32.08  Aligned_cols=82  Identities=16%  Similarity=0.204  Sum_probs=58.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCE--EEEECCCHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889--9997699069
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRK--ILMMVTDGDP   81 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~--Iil~vp~g~~   81 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.+|+.++.++..++.......                .++  +-.-|.+.+.
T Consensus        10 ~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~----------------~~~~~~~~Dvt~~~~   73 (265)
T PRK07062         10 VAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPG----------------ARLLAARCDVLDEAD   73 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCC----------------CEEEEEECCCCCHHH
T ss_conf             8999575779999999999987999999979889999999999873699----------------659999757999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++.++.+......=|++|...
T Consensus        74 v~~~v~~~~~~~G~iDiLVnNA   95 (265)
T PRK07062         74 VAAFAAAVEARFGGVDMLVNNA   95 (265)
T ss_pred             HHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999839988899778


No 260
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=95.97  E-value=0.16  Score=30.68  Aligned_cols=115  Identities=10%  Similarity=0.133  Sum_probs=60.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCC--EEEEEECCH--HHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE-
Q ss_conf             998805698157111688999997898--599973998--999999971221127840328989998605778899997-
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDF--ELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM-   75 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~--~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~-   75 (475)
                      |+|  |.++|+|.=|.+.|+-|+++|.  .|.++|...  ...+.+ .++...   ..+.... +.   ++..+.|+.+ 
T Consensus         7 ~Kk--vlV~GlG~sG~s~a~~L~~~~~~~~v~~~D~~~~~~~~~~l-~~~~~~---~~g~~~~-~~---l~~~d~vV~SP   76 (438)
T PRK04663          7 IKN--VVVVGLGITGLSVVKHLRKTQPQLTVKVIDTRETPPGQEQL-PEDVEL---HSGGWNQ-DW---LAEADLVVTNP   76 (438)
T ss_pred             CCE--EEEEEECHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHH-HCCCEE---EECCCCH-HH---HCCCCEEEECC
T ss_conf             974--99990678589999999966998469996398893688762-069769---7278896-78---36899999899


Q ss_pred             -CCCHH-HHHHHHH---------HHHHCCCCCCEEEECCCCCHHH-HHHHHHHHHHCCCCEE
Q ss_conf             -69906-9999999---------9972078998999679865789-9999999984799430
Q gi|254780716|r   76 -VTDGD-PVDQLID---------KLKPLLSPEDILLDGGNSHFCD-TQIRSLQLSEKGIYFI  125 (475)
Q Consensus        76 -vp~g~-~v~~vi~---------~l~~~l~~g~iiID~sts~~~~-t~~~~~~l~~kgi~fi  125 (475)
                       +|... .+....+         ++.....+..+|--+||..-.+ |.-.+..|+..|....
T Consensus        77 GI~~~~p~~~~a~~~~i~i~~eiel~~~~~~~~iIaVTGTnGKTTTtsli~~iL~~~g~~~~  138 (438)
T PRK04663         77 GIALATPEIQPVLAKGIPVVGDIELFAWAVDKPVIAITGSNGKSTVTDLTGVMAKAAGVKVA  138 (438)
T ss_pred             CCCCCCHHHHHHHHCCCCEECHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             76998989999998699370388999764589789994899828999999999982899706


No 261
>PRK08263 short chain dehydrogenase; Provisional
Probab=95.97  E-value=0.16  Score=30.68  Aligned_cols=83  Identities=17%  Similarity=0.244  Sum_probs=60.1

Q ss_pred             CCCCEEEEE-EC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698-15-7111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII-GL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI-GL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+.. +-|| |- .-+|..+|+.|+++|++|.+.+|+.++.+++.++..   ..+                ..+-+-|.+
T Consensus         1 m~gK-v~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~~~---~~~----------------~~~~~Dvtd   60 (275)
T PRK08263          1 MMGK-VWFITGASRGFGREWTEAALERGDRVVATARDTATLADLAERYG---DAL----------------LPLALDVTD   60 (275)
T ss_pred             CCCC-EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---CCE----------------EEEEEECCC
T ss_conf             9899-89994674399999999999879989999798999999999759---967----------------999964899


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++.+......=|++|...
T Consensus        61 ~~~v~~~v~~~~~~~G~iDiLVNNA   85 (275)
T PRK08263         61 RAAVFAAVEQAVKHFGRLDIVVNNA   85 (275)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999849987899888


No 262
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=95.97  E-value=0.1  Score=32.28  Aligned_cols=83  Identities=19%  Similarity=0.306  Sum_probs=59.3

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|.++|+.|+++|++|.+.+|+.++.++..++......++                ..+-.-+.+.+.+
T Consensus         5 K~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~D~~~~~~v   68 (258)
T PRK12429          5 KTALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGKA----------------IGVAMDVTDEEAI   68 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHH
T ss_conf             989994887589999999999879999999798899999999998449918----------------9998358999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+.....+=|++|...
T Consensus        69 ~~~~~~~~~~~g~iDiLVnnA   89 (258)
T PRK12429         69 NAGIDKVVETFGGVDILVNNA   89 (258)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999829970999899


No 263
>PRK06139 short chain dehydrogenase; Provisional
Probab=95.95  E-value=0.086  Score=32.77  Aligned_cols=77  Identities=19%  Similarity=0.239  Sum_probs=56.0

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
Q ss_conf             57111688999997898599973998999999971221127840328989998605778899997699069999999997
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLK   90 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~   90 (475)
                      -+-+|..+|+.|+++|++|.+.+|+.++.+++.++.......+.                .+-.-|.+.+++++.++.+.
T Consensus        15 SsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~----------------~v~~DVsd~~~v~~~~~~~~   78 (324)
T PRK06139         15 SSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVL----------------VVPTDVTHADQVQALATQAA   78 (324)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHHHHHHHHHH
T ss_conf             54999999999998799899998999999999999995499489----------------99766788578999999999


Q ss_pred             HCCCCCCEEEECC
Q ss_conf             2078998999679
Q gi|254780716|r   91 PLLSPEDILLDGG  103 (475)
Q Consensus        91 ~~l~~g~iiID~s  103 (475)
                      ....+=|++|...
T Consensus        79 ~~~G~IDiLVNNA   91 (324)
T PRK06139         79 SFLGRIDVWFNNV   91 (324)
T ss_pred             HHCCCCCEEEECC
T ss_conf             9749987886457


No 264
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=95.95  E-value=0.049  Score=34.53  Aligned_cols=36  Identities=17%  Similarity=0.141  Sum_probs=18.0

Q ss_pred             HHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             72078998999679865789999999998479943067
Q gi|254780716|r   90 KPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        90 ~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ...+++|.+++-.  .++....++.+.+.++|+..+.+
T Consensus        80 ~~~lr~g~~Lis~--L~pa~~~el~~~L~~~~vtaiA~  115 (510)
T PRK09424         80 IALLREGATLVSF--IWPAQNPELMEKLAARGITVLAM  115 (510)
T ss_pred             HHHCCCCCEEEEE--CCCCCCHHHHHHHHHCCCCEEEE
T ss_conf             9734799899997--68667989999999759928975


No 265
>PRK07109 short chain dehydrogenase; Provisional
Probab=95.94  E-value=0.099  Score=32.32  Aligned_cols=81  Identities=16%  Similarity=0.258  Sum_probs=59.5

Q ss_pred             EEEEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             56981-57111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      |=|-| -+-+|..+|+.++++|++|.+.+|++++.+++.++-...+..+                ..+-+-|.+.+++++
T Consensus        11 VvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~----------------~~~~~DVsd~~~v~~   74 (338)
T PRK07109         11 VVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEA----------------LAVVADVADAEAVQA   74 (338)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE----------------EEEEEECCCHHHHHH
T ss_conf             9994843499999999999879989999899999999999999639818----------------999801799999999


Q ss_pred             HHHHHHHCCCCCCEEEEC
Q ss_conf             999997207899899967
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~  102 (475)
                      .++.+...+.+=|++|..
T Consensus        75 ~~~~~~~~~G~IDvlVNN   92 (338)
T PRK07109         75 AADRAEEELGPIDTWVNN   92 (338)
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999984998888654


No 266
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=95.94  E-value=0.074  Score=33.23  Aligned_cols=102  Identities=20%  Similarity=0.262  Sum_probs=63.9

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCC----EEEEEECCHHHHHHHHHH---CCCC--CCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             569815-7111688999997898----599973998999999971---2211--27840328989998605778899997
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGF----RLAVYNKDFELTDVFIKK---ISGL--SQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~----~V~vydr~~~~~~~l~~~---~~~~--~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      |++||. |+-|..+|..|+.++.    ++..+|+++++.+..+-.   ....  ..++....+..+   .++..++|++.
T Consensus         1 V~IIGA~G~VG~~~a~~l~~~~~~~~~el~L~Di~~~~~~g~a~Dl~~~~~~~~~~~v~~~~~~~~---~~~daDvVVit   77 (263)
T cd00650           1 IAVIGAGGNVGPALAFGLADGSVLLAIELVLYDIDEEKLKGVAMDLQDAVEPLADIKVSITDDPYE---AFKDADVVIIT   77 (263)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCEEEECCCHHH---HHCCCCEEEEE
T ss_conf             989877977999999999828999998899995898720879999985452357873997487389---83799899990


Q ss_pred             CC---------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             69---------------906999999999720789989996798657899999
Q gi|254780716|r   76 VT---------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR  113 (475)
Q Consensus        76 vp---------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~  113 (475)
                      --               +.+.+.++...+..+. |+.++|-.+|  |-|+...
T Consensus        78 ag~~~k~g~~R~dll~~N~~I~~~i~~~i~~~~-p~a~iivvtN--Pvdv~t~  127 (263)
T cd00650          78 AGVGRKPGMGRLDLLKRNVPIVKEIGDNIEKYS-PDAWIIVVSN--PVDIITY  127 (263)
T ss_pred             CCCCCCCCCCHHHHHHCHHHHHHHHHHHHHHCC-CCCEEEECCC--CHHHHHH
T ss_conf             577889998765664032889999988887329-9836997389--4899999


No 267
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=95.93  E-value=0.1  Score=32.25  Aligned_cols=82  Identities=15%  Similarity=0.259  Sum_probs=59.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.++..++.......+.                .+-.-|.+.+.++
T Consensus        14 valVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~----------------~~~~Dv~~~~~v~   77 (259)
T PRK08213         14 TALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDAL----------------WLAADVADEADIE   77 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHHH
T ss_conf             899948776899999999998699999997988999999999995499589----------------9982689999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+++.+.....+=|++|...
T Consensus        78 ~~v~~~~~~~G~iDiLVNNA   97 (259)
T PRK08213         78 RLAEETLERFGHIDILVNNA   97 (259)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999839998999899


No 268
>PRK12743 acetoin dehydrogenase; Provisional
Probab=95.93  E-value=0.17  Score=30.54  Aligned_cols=85  Identities=19%  Similarity=0.271  Sum_probs=57.2

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--15711168899999789859997-399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVY-NKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vy-dr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+|  |.+|  |-+-+|..+|+.|++.|.+|.+. +++.+..++..++....+..+.                .+-.-|.
T Consensus         1 M~K--ValITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~   62 (253)
T PRK12743          1 MAQ--VAIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAE----------------IVHLDLS   62 (253)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEE----------------EEEECCC
T ss_conf             999--8999075889999999999987998999748997999999999994599189----------------9990489


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.++++++.+...+..=|++|...
T Consensus        63 ~~~~~~~~~~~~~~~~G~iDilVNnA   88 (253)
T PRK12743         63 NLPEGAQAIEKLIQRLGRLDVLVNNA   88 (253)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999819998999899


No 269
>PRK00066 ldh L-lactate dehydrogenase; Reviewed
Probab=95.91  E-value=0.17  Score=30.50  Aligned_cols=103  Identities=12%  Similarity=0.226  Sum_probs=60.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHH---HCCCCCCC-CEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             8805698157111688999997898--59997399899999997---12211278-403289899986057788999976
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIK---KISGLSQK-VIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~---~~~~~~~~-~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      ..+|++||.|..|.++|.-|+.+|.  ++..||+++++++....   .+...... .....+.++    ++..++|++..
T Consensus         6 ~~KI~IIGaG~VG~~~a~~l~~~~l~~el~LiD~~~~~a~g~a~Dl~h~~~~~~~~~i~~gdy~~----~~daDvVVitA   81 (315)
T PRK00066          6 HNKVVLVGDGAVGSSYAYALVNQGIADELVIIDINKEKAEGDAMDLSHAVPFTSPTKIYAGDYSD----CKDADLVVITA   81 (315)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHH----HCCCCEEEECC
T ss_conf             98499999798899999999866998889998089871078999888541236884797399999----67999999899


Q ss_pred             CC----H-----------HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             99----0-----------699999999972078998999679865789999
Q gi|254780716|r   77 TD----G-----------DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        77 p~----g-----------~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      ..    |           +.+.++..++.++ .|..+++-.|  +|-|...
T Consensus        82 G~~~k~g~tR~dll~~N~~I~~~i~~~i~~~-~p~~i~ivvt--NPvDvmt  129 (315)
T PRK00066         82 GAPQKPGETRLDLVEKNLKIFKSIVGEVMAS-GFDGIFLVAS--NPVDILT  129 (315)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEEEC--CCHHHHH
T ss_conf             9989999987899987899999988776424-8853999936--9189999


No 270
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=95.91  E-value=0.17  Score=30.50  Aligned_cols=114  Identities=18%  Similarity=0.153  Sum_probs=63.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH--HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCH
Q ss_conf             8056981571116889999978985999739989--99999971221127840328989998605778899997--6990
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE--LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDG   79 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~--~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g   79 (475)
                      .+|.|+|+|.=|.+.|+-|.++|++|.+||...+  ..+.+. ++..   -..+... .+.   +...+.|+.+  +|..
T Consensus         7 k~v~V~GlG~sG~s~~~~L~~~G~~v~~~D~~~~~~~~~~l~-~~~~---~~~g~~~-~~~---~~~~d~vV~SPGI~~~   78 (438)
T PRK03806          7 KNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLP-ENVE---RHTGSLN-DEW---LLAADLIVASPGIALA   78 (438)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHH-CCCC---EEECCCC-HHH---HCCCCEEEECCCCCCC
T ss_conf             989999457888999999997899699998999900578864-5884---6657779-668---0679999989978998


Q ss_pred             HH-HHHHHH---------HHHHCCCCCCEEEE-CCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             69-999999---------99720789989996-798657899999999984799430
Q gi|254780716|r   80 DP-VDQLID---------KLKPLLSPEDILLD-GGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        80 ~~-v~~vi~---------~l~~~l~~g~iiID-~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                      .+ +....+         ++.-...+..+|-- +||---..|.-.+..|++.|....
T Consensus        79 ~p~~~~a~~~~i~i~seiel~~~~~~~~iIaVTGTnGKTTTt~li~~iL~~~g~~~~  135 (438)
T PRK03806         79 HPSLSAAADAGVEIVGDIELFCREAQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVG  135 (438)
T ss_pred             CHHHHHHHHCCCCEEEHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             989999998799477699997222799889994899848999999999986599756


No 271
>PRK07201 short chain dehydrogenase; Provisional
Probab=95.91  E-value=0.12  Score=31.60  Aligned_cols=36  Identities=25%  Similarity=0.419  Sum_probs=23.4

Q ss_pred             ECCHHHHHHHHHHHHC-CCEEEEEECC--HHHHHHHHHH
Q ss_conf             1571116889999978-9859997399--8999999971
Q gi|254780716|r   10 GLGSMGSNLSLNILDK-GFRLAVYNKD--FELTDVFIKK   45 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~-G~~V~vydr~--~~~~~~l~~~   45 (475)
                      +.|-.|..+...|++. +-+|++-=|.  .++.+++.+.
T Consensus         8 aTGFLG~~LL~~LL~~~~a~V~cLVR~~s~~r~~~~~~~   46 (663)
T PRK07201          8 GTGFIGRRLVSRLLDRPGARVHVLVRRQSLGRFERLAEY   46 (663)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHH
T ss_conf             842889999999984899989999787749999999997


No 272
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase.
Probab=95.90  E-value=0.15  Score=30.98  Aligned_cols=114  Identities=18%  Similarity=0.252  Sum_probs=66.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEE--------EEC---CHHHHHHHHHHCCCCCCCCE----ECCCHHHHHHHCCC
Q ss_conf             8056981571116889999978985999--------739---98999999971221127840----32898999860577
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAV--------YNK---DFELTDVFIKKISGLSQKVI----VTKNLEQMVEAVCK   68 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~v--------ydr---~~~~~~~l~~~~~~~~~~~~----~~~s~~e~v~~l~~   68 (475)
                      ..|.+=|.|+.|+..|+.|.+.|.+|..        ||.   +.+...++.++.........    ..-+.+++..  ..
T Consensus        33 ~~v~IqGfGnVG~~~a~~l~~~GakvvavsD~~G~i~~~~Gldi~~l~~~~~~~~~~~~~~~~~~~~~i~~~~~~~--~~  110 (237)
T pfam00208        33 KTVAVQGFGNVGSYAAEKLLELGAKVVAVSDSSGYIYDPNGIDIEELLELKEEGGGRVVEYAGSGAEYISGEELWE--ID  110 (237)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHCCEEECCCCCCCEECCCCCCCC--CC
T ss_conf             9999989889999999999987996999982876799999999999999999719843124665753448710004--76


Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEC
Q ss_conf             8899997699069999999997207899899967986578999999999847994306
Q gi|254780716|r   69 PRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG  126 (475)
Q Consensus        69 pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid  126 (475)
                      +++.+-|-..+....+..    +.+ +-.+|+.+.|...  |.+..+.|.++||.++=
T Consensus       111 ~DIliPaA~~~~I~~~na----~~i-~ak~I~EgAN~p~--t~eA~~~L~~rgI~viP  161 (237)
T pfam00208       111 CDILVPCATQNEINEENA----KLI-KAKAVVEGANMPT--TPEADEILEERGILYAP  161 (237)
T ss_pred             CCEEEECCCCCCCCHHHH----HHC-CCCEEEECCCCCC--CHHHHHHHHHCCCEEEC
T ss_conf             668864455688998999----862-7548975378988--97899999988998968


No 273
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=95.88  E-value=0.12  Score=31.70  Aligned_cols=73  Identities=11%  Similarity=0.263  Sum_probs=54.2

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHH
Q ss_conf             71116889999978985999739989999999712211278403289899986057788999976990699999999972
Q gi|254780716|r   12 GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKP   91 (475)
Q Consensus        12 G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~   91 (475)
                      +-+|..+|+.|+++|++|.+.+|+.++.+++.++..   .++.                .+-.-|.+.+.++++++.+..
T Consensus        10 sGIG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~lg---~~~~----------------~~~~Dvsd~~~v~~~~~~~~~   70 (248)
T PRK10538         10 AGFGECITRRFIQNGHKVIATGRRQERLQELKDELG---DNLY----------------IAQLDVRNRAAIEEMLASLPA   70 (248)
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---CCEE----------------EEEEECCCHHHHHHHHHHHHH
T ss_conf             699999999999879999999899999999999848---8679----------------999734888999999999999


Q ss_pred             CCCCCCEEEECC
Q ss_conf             078998999679
Q gi|254780716|r   92 LLSPEDILLDGG  103 (475)
Q Consensus        92 ~l~~g~iiID~s  103 (475)
                      ...+=|++|...
T Consensus        71 ~~g~iDiLVnNA   82 (248)
T PRK10538         71 EWRNIDILVNNA   82 (248)
T ss_pred             HCCCCCEEEECC
T ss_conf             709975999778


No 274
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=95.88  E-value=0.1  Score=32.27  Aligned_cols=75  Identities=17%  Similarity=0.212  Sum_probs=53.8

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|++.|.+|.+.+|++++.+++.++..   ..+.                .+-.-+.+.+.+++.++.+
T Consensus        14 as~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~~---~~~~----------------~~~~Dv~~~~~~~~~~~~~   74 (263)
T PRK06200         14 GGSGIGRALVERFLAEGARVAVLERSAEKCASLRQRFG---DDVL----------------VVEGDVTSYADNQRAVAQT   74 (263)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---CCEE----------------EEECCCCCHHHHHHHHHHH
T ss_conf             66799999999999879999999799999999999818---8646----------------8717999999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      .....+=|++|...
T Consensus        75 ~~~~G~iDiLVnnA   88 (263)
T PRK06200         75 VDRFGKLDCFVGNA   88 (263)
T ss_pred             HHHHCCCCEEEECC
T ss_conf             99849988899757


No 275
>PRK06720 hypothetical protein; Provisional
Probab=95.87  E-value=0.088  Score=32.68  Aligned_cols=82  Identities=18%  Similarity=0.244  Sum_probs=59.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||+.++.++..++-...+..+                ..+-.-|.+.+.++
T Consensus        18 valITGa~~GIG~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g~~a----------------~~~~~Dvs~~~~v~   81 (169)
T PRK06720         18 VAIVTGGGIGIGRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLGGEA----------------LFVSYDMEKQGDWQ   81 (169)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHH
T ss_conf             99998975489999999999869989995276365999999999749953----------------78975889999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        82 ~~i~~~~~~~g~iDiLvNNA  101 (169)
T PRK06720         82 RVISITLNAFSRIDMLFQNA  101 (169)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999759899899894


No 276
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731    Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees. The Escherichia coli ThiF and MoeB proteins are seemingly more closely related than the E. coli ThiF and Campylobacter (for example) ThiF. This entry represents the more widely distributed clade of ThiF proteins as found in E. coli..
Probab=95.87  E-value=0.078  Score=33.08  Aligned_cols=124  Identities=16%  Similarity=0.184  Sum_probs=83.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHC--C-CCCC-CCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             880569815711168899999789-85999739989999999712--2-1127-84032898999860577889999769
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKI--S-GLSQ-KVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~--~-~~~~-~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      .++|=+||.|-.|++.+..|+.+| -++.+.|.+.=-...|..+-  . ...+ ...-++..++-+..++ |++.+.-+.
T Consensus        21 ~s~VLiiGaGgLGs~~~~~LA~AGVG~i~i~D~D~V~~SNLqRQ~Lf~e~Dv~~~~pK~e~aa~~l~~LN-~~i~v~a~~   99 (210)
T TIGR02356        21 ASHVLIIGAGGLGSPAALYLAAAGVGTITIVDDDHVDLSNLQRQILFAEEDVGTLRPKVEAAAERLRELN-SDIRVTALK   99 (210)
T ss_pred             HCCEEEEEECHHHHHHHHHHHHCCCCEEEEEECCEECHHHCHHHHHHCHHHHHCCCHHHHHHHHHHHHHC-CCCEEEEEE
T ss_conf             0865999726145689999982888378998516770101205543032442013158999999998538-896899854


Q ss_pred             CHHHHHHHHHHHHHCCCCCC--EEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCC
Q ss_conf             90699999999972078998--99967986578999999999847994306754676
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPED--ILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGG  132 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~--iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG  132 (475)
                      - ..+.+-++.++.   .=|  +||||+ =+|+.-.-....|.+.|+=+|-+.|-|-
T Consensus       100 ~-~vt~~~~~~~i~---~~DPdlVlDc~-DNf~tryliNdaC~~~~~PlI~aavvG~  151 (210)
T TIGR02356       100 E-RVTAENLELLIE---NVDPDLVLDCT-DNFATRYLINDACQALGIPLISAAVVGF  151 (210)
T ss_pred             E-CCCHHHHHHHHH---CCCCCEEEECC-CCHHHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             2-027799999962---38996896156-6877889999999984798699988763


No 277
>PRK06914 short chain dehydrogenase; Provisional
Probab=95.86  E-value=0.17  Score=30.61  Aligned_cols=88  Identities=16%  Similarity=0.227  Sum_probs=54.3

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             998805698157-1116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |++..+=+-|-+ -+|..+|+.|+++|+.|.+.+|+.++.+++.++.......              +...++-+-|.+.
T Consensus         1 l~~K~alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~~~--------------~~~~~~~~Dvtd~   66 (280)
T PRK06914          1 MNKKIAIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLNLS--------------QNIKVQQLDVTDQ   66 (280)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC--------------CCEEEEECCCCCH
T ss_conf             95198999073449999999999987998999989889999999999964999--------------7669996889999


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             699999999972078998999679
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+ .+.+....+=|++|...
T Consensus        67 ~~v~~~-~~~~~~~g~iDvLVNNA   89 (280)
T PRK06914         67 NSIHNF-QLFLKEYGRIDLLVNNA   89 (280)
T ss_pred             HHHHHH-HHHHHHHCCCCEEEECC
T ss_conf             999999-99999829987899788


No 278
>PRK06182 short chain dehydrogenase; Validated
Probab=95.85  E-value=0.18  Score=30.32  Aligned_cols=81  Identities=14%  Similarity=0.224  Sum_probs=58.4

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             99880569815-71116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |++..+=+-|- +=+|..+|+.|+++|+.|.+.+|+.++.+++.+.+      +                ..+-+-|.+.
T Consensus         1 mk~Kv~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~------~----------------~~~~~Dvt~~   58 (273)
T PRK06182          1 MKKKVALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLG------I----------------HPLALDVTDE   58 (273)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC------C----------------EEEEEECCCH
T ss_conf             94698999063209999999999987998999979899999999679------9----------------7999858999


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             699999999972078998999679
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++++++.+.....+=|++|...
T Consensus        59 ~~v~~~~~~i~~~~g~iDiLVNNA   82 (273)
T PRK06182         59 ASMKAAVATILAEEGRIDVLVNNA   82 (273)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999999839988775058


No 279
>PRK06194 hypothetical protein; Provisional
Probab=95.84  E-value=0.082  Score=32.92  Aligned_cols=82  Identities=15%  Similarity=0.258  Sum_probs=56.9

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+=+|..+|+.|++.|.+|.+.||+.++.++..++.......+.                .+-+-|.+.+.+
T Consensus         7 KvavITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~----------------~~~~DVsd~~~v   70 (301)
T PRK06194          7 KVAVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVL----------------GVRTDVSDAAQV   70 (301)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHH
T ss_conf             9899927377999999999998799899997988999999999984598499----------------996568999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +++++.+......=|++|..
T Consensus        71 ~~l~~~~~~~fG~iDiLVNN   90 (301)
T PRK06194         71 EALADAALERFGAVHLLFNN   90 (301)
T ss_pred             HHHHHHHHHHHCCEEEEEEC
T ss_conf             99999999983993799955


No 280
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=95.83  E-value=0.12  Score=31.75  Aligned_cols=136  Identities=16%  Similarity=0.193  Sum_probs=77.6

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCC--CEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-5999739989999999712211278--40328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQK--VIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~--~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      ++++|-+||+|-.|+..|..|++.|. ++...|.+.=....+..+.......  -.-+...++.+..+. |.+-+...+.
T Consensus        10 ~~s~V~v~G~GGvGs~~a~~LarsGVG~l~lvD~D~v~~SNLnRQ~~a~~~~iG~~K~~~~~~rl~~iN-P~~~v~~~~~   88 (231)
T cd00755          10 RNAHVAVVGLGGVGSWAAEALARSGVGKLTLIDFDVVCVSNLNRQIHALLSTVGKPKVEVMAERIRDIN-PECEVDAVEE   88 (231)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCEECCCCHHHHHCCCHHHCCCCCHHHHHHHHHHHC-CCCEEEEEHH
T ss_conf             549789988863689999999980997599971999045444433016563369972899999999879-9988998625


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEEC
Q ss_conf             06999999999720789989996798657899999999984799430675467600035684-378845
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGG  146 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG  146 (475)
                       ....+-+.+++.  ..-|+|||+.-+ +..-..+.+.|.++++-++.++=.||.    .-| -+.++-
T Consensus        89 -~~~~~n~~~ll~--~~~D~VvDaiD~-~~~K~~l~~~c~~~~iplIss~Gag~k----~DPt~i~v~D  149 (231)
T cd00755          89 -FLTPDNSEDLLG--GDPDFVVDAIDS-IRAKVALIAYCRKRKIPVISSMGAGGK----LDPTRIRVAD  149 (231)
T ss_pred             -HCCHHHHHHHHC--CCCCEEEECCCC-HHHHHHHHHHHHHCCCEEEEECCCCCC----CCCCEEEEEE
T ss_conf             -159989999845--477778534424-877999999999829908998673467----5775389863


No 281
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=95.81  E-value=0.14  Score=31.30  Aligned_cols=125  Identities=17%  Similarity=0.231  Sum_probs=77.5

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             8805698157111688999997898-59997399899999997122--11278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      +++|-+||+|-.|.+.+..|+..|. ++.+.|.+.-....+..+--  ...-+..-+.+.++.+..+. |.+-+...+.-
T Consensus        28 ~s~VlvvG~GGLG~~~~~yLa~aGvG~i~i~D~D~ve~sNL~RQ~l~~~~~iG~~K~~~a~~~l~~~n-p~i~i~~~~~~  106 (355)
T PRK05597         28 DAKVSVIGAGGLGSPALLYLAGAGVGHITIIDDDVVDLSNLHRQVIHTTAGVGTPKAESAREAMLALN-PDVKVTVSVRR  106 (355)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEHHH
T ss_conf             29689987776689999999984997599972999261213377565412179797999999999878-99742753321


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                       -..   +.....++.-|+||||+. +|..-.-+...|...+.-++-+.+.|-+
T Consensus       107 -l~~---~na~~li~~~DvVvD~tD-n~~tR~lind~c~~~~~PlV~ga~~~~~  155 (355)
T PRK05597        107 -LDW---SNALSELADADVILDGSD-NFDTRHVASWAAARLGIPHVWASILGFD  155 (355)
T ss_pred             -CCH---HHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCCCE
T ss_conf             -577---789977528878987678-8889999999999869987996524467


No 282
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190   This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species. The enzyme from Corynebacterium glutamicum has been crystallized and characterised ..
Probab=95.80  E-value=0.19  Score=30.19  Aligned_cols=183  Identities=19%  Similarity=0.229  Sum_probs=116.5

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC-CCEE-EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             9988056981571116889999978-9859-9973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK-GFRL-AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~-G~~V-~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+|-..||||-||+|+..-.-|..+ .+++ .||.|--..+.++..+        .+...+.+-.+-++.-++.|||-|+
T Consensus         1 M~kiRaaIVGYGNlG~~V~~ai~~~PDmElvgv~~Rrd~~t~~va~~--------~~vy~V~~~~K~~~dvdv~iLC~gs   72 (326)
T TIGR01921         1 MSKIRAAIVGYGNLGKSVEEAIQQAPDMELVGVFRRRDAETLDVAEE--------LAVYAVVEDEKELEDVDVLILCTGS   72 (326)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHC--------CCHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             97057888622320079999984089804899887078875761122--------5202222223202882599973886


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHH--HHHHHH-HHHHHCCCCEECCCCCCCCCCCCCCC-EEE-EECCHHHHHH
Q ss_conf             069999999997207899899967986578--999999-99984799430675467600035684-378-8454899988
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFC--DTQIRS-LQLSEKGIYFIGIGVSGGVKGARSGA-SLM-VGGNEKAYNR  153 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~--~t~~~~-~~l~~kgi~fid~pVSGG~~gA~~G~-slM-vGG~~~~~~~  153 (475)
                      ..    ++..-.|++-.+-.-||.=-.|-+  +-++.- +.+++.                  |. |+. +|=|+-.|-.
T Consensus        73 at----d~pe~~p~fA~~~nTvDsfD~H~~Ip~~r~~~DaaA~~~------------------g~VSvis~GWDPG~fSi  130 (326)
T TIGR01921        73 AT----DLPEQKPYFAAFINTVDSFDIHTDIPDLRRTLDAAAKEA------------------GAVSVISAGWDPGLFSI  130 (326)
T ss_pred             CC----CCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHC------------------CCEEEEEECCCCCCHHH
T ss_conf             45----554345100122101236502242078999999999861------------------98789983478872679


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECCC-CHHH--HHHHHHHHHHHHH-HHH-HHHHHHHHHHH--CCCCHHHHH
Q ss_conf             899999875015678618985698-7467--8988776787888-999-89999999964--289978999
Q gi|254780716|r  154 VENILLSISAKYQNSPCCALLGPD-GSGH--FVKMIHNGIEYAN-MQL-IADIYGILRDS--LNKNPLEIS  217 (475)
Q Consensus       154 ~~piL~~iaak~~~~~cv~y~G~~-GsGh--~vKMVhNgIey~~-mq~-iaE~~~~l~~~--~~~~~~~i~  217 (475)
                      .+=++++++++..   -+++.||+ ..||  .||-| .|++-|. |.+ +-++.+=.+++  .+++-.+++
T Consensus       131 ~Rv~geA~lp~g~---tyTfwGpGlS~GHsdAvrrI-dGVk~Av~yTlP~~DA~E~~R~GE~~~LTg~~~H  197 (326)
T TIGR01921       131 NRVLGEAILPKGI---TYTFWGPGLSQGHSDAVRRI-DGVKAAVQYTLPIKDALEKVRRGEAEELTGKEIH  197 (326)
T ss_pred             HHHHHHHHHCCCC---EEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCEE
T ss_conf             9999997501686---13323788664358988765-6678886417885788898626888888756500


No 283
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=95.79  E-value=0.19  Score=30.27  Aligned_cols=75  Identities=21%  Similarity=0.337  Sum_probs=57.3

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|++.|.+|.+.+|+.++.++..++....                   ...+..-|.+.+.+++.++.+
T Consensus        17 ~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~-------------------~~~~~~Dvtd~~~v~~~v~~~   77 (251)
T PRK07523         17 SSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESLKGS-------------------AHTLAFDVTDHDAVRAAIDAF   77 (251)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC-------------------CEEEEEECCCHHHHHHHHHHH
T ss_conf             3669999999999987999999969989999999981887-------------------279999579999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      .....+=|++|...
T Consensus        78 ~~~~G~iDiLVNNA   91 (251)
T PRK07523         78 EAEIGPIDILVNNA   91 (251)
T ss_pred             HHHCCCCCEEEECC
T ss_conf             99759986999898


No 284
>PRK07814 short chain dehydrogenase; Provisional
Probab=95.79  E-value=0.13  Score=31.38  Aligned_cols=82  Identities=10%  Similarity=0.221  Sum_probs=59.5

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+++.++-......+                ..+-.-|.+.+.+
T Consensus        11 KvalITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~----------------~~~~~Dv~~~~~v   74 (263)
T PRK07814         11 QVAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRA----------------HVVAADLAHPEAT   74 (263)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE----------------EEEECCCCCHHHH
T ss_conf             989995896689999999999879989999698999999999998529928----------------9998158999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      ++.++.....+..=|++|..
T Consensus        75 ~~~v~~~~~~~G~iDiLVnN   94 (263)
T PRK07814         75 AGLAGQAVEAFGRLDIVVNN   94 (263)
T ss_pred             HHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999982998899989


No 285
>PRK09186 flagellin modification protein A; Provisional
Probab=95.78  E-value=0.14  Score=31.10  Aligned_cols=84  Identities=18%  Similarity=0.251  Sum_probs=59.6

Q ss_pred             CCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEE--EECCC
Q ss_conf             8805698--1571116889999978985999739989999999712211278403289899986057788999--97699
Q gi|254780716|r    3 QADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKIL--MMVTD   78 (475)
Q Consensus         3 k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Ii--l~vp~   78 (475)
                      |-++.+|  |-+-+|..+|+.|+++|.+|.+.||+.++.++..++....                 ...++.+  .-|.+
T Consensus         3 ~gK~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~-----------------~~~~v~~~~~Dvt~   65 (255)
T PRK09186          3 EGKTILITGAGGLIGSALVKAILEAGGIVIAADINKEALNKLLESLGTI-----------------EKTKLTLVELDITD   65 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHH-----------------CCCEEEEEECCCCC
T ss_conf             9598999795868999999999987999999969889999999999870-----------------59807999846899


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++.+......=|++|.+.
T Consensus        66 ~~~v~~~~~~~~~~~g~id~lVnnA   90 (255)
T PRK09186         66 QESLEEFLSKSQERYGKIDGAVNCA   90 (255)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999819977899757


No 286
>CHL00194 ycf39 Ycf39; Provisional
Probab=95.76  E-value=0.082  Score=32.92  Aligned_cols=109  Identities=15%  Similarity=0.154  Sum_probs=64.3

Q ss_pred             EEEEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             56981-57111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      |-++| .|..|+.+++.|+++|++|.+.-|++++...+...+....  .--..+++.+..+++..+.|+.+.+..     
T Consensus         3 ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v--~gDl~dpesl~~Al~GvdaVi~~~~~~-----   75 (319)
T CHL00194          3 LLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELV--YGDLSLPETIPPALEGITAIIDASTSR-----   75 (319)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEE--EECCCCHHHHHHHHCCCCEEEEECCCC-----
T ss_conf             9998998589999999999688908999578676323421596799--942788778999965996799945667-----


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC-EECCCCCCC
Q ss_conf             999997207899899967986578999999999847994-306754676
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY-FIGIGVSGG  132 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~-fid~pVSGG  132 (475)
                                +.+. ...-..+++.+....+.+++.|+. |+=.-+-|.
T Consensus        76 ----------~~~~-~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga  113 (319)
T CHL00194         76 ----------PSDL-NNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNA  113 (319)
T ss_pred             ----------CCCC-CHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             ----------7886-2088988988999999999849988999613566


No 287
>PRK07326 short chain dehydrogenase; Provisional
Probab=95.76  E-value=0.11  Score=31.91  Aligned_cols=80  Identities=19%  Similarity=0.285  Sum_probs=58.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|++|.+.+|+.++.+++.++....  ++                ..+-.-|.+.+.++
T Consensus         7 valITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~--~~----------------~~~~~Dv~d~~~v~   68 (235)
T PRK07326          7 AALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKR--NV----------------LGLACDVRDEADVR   68 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCC--CE----------------EEEEEECCCHHHHH
T ss_conf             9999382679999999999987999999989889999999984239--86----------------99996389999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ..++.+.....+=|++|...
T Consensus        69 ~~v~~~~~~~G~iDiLVNNA   88 (235)
T PRK07326         69 QAVDAHVEAFGGLDILVNNA   88 (235)
T ss_pred             HHHHHHHHHCCCCEEEEECC
T ss_conf             99999999829966999888


No 288
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.76  E-value=0.15  Score=31.06  Aligned_cols=80  Identities=14%  Similarity=0.148  Sum_probs=54.2

Q ss_pred             EEEEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             56981-57111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +=+.| -+-+|..+|+.|++.|.+|.+.+|++++.+++.++..... ++                ..+..-+.+.+.+++
T Consensus         8 ~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g-~~----------------~~~~~Dvs~~~~v~~   70 (238)
T PRK05786          8 VLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKYG-NV----------------IYVVGDVSKLEGARE   70 (238)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCC-CE----------------EEEECCCCCHHHHHH
T ss_conf             9992898789999999999879999999698899999999874359-77----------------999757899999999


Q ss_pred             HHHHHHHCCCCCCEEEEC
Q ss_conf             999997207899899967
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~  102 (475)
                      .++.+......-|++|..
T Consensus        71 ~~~~~~~~~g~iD~lv~n   88 (238)
T PRK05786         71 AAEKAAKVFGALHGLVVT   88 (238)
T ss_pred             HHHHHHHHHCCCCEEEEE
T ss_conf             999999983998879980


No 289
>cd01487 E1_ThiF_like E1_ThiF_like. Member of superfamily of activating enzymes (E1) of the ubiquitin-like proteins. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=95.75  E-value=0.09  Score=32.61  Aligned_cols=121  Identities=15%  Similarity=0.174  Sum_probs=64.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698157111688999997898-5999739989999999712211-278403289899986057788999976990699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +|.+||+|-.|.+.|..|++.|. ++...|.+.=....+..+.-.. .-+-.-+...++....+. |.+-+...+. ...
T Consensus         1 kV~IvG~GGLG~~~a~~La~aGvg~i~lvD~D~Ve~SNL~RQ~~~~~diG~~Ka~~a~~~l~~iN-p~i~i~~~~~-~l~   78 (174)
T cd01487           1 KVGIAGAGGLGSNIAVLLARSGVGNLKLVDFDVVEPSNLNRQQYFLSQIGEPKVEALKENLREIN-PFVKIEAINI-KID   78 (174)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHCCHHHHHHCCCHHHHHHHHHHHHHC-CCCEEEEEEC-CCC
T ss_conf             98998767889999999998189739999899466644301324777479749999999999879-7988999914-449


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHH-HHCCCCEECCCCCC
Q ss_conf             99999997207899899967986578999999999-84799430675467
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL-SEKGIYFIGIGVSG  131 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l-~~kgi~fid~pVSG  131 (475)
                      .+-++++   ++.-|+|+|++-. +.....+.+.+ ..++.-++.+...|
T Consensus        79 ~~n~~~l---~~~~D~ViD~~Dn-~~tr~~l~~~~~~~~~~plv~as~~~  124 (174)
T cd01487          79 ENNLEGL---FGDCDIVVEAFDN-AETKAMLAESLLGNKNKPVVCASGMA  124 (174)
T ss_pred             HHHHHHH---HHCCCEEEECCCC-HHHHHHHHHHHHHHCCCCEEEEEEEC
T ss_conf             9999999---8379999999999-89999999999998799599997451


No 290
>PRK07478 short chain dehydrogenase; Provisional
Probab=95.75  E-value=0.12  Score=31.77  Aligned_cols=82  Identities=15%  Similarity=0.171  Sum_probs=58.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+++.++.......+.                .+-.-|.+.+.+
T Consensus         7 KvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~~----------------~~~~Dvt~~~~v   70 (254)
T PRK07478          7 KVAIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEAV----------------ALAGDVRDEAYA   70 (254)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8799958876899999999998799999997988999999999996499089----------------997689999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +++++.......+=|++|..
T Consensus        71 ~~~v~~~~~~~G~iDiLVNN   90 (254)
T PRK07478         71 KALVALAVERFGGLDIAFNN   90 (254)
T ss_pred             HHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999984999899988


No 291
>PRK07035 short chain dehydrogenase; Provisional
Probab=95.73  E-value=0.14  Score=31.20  Aligned_cols=81  Identities=14%  Similarity=0.283  Sum_probs=56.7

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.+++.++-......+                ..+-.-|.+.+.++
T Consensus        10 valITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~----------------~~~~~Dv~~~~~v~   73 (252)
T PRK07035         10 IALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAGGKA----------------EALACHIGEMEQID   73 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHH
T ss_conf             89995887499999999999879989999798899999999999649957----------------99982489999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      +.++.+.....+=|++|..
T Consensus        74 ~~~~~~~~~~G~iDilVnn   92 (252)
T PRK07035         74 ALFAQIRERHGRLDILVNN   92 (252)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999982997789876


No 292
>PRK06138 short chain dehydrogenase; Provisional
Probab=95.72  E-value=0.15  Score=30.91  Aligned_cols=82  Identities=17%  Similarity=0.244  Sum_probs=59.4

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.||+.++.++..++... ..++                ..+-.-|.+.+.+
T Consensus         6 KvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~-~~~~----------------~~~~~Dvs~~~~v   68 (252)
T PRK06138          6 RVAIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAERVAAAIAA-GGRA----------------FARQGDVGSAEAV   68 (252)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC-CCCE----------------EEEEECCCCHHHH
T ss_conf             8899947467999999999998799899996887899999999837-9919----------------9999428999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+.....+=|++|...
T Consensus        69 ~~~~~~~~~~~G~iDiLVNNA   89 (252)
T PRK06138         69 EALVDFVAARWGRLDVLVNNA   89 (252)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999829998999898


No 293
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional
Probab=95.71  E-value=0.017  Score=37.97  Aligned_cols=34  Identities=24%  Similarity=0.626  Sum_probs=31.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             998805698157111688999997898599973998
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      |+.  |.|||-|..|...|.+|++.|++|.|+|+..
T Consensus         1 m~~--V~VIGaGivGlstA~~La~~G~~VtviDr~~   34 (410)
T PRK12409          1 MSH--IAVIGAGITGVTTAYALAQRGYQVTVFDRHR   34 (410)
T ss_pred             CCC--EEEECCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             995--9998983999999999997899189996989


No 294
>PRK12829 short chain dehydrogenase; Provisional
Probab=95.70  E-value=0.16  Score=30.81  Aligned_cols=81  Identities=17%  Similarity=0.265  Sum_probs=60.1

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.||++++.+++.++...  ....                .+-.-|.+.+.+
T Consensus        12 KvalVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~~--~~~~----------------~~~~Dvt~~~~v   73 (264)
T PRK12829         12 LRVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATAARLPG--AKVT----------------ATVADVADPAQV   73 (264)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--CCEE----------------EEEEECCCHHHH
T ss_conf             9799947376899999999998799899997998999999997479--9759----------------999628999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+......=|++|...
T Consensus        74 ~~~v~~~~~~~G~iDiLVNNA   94 (264)
T PRK12829         74 ERVFDTAVERFGGLDVLVNNA   94 (264)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999739998999899


No 295
>PRK12828 short chain dehydrogenase; Provisional
Probab=95.69  E-value=0.19  Score=30.21  Aligned_cols=81  Identities=15%  Similarity=0.206  Sum_probs=59.6

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.+|+.++.++.+++...                  ...+.+-.-|.+.+.+
T Consensus         8 KvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~------------------~~~~~~~~Dvt~~~~~   69 (239)
T PRK12828          8 KVVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQTLPGVPA------------------DALRIGGIDLVDPQAA   69 (239)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHC------------------CCCEEEEECCCCHHHH
T ss_conf             9899947254899999999998799899997987789999987517------------------8856999607999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+.....+=|++|...
T Consensus        70 ~~~v~~~~~~~G~iDilVnNA   90 (239)
T PRK12828         70 RRAVDEVNRQFGRLDALVNIA   90 (239)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999839997999897


No 296
>PRK05600 thiamine biosynthesis protein ThiF; Validated
Probab=95.68  E-value=0.1  Score=32.29  Aligned_cols=126  Identities=14%  Similarity=0.158  Sum_probs=77.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             98805698157111688999997898-59997399899999997122--1127840328989998605778899997699
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      +++.|-+||+|-.|.+.+..|+..|. ++.+.|.+.=....+..+--  ...-+..-+.+.++.+..++ |.+-+..++.
T Consensus        40 ~~a~VlvvG~GGLG~p~~~yLaaaGvG~i~ivD~D~Ve~sNL~RQil~~~~diG~~K~~~A~~~l~~lN-p~i~i~~~~~  118 (370)
T PRK05600         40 HNARVLVIGAGGLGCPAMQSLASAGVGTITLIDDDTVDVSNIHRQILFGASDVGRPKVEVAAERLKEIQ-PDIRVNALRE  118 (370)
T ss_pred             HCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHHC-CCCCEEEHHH
T ss_conf             619789988875789999999982897489873898260210555426976669757999999999878-9971573566


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             0699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      - -..   +.+...++.-|+||||+- ++..-.-....|...++-++-+.+.|-+
T Consensus       119 ~-l~~---~n~~~li~~~DvVvD~tD-Nf~tRylindaC~~~~~PlV~ga~~~~e  168 (370)
T PRK05600        119 R-LTA---ENAVELLNGVDLVLDGSD-SFATKFLVADAAEITGTPLVWGTVLRFH  168 (370)
T ss_pred             H-CCH---HHHHHHHHCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEEECCCE
T ss_conf             4-699---999987636878997788-8799999999999849976984532628


No 297
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=95.68  E-value=0.16  Score=30.77  Aligned_cols=75  Identities=19%  Similarity=0.295  Sum_probs=56.1

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|++.|..|.+.+|+.++.+++.++..   .++                ..+-.-|.+.+.++..++.+
T Consensus        14 ~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~~~~---~~~----------------~~~~~Dv~~~~~v~~~~~~~   74 (245)
T PRK12936         14 ASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAAELG---ERV----------------KIFPANLSDRDEVKALGQKA   74 (245)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---CCE----------------EEEECCCCCHHHHHHHHHHH
T ss_conf             47689999999999869999998299999999999838---966----------------99991379999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      ......=|++|...
T Consensus        75 ~~~~g~iDiLINnA   88 (245)
T PRK12936         75 EADLEGVDILVNNA   88 (245)
T ss_pred             HHHCCCCCEEEECC
T ss_conf             99759996999899


No 298
>PRK05855 short chain dehydrogenase; Validated
Probab=95.65  E-value=0.12  Score=31.57  Aligned_cols=72  Identities=15%  Similarity=0.180  Sum_probs=36.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             11688999997898599973998999999971221127840328989998605778899997699069999999997207
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLL   93 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l   93 (475)
                      +|.++|+.|++.|.+|.+.|++.+..++..++-...+....                .+.+-|.+.+++++..+.+....
T Consensus       327 IGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~----------------~~~~DVtd~~av~al~~~v~~~~  390 (582)
T PRK05855        327 IGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAH----------------AYRVDVSDADAMEALAEWVGAEH  390 (582)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHHHHHHHHHHHHC
T ss_conf             99999999997799999960799999999999995198489----------------99755899999999999999976


Q ss_pred             CCCCEEEE
Q ss_conf             89989996
Q gi|254780716|r   94 SPEDILLD  101 (475)
Q Consensus        94 ~~g~iiID  101 (475)
                      ..=||+|.
T Consensus       391 G~iDILVN  398 (582)
T PRK05855        391 GVPDIVVN  398 (582)
T ss_pred             CCCCEEEE
T ss_conf             99999998


No 299
>PRK07776 consensus
Probab=95.65  E-value=0.22  Score=29.78  Aligned_cols=79  Identities=13%  Similarity=0.212  Sum_probs=55.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|++|++.|.+|.+.+|++++.++..++...  ...                -.+..-+.+.+.++
T Consensus        10 v~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~~--~~~----------------~~~~~Dv~~~~~~~   71 (252)
T PRK07776         10 TAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAAQLGA--ERA----------------LGVAGHAVDEEHAR   71 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCE----------------EEEEEECCCHHHHH
T ss_conf             899947787999999999998799899997988999999998479--957----------------99997428999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      +.++.+.....+=|++|.-
T Consensus        72 ~~~~~~~~~~g~iDilVnN   90 (252)
T PRK07776         72 EAVDLTLERFGSVDILVNN   90 (252)
T ss_pred             HHHHHHHHHHCCCCEEEEC
T ss_conf             9999999984998699987


No 300
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=95.63  E-value=0.21  Score=29.98  Aligned_cols=100  Identities=15%  Similarity=0.223  Sum_probs=71.0

Q ss_pred             EEEEEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC-CCCC--CEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             056981-57111688999997898599973998999999971221-1278--4032898999860577889999769906
Q gi|254780716|r    5 DIGIIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG-LSQK--VIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~-~~~~--~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ++-++| .|..|...|+-|++.|-+|..-.|+.++.+++.++-.. ....  .....+.++....+...++||..-++|-
T Consensus        30 ~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~~ek~~~~a~~i~~r~g~~~~~~~~~~~~~~~~~l~~adiV~~a~aAGv  109 (194)
T cd01078          30 TAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQKAADSLRARFGEGVGAVETSDDAARAAAIKGADVVFAAGAAGV  109 (194)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCEEEECCHHHH
T ss_conf             89998588578999999999839979999587888999999999970987311357887789977466989996427778


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCH
Q ss_conf             999999999720789989996798657
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHF  107 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~  107 (475)
                        + ++.+.....+++.+++|..-..|
T Consensus       110 --~-~~~~~~~~~k~l~Vv~DVNAvPP  133 (194)
T cd01078         110 --E-LLEKLAWAPKPLAVAADVNAVPP  133 (194)
T ss_pred             --H-HHHHHHHCCCCCEEEEECCCCCC
T ss_conf             --8-87888850888659986589998


No 301
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=95.62  E-value=0.16  Score=30.79  Aligned_cols=79  Identities=23%  Similarity=0.318  Sum_probs=55.3

Q ss_pred             EEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             5698157-111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      |=+-|-+ -+|..+|+.|++.|.+|.+.+|+.++.++..++..... .+                ..+-.-|.+.+.++.
T Consensus         3 VlITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g-~~----------------~~~~~Dv~~~~~v~~   65 (259)
T PRK08340          3 VLVTASSRGIGFNVARELLKKGARVVISSRNEENLEKALKELKELG-EV----------------YAIKADLSDKDDLKN   65 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC-CE----------------EEEEEECCCHHHHHH
T ss_conf             9997587789999999999879999999799899999999987418-87----------------999963699899999


Q ss_pred             HHHHHHHCCCCCCEEEE
Q ss_conf             99999720789989996
Q gi|254780716|r   85 LIDKLKPLLSPEDILLD  101 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID  101 (475)
                      ++++....+..=|++|.
T Consensus        66 ~v~~~~~~~G~iD~LVn   82 (259)
T PRK08340         66 LVKEAWELLGGIDALVW   82 (259)
T ss_pred             HHHHHHHHHCCCCEEEE
T ss_conf             99999998599888998


No 302
>PRK06123 short chain dehydrogenase; Provisional
Probab=95.62  E-value=0.22  Score=29.69  Aligned_cols=86  Identities=17%  Similarity=0.331  Sum_probs=58.9

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--1571116889999978985999-7399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |++ +|.+|  |-+-+|..+|+.|++.|++|.+ |+++.+..+++.+........+.                .+-.-|.
T Consensus         1 m~n-KvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~   63 (249)
T PRK06123          1 MMR-KVMIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEAL----------------AVAADVA   63 (249)
T ss_pred             CCC-CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEE----------------EEECCCC
T ss_conf             999-88999686879999999999987998999808987899999999996499099----------------9984799


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.++.+++.+.....+=|++|...
T Consensus        64 ~~~~v~~~~~~~~~~~G~iDiLVnNA   89 (249)
T PRK06123         64 DEADVLRLFEAVDRELGRLDALVNNA   89 (249)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999999999999829987899888


No 303
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.61  E-value=0.14  Score=31.14  Aligned_cols=78  Identities=18%  Similarity=0.390  Sum_probs=54.8

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             1571116889999978985999-739989999999712211278403289899986057788999976990699999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDK   88 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~   88 (475)
                      |-+-+|..+|+.|+++|++|.+ ++++.++.+++.++......++                ..+-.-+.+.+.+++.++.
T Consensus        13 gs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~----------------~~~~~Dl~~~~~~~~~~~~   76 (247)
T PRK05565         13 ASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDA----------------IAVKADVSSEDDVENLVEQ   76 (247)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHHHHHHH
T ss_conf             845899999999998799899981799899999999999639908----------------9998358999999999999


Q ss_pred             HHHCCCCCCEEEECC
Q ss_conf             972078998999679
Q gi|254780716|r   89 LKPLLSPEDILLDGG  103 (475)
Q Consensus        89 l~~~l~~g~iiID~s  103 (475)
                      +.....+=|++|...
T Consensus        77 ~~~~~g~iD~lVnnA   91 (247)
T PRK05565         77 IVEKFGKIDILVNNA   91 (247)
T ss_pred             HHHHCCCCCEEEECC
T ss_conf             999809984999899


No 304
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=95.61  E-value=0.2  Score=29.98  Aligned_cols=80  Identities=15%  Similarity=0.264  Sum_probs=59.9

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.|++.++.++..++...   +.                ..+-.-|.+.+.+
T Consensus         6 KvalVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g~---~~----------------~~~~~Dvt~~~~v   66 (256)
T PRK07067          6 KVALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIGP---AA----------------VAVSLDVTRQDSI   66 (256)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC---CE----------------EEEEEECCCHHHH
T ss_conf             8899937677899999999998799999997988999999998199---75----------------9999848999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+.....+=|++|...
T Consensus        67 ~~~v~~~~~~~G~iDiLVNNA   87 (256)
T PRK07067         67 DRIVAAAVERFGGIDILVNNA   87 (256)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999819998999899


No 305
>TIGR02371 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742   This enzyme, a homologue of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other archaea..
Probab=95.60  E-value=0.062  Score=33.80  Aligned_cols=123  Identities=18%  Similarity=0.203  Sum_probs=75.0

Q ss_pred             CEEEEEECCHHHHH--HHHHHHHCCCEEEEEECCHHHHHHHHHHCC-CCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             80569815711168--899999789859997399899999997122-112784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSN--LSLNILDKGFRLAVYNKDFELTDVFIKKIS-GLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~--mA~nL~~~G~~V~vydr~~~~~~~l~~~~~-~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      +-|||||.|+--.-  +|.+=.-.==+|.+|+|+++..++|+.+.. ...-.+..+.++.|-+..||   ++.+.-|+=+
T Consensus       130 sv~G~iGaG~QA~tQL~Al~rVfd~eeV~~y~rt~~~~~kF~~~~skd~~~~~~a~~~p~E~v~~cD---ilVTtTPsRk  206 (327)
T TIGR02371       130 SVLGLIGAGRQAYTQLEALSRVFDLEEVKVYSRTKEAAEKFVKRASKDYEVPVRAATDPAEKVEDCD---ILVTTTPSRK  206 (327)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHCCCCCCEEECCCCHHHHCCCC---EEEEECCCCC
T ss_conf             3355763685799999998762554506998617688999998752024651242126747770786---7998568989


Q ss_pred             HH-HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEE-----------CCCCCCCCCC
Q ss_conf             99-9999999720789989996798657899999999984799430-----------6754676000
Q gi|254780716|r   81 PV-DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI-----------GIGVSGGVKG  135 (475)
Q Consensus        81 ~v-~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fi-----------d~pVSGG~~g  135 (475)
                      +| .+      ...++|.=|-=.|---+-..+-=-+.|++..|-+-           -.|||-|.-+
T Consensus       207 PvVkA------~WV~eGTHInAiGADapGKqELDpeiLk~aki~vDdleQA~HsGEiNVp~skg~i~  267 (327)
T TIGR02371       207 PVVKA------DWVEEGTHINAIGADAPGKQELDPEILKKAKIVVDDLEQAKHSGEINVPISKGVIR  267 (327)
T ss_pred             CEEEE------ECCCCCCCEEEECCCCCCCCCCCHHHHHCCCEEEECHHHCCCCCEEEECCCCCEEE
T ss_conf             60754------22598882551057888831003687632706885133200176471021377233


No 306
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=95.55  E-value=0.17  Score=30.55  Aligned_cols=83  Identities=22%  Similarity=0.360  Sum_probs=59.7

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-.-+|..+|+.|++.|.+|.+.||+.++.++..++....+..+.                .+-.-|.+.+.+
T Consensus         8 KvalVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~----------------~~~~Dvt~~~~v   71 (262)
T PRK13394          8 KTAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAI----------------GVAMDVTNEDAV   71 (262)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHH
T ss_conf             9899958577899999999998799999997988999999999996299399----------------998158999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.....+..=|++|...
T Consensus        72 ~~~v~~~~~~~G~iDiLVnnA   92 (262)
T PRK13394         72 NAGIDKVAERFGSVDILVSNA   92 (262)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999819999999899


No 307
>PRK06198 short chain dehydrogenase; Provisional
Probab=95.54  E-value=0.17  Score=30.50  Aligned_cols=82  Identities=11%  Similarity=0.188  Sum_probs=57.4

Q ss_pred             EEEEE-CCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             56981-571116889999978985-9997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGIIG-LGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiIG-LG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +=+-| -+-+|..+|+.|++.|.+ |.+++|+.++.+++.++......++                ..+-.-|.+.+.++
T Consensus         9 alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~Dv~~~~~v~   72 (268)
T PRK06198          9 ALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKA----------------VFVQADLAKVEDCR   72 (268)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHH
T ss_conf             99958577899999999998799389996298889999999999549967----------------99982689999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+++.......+=|++|...
T Consensus        73 ~~~~~~~~~fG~iDiLVNnA   92 (268)
T PRK06198         73 AVVAAADEAFGRLDALVNAA   92 (268)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999839998999899


No 308
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089   This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , . In most species this protein is bifunctional, existing as fused alpha-beta domains. In Pyrococcus and related species, however, the domains exist as separate polypeptides. This entry represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. One of these (along with its beta-domain partner) was characterised as ACS-II showing specificity for phenylacetyl-CoA . This entry excludes non-ACS-I paralogs. .
Probab=95.53  E-value=0.085  Score=32.78  Aligned_cols=252  Identities=17%  Similarity=0.232  Sum_probs=165.9

Q ss_pred             EEEEEEC----CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC-CCCC-CEECCCHHHH-HHHCCCCCEEEEECC
Q ss_conf             0569815----7111688999997898599973998999999971221-1278-4032898999-860577889999769
Q gi|254780716|r    5 DIGIIGL----GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG-LSQK-VIVTKNLEQM-VEAVCKPRKILMMVT   77 (475)
Q Consensus         5 ~IGiIGL----G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~-~~~~-~~~~~s~~e~-v~~l~~pr~Iil~vp   77 (475)
                      .|.+||-    |..|..+-+||.+-||+=.+|=.|+..         . .-.+ ++++.++.+. -+.+|   ..+++||
T Consensus         9 SvAVIGAS~~~gKVGy~i~~NL~~~Gy~G~~YPVNpk~---------~i~i~Gr~k~Y~~~~~~dP~~VD---LAVivvP   76 (457)
T TIGR02717         9 SVAVIGASRDEGKVGYAIMKNLIEGGYKGKIYPVNPKA---------GIEILGRVKAYPSVLEIDPDEVD---LAVIVVP   76 (457)
T ss_pred             CEEEECCCCCCCCCCHHHHEEEECCCCEEEEEEECCCC---------CEEEEECCCCCCCHHHCCCCCCC---EEEEECC
T ss_conf             15897124889851002200000378303687622788---------71463011457871114899734---7999728


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC-----CCCHHHHHHHHHHHHHCCCCEECCCCC--------------------CC
Q ss_conf             90699999999972078998999679-----865789999999998479943067546--------------------76
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG-----NSHFCDTQIRSLQLSEKGIYFIGIGVS--------------------GG  132 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s-----ts~~~~t~~~~~~l~~kgi~fid~pVS--------------------GG  132 (475)
                      + +.|-+|+++-...==+|-+||-.|     +...+--+++.+.|++-|++.|+.=+.                    |+
T Consensus        77 a-~~vp~v~eECG~KGVkg~vvI~AGF~E~G~eG~~LE~~l~~~a~kYg~Rl~GPNclG~~nt~~~lNAtFA~~~p~~G~  155 (457)
T TIGR02717        77 A-KLVPQVVEECGEKGVKGAVVITAGFKEVGEEGAELEQKLVEIARKYGMRLLGPNCLGIINTEIKLNATFAPTMPKKGG  155 (457)
T ss_pred             H-HHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCEEEEECCCHHHHHCCCCCCCCCCC
T ss_conf             5-679999999861795189997148645316789999999999976788177673622581440211001357889887


Q ss_pred             -----CCCC------------CCCCEEEEE-CCHHHHHHHHHHHHHHHCCCC--------------------------CC
Q ss_conf             -----0003------------568437884-548999888999998750156--------------------------78
Q gi|254780716|r  133 -----VKGA------------RSGASLMVG-GNEKAYNRVENILLSISAKYQ--------------------------NS  168 (475)
Q Consensus       133 -----~~gA------------~~G~slMvG-G~~~~~~~~~piL~~iaak~~--------------------------~~  168 (475)
                           ..||            .-|.|-||| |++...+.. .+|+-++..-+                          ..
T Consensus       156 Iaf~SQSGAl~~a~Ldwa~~~~vGfS~~VS~GNkAD~~e~-Dlley~~~D~~T~~I~~Y~Eg~~DG~~Fl~~A~~~s~~K  234 (457)
T TIGR02717       156 IAFISQSGALLTALLDWAEKNGVGFSYFVSLGNKADIDES-DLLEYLADDPDTKVILLYLEGIKDGRKFLKTAKEISKKK  234 (457)
T ss_pred             EEEEEHHHHHHHHHHHHHHHCCCCEEEEEECCCCEECCHH-HHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             7789712589999999998727813477826741111657-788898539894089997178704168999988863059


Q ss_pred             CE-EEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             61-89856987467898877678788899989999999-96428997899999986068844307999999999740567
Q gi|254780716|r  169 PC-CALLGPDGSGHFVKMIHNGIEYANMQLIADIYGIL-RDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTI  246 (475)
Q Consensus       169 ~c-v~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l-~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~  246 (475)
                      |= +.=-|.+-+|.-+=+=|=|=.=|.    -++|..+ |+++-.--+-+.+.|+              .++.|..-...
T Consensus       235 Piv~lKsG~s~~GakAA~SHTGaLAGs----~~~y~aaf~q~G~iRa~~~~ELfd--------------~A~~L~~~~~~  296 (457)
T TIGR02717       235 PIVVLKSGTSEAGAKAASSHTGALAGS----DEAYDAAFKQAGVIRADSIEELFD--------------LARLLSNQPLP  296 (457)
T ss_pred             CEEEEECCCCHHHHHHHHHCCCHHHHH----HHHHHHHHCCCCEEEEECHHHHHH--------------HHHHHHCCCCC
T ss_conf             889993688834567652102313366----899998743014388701778899--------------99998358989


Q ss_pred             -CCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             -9995200102333658716778988775178885146777888775
Q gi|254780716|r  247 -TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS  292 (475)
Q Consensus       247 -~g~~lid~i~d~~~~kgTg~Wt~~~a~~lgvp~p~i~~av~aR~~S  292 (475)
                       .|    ++|.=.-+.=|.|--|+=...+.|.+..-+.++...|..-
T Consensus       297 ~~g----~~~~IiTN~GG~Gvia~D~~~~~Gl~L~~~~~~t~~~L~~  339 (457)
T TIGR02717       297 PKG----NRVAIITNAGGPGVIATDACEEVGLELAELSEKTKEKLRN  339 (457)
T ss_pred             CCC----CEEEEEECCCCHHHHHHHHHHHCCCEEECCCHHHHHHHHH
T ss_conf             988----7699997896167787656777497455585899999997


No 309
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.52  E-value=0.18  Score=30.44  Aligned_cols=81  Identities=17%  Similarity=0.311  Sum_probs=58.3

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|+++|++|.+.+|+.++.+++.++-..  .++                ..+..-|.+.+.+
T Consensus         7 K~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~~--~~~----------------~~~~~Dv~~~~~~   68 (250)
T PRK07231          7 KVAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVAAEIRG--GRA----------------IAVAADVSDEADV   68 (250)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCE----------------EEEEEECCCHHHH
T ss_conf             8899938886899999999998799999997988999999998449--967----------------9999307999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+...+.+=|++|...
T Consensus        69 ~~~~~~~~~~~g~iD~lInnA   89 (250)
T PRK07231         69 RAAVEAALERFGSVDILVNNA   89 (250)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999819971999888


No 310
>PRK12548 shikimate 5-dehydrogenase; Provisional
Probab=95.50  E-value=0.085  Score=32.78  Aligned_cols=15  Identities=13%  Similarity=0.016  Sum_probs=6.3

Q ss_pred             EEEECCHHHHHHHHH
Q ss_conf             997399899999997
Q gi|254780716|r   30 AVYNKDFELTDVFIK   44 (475)
Q Consensus        30 ~vydr~~~~~~~l~~   44 (475)
                      ..++..++..+++++
T Consensus        42 ~~~~v~~~~l~~~~~   56 (289)
T PRK12548         42 LAFDVPKEKVADAIT   56 (289)
T ss_pred             EEEECCHHHHHHHHH
T ss_conf             978778889999999


No 311
>PRK07825 short chain dehydrogenase; Provisional
Probab=95.50  E-value=0.2  Score=30.07  Aligned_cols=73  Identities=19%  Similarity=0.245  Sum_probs=52.7

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHH
Q ss_conf             57111688999997898599973998999999971221127840328989998605778899997699069999999997
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLK   90 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~   90 (475)
                      -+-+|..+|+.|++.|.+|.+.||+.++.++..++...    +.                .+-+-|.+.+.++++++.+.
T Consensus        14 ssGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~~----~~----------------~~~~DVtd~~~v~~~~~~~~   73 (273)
T PRK07825         14 ARGIGLATARALAALGAKVAIGDLDEALAKESAAELGL----VV----------------GGPLDVTDPASFAAFLDAVE   73 (273)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC----CE----------------EEECCCCCHHHHHHHHHHHH
T ss_conf             33999999999998799899997999999999986078----55----------------99914799999999999999


Q ss_pred             HCCCCCCEEEECC
Q ss_conf             2078998999679
Q gi|254780716|r   91 PLLSPEDILLDGG  103 (475)
Q Consensus        91 ~~l~~g~iiID~s  103 (475)
                      ....+=|++|...
T Consensus        74 ~~~G~iDiLVNNA   86 (273)
T PRK07825         74 ADLGPIDVLVNNA   86 (273)
T ss_pred             HHHCCCCEEEECC
T ss_conf             9709977899878


No 312
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=95.45  E-value=0.16  Score=30.82  Aligned_cols=83  Identities=12%  Similarity=0.245  Sum_probs=57.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999-73998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+|  |-+-+|..+|+.|+++|++|.+ |+++.+..+++.++.......+.                .+-.-|.+.+.
T Consensus         7 KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dvs~~~~   70 (252)
T PRK06947          7 KVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRAC----------------VVAGDVANEAD   70 (252)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHH
T ss_conf             08999388358999999999987998999808987899999999996499289----------------99847999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.+++........=|++|...
T Consensus        71 v~~~~~~~~~~~G~iD~lVnNA   92 (252)
T PRK06947         71 VIAMFDAVQAAFGRLDALVNNA   92 (252)
T ss_pred             HHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999849988999876


No 313
>PRK08324 short chain dehydrogenase; Validated
Probab=95.43  E-value=0.2  Score=30.10  Aligned_cols=51  Identities=8%  Similarity=0.163  Sum_probs=27.2

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCHHHCCC-CCCCCCHHHHHHHHHHHHCCCCCHH
Q ss_conf             430799999999974056799952001023-3365871677898877517888514
Q gi|254780716|r  228 LSSYLIKITAEILSSSDTITGMPIIDVICD-KASQKGTGIRSIIEGHKLSSSMTIT  282 (475)
Q Consensus       228 ~~syLl~i~~~il~~k~~~~g~~lid~i~d-~~~~kgTg~Wt~~~a~~lgvp~p~i  282 (475)
                      ..-|.||-.+  |++...  ..+|--+|.= .-+..|-|+=++..=.+.|..+-..
T Consensus       400 ~EYW~LEqaK--L~~~~~--~~~L~GKVALVTGga~GIG~A~A~~fa~eGA~Vvl~  451 (676)
T PRK08324        400 IEYWSLEQAK--LQKMPK--PKPLAGKVALVTGAAGGIGLATAKRLAAEGACVVLA  451 (676)
T ss_pred             CCCCHHHHHH--HHCCCC--CCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             5655177888--626899--988899879994798816299999999879989999


No 314
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=95.43  E-value=0.18  Score=30.45  Aligned_cols=83  Identities=16%  Similarity=0.395  Sum_probs=58.8

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999-73998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+|  |-+-+|.++|+.|++.|.+|.+ |+++.+..+++.++.......+.                .+-.-|.+.+.
T Consensus         7 KvalVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dvs~~~~   70 (247)
T PRK12935          7 KVAIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVY----------------AVQADVSKVED   70 (247)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHH
T ss_conf             98999172768999999999987998999769998999999999984399589----------------99857999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++.++.......+=|++|...
T Consensus        71 ~~~~v~~~~~~~G~iDiLVNNA   92 (247)
T PRK12935         71 ANRLVEEAVNHFGKVDILVNNA   92 (247)
T ss_pred             HHHHHHHHHHHCCCCCEEEECC
T ss_conf             9999999999839998999899


No 315
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.
Probab=95.41  E-value=0.26  Score=29.20  Aligned_cols=105  Identities=18%  Similarity=0.266  Sum_probs=67.5

Q ss_pred             ECCHHHHHHHHHHHHCC----CE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             15711168899999789----85-99973998999999971221127840328989998605778899997699069999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKG----FR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G----~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      |+|+.|+..++-|.++.    ++ +.+.+|++.+.+...     .......+.++.++++.. .+++|+-|-+. +++. 
T Consensus         1 G~G~VG~~v~~~l~~~~~~~~~~l~~v~~r~~~~~~~~~-----~~~~~~~~~d~~~ll~~~-~iDvVVE~~g~-~~~~-   72 (116)
T pfam03447         1 GCGAIGSGLLELLLRQQEEIPLELVAVADRDLLSKARAA-----LLGDEPVTLDLDDLVADP-RPDVVVECASS-EAVA-   72 (116)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCEEEEEEEECCHHHCCCCC-----CCCCCEEECCHHHHHCCC-CCCEEEECCCC-HHHH-
T ss_conf             987028999999994920356799999847834323212-----466671577999996188-99899988994-8999-


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHH---HHHHHHHHHHCCCCE
Q ss_conf             9999972078998999679865789---999999998479943
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGGNSHFCD---TQIRSLQLSEKGIYF  124 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~sts~~~~---t~~~~~~l~~kgi~f  124 (475)
                        +-..+.|+.|.-+|-..-.-..+   -.++.+.++++|..+
T Consensus        73 --~~~~~aL~~GkhVVTaNK~~lA~~~~~~eL~~~A~~~g~~~  113 (116)
T pfam03447        73 --EYVLKALKAGKHVVTASKGALADLALRERLREAAEASGVRV  113 (116)
T ss_pred             --HHHHHHHHCCCEEEEECHHHHCCHHHHHHHHHHHHHCCCEE
T ss_conf             --99999998799899907889678579999999999839969


No 316
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism]
Probab=95.41  E-value=0.15  Score=30.89  Aligned_cols=124  Identities=19%  Similarity=0.294  Sum_probs=64.9

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--------CCEE---EEEECCHHHHHHHHHHCCCCCCCCEECCCH-----HHHHH
Q ss_conf             9988056981571116889999978--------9859---997399899999997122112784032898-----99986
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--------GFRL---AVYNKDFELTDVFIKKISGLSQKVIVTKNL-----EQMVE   64 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--------G~~V---~vydr~~~~~~~l~~~~~~~~~~~~~~~s~-----~e~v~   64 (475)
                      |++-+||++|+|..|+++++-|.++        |.++   .+-||+..+...+-  ....   .....++     .+++.
T Consensus         1 ~~~v~v~l~G~G~VG~~~~~il~~~~~~l~~~~g~~i~v~~v~~~~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~~~   75 (333)
T COG0460           1 MKTVKVGLLGLGTVGSGVLEILAEKQEELRKRAGIEIRVVAVADRDGSLVRDLD--LLNA---EVWTTDGALSLGDEVLL   75 (333)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCC--CCCH---HHHEECCCCCCCHHHHC
T ss_conf             954899998337142999999998268887632872699999961530113566--5332---34300553244276650


Q ss_pred             HCCCCCEEEEECCC-HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHH--HHHHHHHHHCCCC-EECCCCCCC
Q ss_conf             05778899997699-06999999999720789989996798657899--9999999847994-306754676
Q gi|254780716|r   65 AVCKPRKILMMVTD-GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDT--QIRSLQLSEKGIY-FIGIGVSGG  132 (475)
Q Consensus        65 ~l~~pr~Iil~vp~-g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t--~~~~~~l~~kgi~-fid~pVSGG  132 (475)
                      . ...++++-+++. -...+. .+-+...|+.|.-||- .|=.+-..  .++.+.+++.|.. +.++.|.||
T Consensus        76 ~-~~~dvvve~~~~d~~~~~~-~~~~~~al~~GkhVVT-aNK~~lA~~~~el~~~A~~~g~~l~yEAtV~gG  144 (333)
T COG0460          76 D-EDIDVVVELVGGDVEPAEP-ADLYLKALENGKHVVT-ANKALLALHYHELREAAEKNGVKLLYEATVGGG  144 (333)
T ss_pred             C-CCCCEEEECCCCCCCCHHH-HHHHHHHHHCCCEEEC-CCCHHHHHHHHHHHHHHHHHCCEEEEEEEECCC
T ss_conf             4-5688798557666874123-8999999975996997-896476766999999999739858998550257


No 317
>PRK06500 short chain dehydrogenase; Provisional
Probab=95.40  E-value=0.26  Score=29.18  Aligned_cols=75  Identities=13%  Similarity=0.099  Sum_probs=54.4

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|..+|+.|++.|.+|.+.+|++++.++..++...   +.                ..+-.-+.+.+.++++++.+
T Consensus        14 as~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~---~~----------------~~~~~Dv~~~~~~~~~~~~~   74 (249)
T PRK06500         14 GTSGIGLETARQFAAEGARVAITGRDAATLEAARAELGE---DA----------------LVIRNDAGSVAAQRALAQAL   74 (249)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC---CE----------------EEEEEECCCHHHHHHHHHHH
T ss_conf             687899999999998799999996998999999998589---75----------------99995179999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      .....+=|++|...
T Consensus        75 ~~~~g~iDiLvnnA   88 (249)
T PRK06500         75 AEAGGRLDAVFINA   88 (249)
T ss_pred             HHHCCCCCEEEECC
T ss_conf             99769998999899


No 318
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=95.39  E-value=0.21  Score=29.98  Aligned_cols=79  Identities=15%  Similarity=0.192  Sum_probs=54.0

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||+.++.+++.++...   ++.                .+-.-+.+.+.++
T Consensus         7 valITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~---~~~----------------~~~~Dv~~~~~~~   67 (262)
T TIGR03325         7 VVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGD---AVV----------------GVEGDVRSLDDHK   67 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC---CEE----------------EEECCCCCHHHHH
T ss_conf             899906787899999999998799999998998999999986799---679----------------9984579999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.......+=|++|...
T Consensus        68 ~~v~~~~~~~G~iDiLVnNA   87 (262)
T TIGR03325        68 EAVARCVAAFGKIDCLIPNA   87 (262)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999849988899726


No 319
>PRK06940 short chain dehydrogenase; Provisional
Probab=95.38  E-value=0.27  Score=29.13  Aligned_cols=85  Identities=16%  Similarity=0.244  Sum_probs=55.1

Q ss_pred             CCCCEEEEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             998805698-1571116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |++ +|-+| |-|-+|.++|+.|+ .|..|.+.||+.++.+++.++.......+.                .+-.-|.+.
T Consensus         3 L~~-kV~v~tGa~GIG~aiA~~la-~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~----------------~~~~Dvs~~   64 (277)
T PRK06940          3 MSK-EVVVVIGAGGMGQAIARRVG-SGKTVLLADYNEENLQAVARTLREAGFDVI----------------TQQVDVSSR   64 (277)
T ss_pred             CCC-CEEEECCCCHHHHHHHHHHH-HCCEEEEEECCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCH
T ss_conf             899-29999781699999999998-199899998988999999999872288299----------------998257998


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             6999999999720789989996798
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~st  104 (475)
                      +.++.+++.. ..+.+=|++|...-
T Consensus        65 ~~v~~l~~~~-~~~G~idiLVnnAG   88 (277)
T PRK06940         65 ESVKALAQTA-ATLGAVTGLVHTAG   88 (277)
T ss_pred             HHHHHHHHHH-HHHCCCCEEEECCC
T ss_conf             9999999999-98699879998886


No 320
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]
Probab=95.38  E-value=0.049  Score=34.55  Aligned_cols=166  Identities=16%  Similarity=0.172  Sum_probs=87.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC--CEEEEEEC-C-HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             0569815711168899999789--85999739-9-899999997122112784032898999860577889999769906
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG--FRLAVYNK-D-FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G--~~V~vydr-~-~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      +||+=|.|.+|+..++.+..++  .+|.+-|- + ++....+.+. ......+.+.-+.++-...++...+=        
T Consensus         3 kV~INGfGrIGR~v~ra~~~~~~dieVVaInd~t~~~~~A~Llk~-Ds~hg~f~~~v~~~~~~~~v~g~~I~--------   73 (335)
T COG0057           3 KVAINGFGRIGRLVARAALERDGDIEVVAINDLTDPDYLAHLLKY-DSVHGRFDGEVEVKDDALVVNGKGIK--------   73 (335)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHH-CCCCCCCCCCCCCCCCEEEECCCEEE--------
T ss_conf             899945757889999999717897599999368997899899864-25578877732247874898995268--------


Q ss_pred             HHHHHHH-HHHHCCCCC-CEEEECCCCCHHHHHHHHHHHHHCCCC--EECCCCCCCCCCCCCCCEEEEECCHHHHHHHHH
Q ss_conf             9999999-997207899-899967986578999999999847994--306754676000356843788454899988899
Q gi|254780716|r   81 PVDQLID-KLKPLLSPE-DILLDGGNSHFCDTQIRSLQLSEKGIY--FIGIGVSGGVKGARSGASLMVGGNEKAYNRVEN  156 (475)
Q Consensus        81 ~v~~vi~-~l~~~l~~g-~iiID~sts~~~~t~~~~~~l~~kgi~--fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~p  156 (475)
                       |....+ ..+|.-+-| ||+|||+-.+- ......+.+++.|+.  ++.+|-.+-      -+.+..|-..+.|+.-+.
T Consensus        74 -v~~~~~p~~l~w~d~gvdiVve~Tg~f~-~~e~~~~hl~agGaKkV~isap~~~~------~~~vv~gvn~~~~~~~~~  145 (335)
T COG0057          74 -VLAERDPANLPWADLGVDIVVECTGKFT-GREKAEKHLKAGGAKKVLISAPGKDD------VATVVYGVNHNYYDAGHT  145 (335)
T ss_pred             -EEECCCHHHCCCCCCCCCEEEECCCCCC-CHHHHHHHHHHCCCCEEEECCCCCCC------CCEEEEECCCCCCCCCCC
T ss_conf             -8732896879812128639998998766-63347999874599789985789888------617998525133578884


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH--HHHHHHHHHH
Q ss_conf             99987501567861898569874678988776--7878889998
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGPDGSGHFVKMIHN--GIEYANMQLI  198 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN--gIey~~mq~i  198 (475)
                      +....           =|-..+-.-.+|.+|.  |||.|.|..+
T Consensus       146 iVsna-----------SCTTNcLap~~kvl~d~fGI~~g~mTtV  178 (335)
T COG0057         146 IVSNA-----------SCTTNCLAPVAKVLNDAFGIEKGLMTTV  178 (335)
T ss_pred             EEEEC-----------CCHHHHHHHHHHHHHHHCCEEEEEEEEE
T ss_conf             89874-----------5113006787999988609459999999


No 321
>PRK05693 short chain dehydrogenase; Provisional
Probab=95.35  E-value=0.27  Score=29.07  Aligned_cols=76  Identities=17%  Similarity=0.275  Sum_probs=57.0

Q ss_pred             EEEEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             56981-57111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +=+-| -+-+|..+|+.|+++|++|.+..|+.+..+++.+++      +.                .+-+-|.+.+.+++
T Consensus         4 vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~------~~----------------~~~~Dvtd~~~i~~   61 (274)
T PRK05693          4 VLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAAAG------FT----------------AVQLDVNDGAALAR   61 (274)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC------CC----------------EEEEECCCHHHHHH
T ss_conf             999488858999999999987999999979999999998489------91----------------89984699899999


Q ss_pred             HHHHHHHCCCCCCEEEECC
Q ss_conf             9999972078998999679
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.+......=|++|...
T Consensus        62 ~~~~~~~~~g~iDiLVNNA   80 (274)
T PRK05693         62 LAEELEAEHQGLDVLINNA   80 (274)
T ss_pred             HHHHHHHHCCCCCEEEECC
T ss_conf             9999999729976899888


No 322
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.33  E-value=0.28  Score=29.02  Aligned_cols=87  Identities=21%  Similarity=0.313  Sum_probs=57.3

Q ss_pred             CC-CCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             99-8805698--15711168899999789859997399-89999999712211278403289899986057788999976
Q gi|254780716|r    1 MK-QADIGII--GLGSMGSNLSLNILDKGFRLAVYNKD-FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~-k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~-~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |. +.+|.+|  |-+-+|..+|+.|++.|++|.+.+++ .+..+++.++.......+.                .+-.-|
T Consensus         1 M~~~~KValVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv   64 (259)
T PRK12745          1 MKSTRPVALVTGGRRGIGLGIALALAAGGFDLAINDRPDAEKLAATQQELRALGVEVI----------------FFPADV   64 (259)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEE----------------EEECCC
T ss_conf             9999999999686789999999999987998999979866789999999984499489----------------998468


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             990699999999972078998999679
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.+.++..++.+.....+=|++|...
T Consensus        65 ~~~~~~~~~~~~~~~~fg~iDiLVNNA   91 (259)
T PRK12745         65 ADLSAHEATLDAAQDAWGRIDCLVNNA   91 (259)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999999999829988999847


No 323
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=95.33  E-value=0.16  Score=30.80  Aligned_cols=86  Identities=21%  Similarity=0.356  Sum_probs=58.2

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--1571116889999978985999-7399899999997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |++ ++.+|  |-+-+|..+|++|++.|++|.+ |.++.++.+++.++......++.                .+-.-|.
T Consensus         1 L~~-KvalVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~   63 (246)
T PRK12938          1 MSQ-RIAYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFI----------------ASEGNVG   63 (246)
T ss_pred             CCC-CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEE----------------EEECCCC
T ss_conf             950-98999185869999999999987998999479981789999999984599789----------------9967879


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.+++.++.+...+.+=|++|..-
T Consensus        64 ~~~~~~~~~~~i~~~~g~idiLVNNA   89 (246)
T PRK12938         64 DWDSTKAAFDKVKAEVGEIDVLVNNA   89 (246)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999759998999898


No 324
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=95.32  E-value=0.28  Score=29.02  Aligned_cols=95  Identities=15%  Similarity=0.096  Sum_probs=60.5

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCE-ECCCHHHHHHHC-CCCCEEEEE--CCCHH
Q ss_conf             05698157111688999997898599973998999999971221127840-328989998605-778899997--69906
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVI-VTKNLEQMVEAV-CKPRKILMM--VTDGD   80 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~-~~~s~~e~v~~l-~~pr~Iil~--vp~g~   80 (475)
                      +|==||.|  |.-++..|++.|.+|.+-|.+++.++...+.......++. -+.+++++...- ++-++|+.+  +-+=+
T Consensus        51 ~ILDVGCG--gG~lse~LAr~Ga~VtGID~S~~~I~~Ar~ha~~~~l~i~y~~~~~e~l~~~~~~~FDvV~~~EVlEHV~  128 (233)
T PRK05134         51 RVLDVGCG--GGILSESMARLGATVTGIDASEENIEVARLHALESGLKIDYRQITAEELAAEHPGQFDVVTCMEMLEHVP  128 (233)
T ss_pred             EEEEECCC--CCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHCCCCEEEEEEEHHHHHCC
T ss_conf             89997558--9711289996799799987998999999998564434511675147665430578634774421477538


Q ss_pred             HHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999720789989996
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLD  101 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID  101 (475)
                      ..+.++..+...|+||-.++-
T Consensus       129 d~~~~l~~~~rlLKPGG~l~l  149 (233)
T PRK05134        129 DPASFIRACAKLVKPGGLVFF  149 (233)
T ss_pred             CHHHHHHHHHHHHCCCCEEEE
T ss_conf             999999999997389914999


No 325
>PRK08267 short chain dehydrogenase; Provisional
Probab=95.32  E-value=0.2  Score=30.11  Aligned_cols=79  Identities=16%  Similarity=0.255  Sum_probs=51.4

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHH
Q ss_conf             569815-7111688999997898599973998999999971221127840328989998605778899997699069999
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +=+-|- +=+|.++|+.|+++|++|.+.||++++.+++.++...  ..+.                ..-+-|.+.+.+++
T Consensus         4 vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~--~~~~----------------~~~~Dvtd~~~v~~   65 (258)
T PRK08267          4 IFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGA--ERAW----------------TGALDVTDRAAWDA   65 (258)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCEE----------------EEEECCCCHHHHHH
T ss_conf             99907226899999999998799999998889999999998369--9679----------------99911799999999


Q ss_pred             HHHHHHHCC-CCCCEEEEC
Q ss_conf             999997207-899899967
Q gi|254780716|r   85 LIDKLKPLL-SPEDILLDG  102 (475)
Q Consensus        85 vi~~l~~~l-~~g~iiID~  102 (475)
                      .+.++.... ..=|++|..
T Consensus        66 ~~~~~~~~~~G~iDiLVNN   84 (258)
T PRK08267         66 ALADFCAATGGRLDVLFNN   84 (258)
T ss_pred             HHHHHHHHHCCCCCEEEEC
T ss_conf             9999999958998689988


No 326
>PRK07063 short chain dehydrogenase; Provisional
Probab=95.27  E-value=0.27  Score=29.13  Aligned_cols=83  Identities=16%  Similarity=0.301  Sum_probs=58.7

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999739989999999712211-27840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.||+.++.++..++.... +..+                ..+-.-|.+.+.
T Consensus         8 KvalVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~----------------~~~~~Dvt~~~~   71 (259)
T PRK07063          8 KVALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARV----------------LALPADVTRAAS   71 (259)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEE----------------EEEECCCCCHHH
T ss_conf             8899958787899999999998799899997987899999999988509918----------------999836899999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++++.+.....+=|++|...
T Consensus        72 v~~~v~~~~~~~G~iDiLVNNA   93 (259)
T PRK07063         72 VRAAVARAEAAFGPLDVLVNNA   93 (259)
T ss_pred             HHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999819988999899


No 327
>PRK05875 short chain dehydrogenase; Provisional
Probab=95.21  E-value=0.21  Score=29.88  Aligned_cols=81  Identities=14%  Similarity=0.151  Sum_probs=54.3

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      |-+-+|.++|+.|++.|.+|.+.+|+.++.++..++........             .....+-.-|.+.+.+++.++.+
T Consensus        15 as~GIG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~~~-------------~~v~~~~~Dvs~~~~v~~~v~~~   81 (277)
T PRK05875         15 GGSGIGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAGGA-------------GAVRYEPADVTNEDEVARAVDAA   81 (277)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCC-------------CEEEEEECCCCCHHHHHHHHHHH
T ss_conf             87499999999999879989999798899999999999612788-------------62899957899999999999999


Q ss_pred             HHCCCCCCEEEECC
Q ss_conf             72078998999679
Q gi|254780716|r   90 KPLLSPEDILLDGG  103 (475)
Q Consensus        90 ~~~l~~g~iiID~s  103 (475)
                      ......=|++|.+.
T Consensus        82 ~~~~g~iD~LVnnA   95 (277)
T PRK05875         82 TAWHGRLHGVVHCA   95 (277)
T ss_pred             HHHHCCCEEEEECC
T ss_conf             99849953999878


No 328
>PRK07806 short chain dehydrogenase; Provisional
Probab=95.20  E-value=0.2  Score=30.06  Aligned_cols=81  Identities=15%  Similarity=0.251  Sum_probs=56.9

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--15711168899999789859997399-89999999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKD-FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~-~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+|  |-.-+|..+|+.|++.|++|.+.+|+ .++.+++.++-...+....                .+-.-|.+.+.+
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~----------------~~~~Dvtd~~~v   71 (248)
T PRK07806          8 IALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRAS----------------AVGADLTDEASV   71 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEE----------------EEECCCCCHHHH
T ss_conf             8999378859999999999987998999838956899999999996198399----------------997899999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +++++.+......=||+|.-
T Consensus        72 ~~l~~~~~~~~G~iDiLVnN   91 (248)
T PRK07806         72 AALMDAIRAEFGGLDALVLN   91 (248)
T ss_pred             HHHHHHHHHHCCCCCEEEEC
T ss_conf             99999999984999899989


No 329
>PRK05872 short chain dehydrogenase; Provisional
Probab=95.19  E-value=0.3  Score=28.71  Aligned_cols=79  Identities=11%  Similarity=0.242  Sum_probs=58.0

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||+.++.+++.++..   ....                .+-.-|.+.+.++
T Consensus        11 valITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~lg---~~~~----------------~~~~DVtd~~~v~   71 (296)
T PRK05872         11 VVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAAELG---DRVL----------------TVVADVTDLAAMQ   71 (296)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC---CCEE----------------EEEEECCCHHHHH
T ss_conf             79992710589999999999879989999899999999999838---8738----------------9998279999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        72 ~~v~~i~~~~G~iDiLVnNA   91 (296)
T PRK05872         72 AAAEEAVERFGGIDVVVANA   91 (296)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999719987876556


No 330
>pfam00107 ADH_zinc_N Zinc-binding dehydrogenase.
Probab=95.18  E-value=0.3  Score=28.71  Aligned_cols=36  Identities=17%  Similarity=0.229  Sum_probs=27.7

Q ss_pred             ECCHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCC
Q ss_conf             15711168899999789-8599973998999999971221
Q gi|254780716|r   10 GLGSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISG   48 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~   48 (475)
                      |+|.|.-.+|+.+   | .+|.+.|+++++.+...+.|+.
T Consensus         1 giG~~~iq~ak~~---Ga~~Vi~~~~~~~r~~~a~~lGa~   37 (131)
T pfam00107         1 GVGLAAVQLAKAL---GAARVIAVDRSEEKLELAKELGAD   37 (131)
T ss_pred             CHHHHHHHHHHHC---CCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             9589999999984---998799996988999999975997


No 331
>PRK05876 short chain dehydrogenase; Provisional
Probab=95.18  E-value=0.2  Score=29.99  Aligned_cols=82  Identities=17%  Similarity=0.218  Sum_probs=55.7

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.|++.++.++..++.......+.                .+.+-|.+.+.+
T Consensus         7 KvavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~----------------~~~~Dvt~~~~v   70 (275)
T PRK05876          7 RGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVH----------------GVMCDVRHREEV   70 (275)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8799928266999999999998799899997988999999999982698479----------------997888999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +..++.....+.+=|++|.-
T Consensus        71 ~~l~~~~~~~~G~iDilvnN   90 (275)
T PRK05876         71 THLADEAFRLLGHVDVVFSN   90 (275)
T ss_pred             HHHHHHHHHHHCCCCEEECC
T ss_conf             99999999984898851215


No 332
>PRK06179 short chain dehydrogenase; Provisional
Probab=95.16  E-value=0.31  Score=28.67  Aligned_cols=79  Identities=13%  Similarity=0.231  Sum_probs=57.6

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698--157111688999997898599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |++.++.+|  |-+=+|..+|+.|+++|++|.+.+|+.++.++.        .+                ...+-+-|.+
T Consensus         1 M~~~KvalITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~~--------~~----------------~~~~~~Dvtd   56 (270)
T PRK06179          1 MSNKKVALVTGASSGIGRATAEALARAGYRVFGTSRNPARATPI--------PG----------------VELLELDVTD   56 (270)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCC--------CC----------------CEEEEEECCC
T ss_conf             98995899907246999999999998799999996897773054--------89----------------7899910799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++.+......=|++|...
T Consensus        57 ~~~v~~~~~~~~~~~g~iDiLVNNA   81 (270)
T PRK06179         57 DASVQAAVQEVIARAGRIDVLVNNA   81 (270)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999839988899898


No 333
>PRK08226 short chain dehydrogenase; Provisional
Probab=95.16  E-value=0.31  Score=28.68  Aligned_cols=81  Identities=19%  Similarity=0.297  Sum_probs=55.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.|++++ .+++.++.......+                ..+-.-|.+.+.++
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~-~~~~~~~~~~~g~~~----------------~~~~~Dvsd~~~v~   70 (263)
T PRK08226          8 TALITGALQGIGEGIARVFARHGANLILLDISPE-IEKLADELCGRGHRC----------------TAVVADVRDPASVA   70 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHHHCCCCE----------------EEEEEECCCHHHHH
T ss_conf             8999473779999999999987998999969879-999999998369917----------------99994179999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+.....+=|++|...
T Consensus        71 ~~v~~~~~~~G~iDiLVNNA   90 (263)
T PRK08226         71 AAIKRAKEKEGRIDILVNNA   90 (263)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999839986999899


No 334
>PRK06227 consensus
Probab=95.15  E-value=0.29  Score=28.92  Aligned_cols=82  Identities=16%  Similarity=0.216  Sum_probs=56.1

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.|++.+..++..++......++                ..+-.-|.+.+.++
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~Dvs~~~~v~   70 (256)
T PRK06227          7 VAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDA----------------LFVKTDVSDEEDVK   70 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHHHH
T ss_conf             89995866889999999999879999999698889999999999559918----------------99981689999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ..++++......=|++|...
T Consensus        71 ~~~~~~~~~~G~iDiLVNNA   90 (256)
T PRK06227         71 NMVRKTVERYGGIDILINNA   90 (256)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999829997999899


No 335
>PRK06841 short chain dehydrogenase; Provisional
Probab=95.15  E-value=0.31  Score=28.64  Aligned_cols=79  Identities=16%  Similarity=0.362  Sum_probs=57.0

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||+++..+...+...   ..+                ..+..-|.+.+.++
T Consensus        17 valVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~~~~---~~~----------------~~~~~Dvt~~~~v~   77 (255)
T PRK06841         17 VAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAAQLLG---GNA----------------KGLVCDVSDSQSVE   77 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC---CCE----------------EEEEEECCCHHHHH
T ss_conf             99997967789999999999879999999698789999998459---966----------------99998469999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+.....+=|++|...
T Consensus        78 ~~v~~~~~~~g~iDiLVNNA   97 (255)
T PRK06841         78 AAVAAAISAFGRIDILVNSA   97 (255)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999819987999899


No 336
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=95.14  E-value=0.31  Score=28.61  Aligned_cols=85  Identities=19%  Similarity=0.298  Sum_probs=55.2

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHH-HHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             998805698--1571116889999978985999739989999-9997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTD-VFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~-~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+|  +.+|  |-+-+|..+|+.|+++|++|.+.+|+.++.. ++.+.......                ....+-.-+.
T Consensus         1 M~K--valITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~~~D~~   62 (245)
T PRK12824          1 MKK--IALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTED----------------QVRLKSLDVT   62 (245)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCC----------------CEEEEECCCC
T ss_conf             985--9999478888999999999987998999958807789999998740499----------------3899991389


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.++..++.+......=|++|...
T Consensus        63 d~~~~~~~v~~~~~~~g~iDiLVnnA   88 (245)
T PRK12824         63 DTEECQEALARIEEEEGPVDILVNNA   88 (245)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999749998999898


No 337
>PRK09730 hypothetical protein; Provisional
Probab=95.14  E-value=0.21  Score=29.87  Aligned_cols=82  Identities=17%  Similarity=0.361  Sum_probs=56.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--1571116889999978985999-739989999999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      |.+|  |-+-+|..+|+.|++.|++|.+ |+++.+..+++.++.......+.                .+-.-|.+.+.+
T Consensus         3 ValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~~~~~v   66 (247)
T PRK09730          3 IALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAF----------------VLQADISDENQV   66 (247)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             9999062269999999999987999999669987899999999997499289----------------998258999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++++.+.....+=|++|...
T Consensus        67 ~~~~~~i~~~~g~id~LVNNA   87 (247)
T PRK09730         67 VAMFTAIDQHDEPLAALVNNA   87 (247)
T ss_pred             HHHHHHHHHHCCCCEEEEECC
T ss_conf             999999999759955999898


No 338
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=95.11  E-value=0.27  Score=29.15  Aligned_cols=84  Identities=13%  Similarity=0.374  Sum_probs=58.8

Q ss_pred             CEEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698--1571116889999978985999-7399899999997122112784032898999860577889999769906
Q gi|254780716|r    4 ADIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      -++.+|  |-+-+|..+|+.|++.|++|.+ |.++.++.+++.++......++                ..+-.-|.+.+
T Consensus         4 gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~----------------~~~~~Dv~d~~   67 (250)
T PRK08063          4 GKVALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKA----------------LVVKANVGDVE   67 (250)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHH
T ss_conf             49899958766999999999998899899975999899999999999549958----------------99984799999


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99999999972078998999679
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+++.++.+.....+=|++|...
T Consensus        68 ~v~~~~~~~~~~~G~iDiLVnnA   90 (250)
T PRK08063         68 KIKEMFSQIDEHFGRLDVFVNNA   90 (250)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999809988999878


No 339
>PRK07411 hypothetical protein; Validated
Probab=95.10  E-value=0.13  Score=31.45  Aligned_cols=125  Identities=14%  Similarity=0.135  Sum_probs=73.9

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCC-C-CCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             88056981571116889999978985-9997399899999997122-1-1278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKIS-G-LSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~-~-~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      ++.|-+||+|-.|.+.|..|+..|.- +.+.|-+.=....+..+-- . ..-+..-+.+.++.+..+. |.+-+...+..
T Consensus        38 ~a~VlvvG~GGLG~p~~~yLaaaGvG~i~ivD~D~ve~sNL~RQ~l~~~~~vG~~K~~~a~~~l~~ln-p~~~i~~~~~~  116 (390)
T PRK07411         38 AASVLCIGTGGLGSPLLLYLAAAGIGRIGIVDFDIVDSSNLQRQVIHGTSWVGKPKIESAKNRILEIN-PYCQVDLYETR  116 (390)
T ss_pred             HCCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHC-CCCCCEEHHHH
T ss_conf             49789988872379999999983897599974899462347854366620079718999999999868-98642103432


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                       -..   +.....++.-|+||||+- ++..-.-....|...++-++-+.+.|.+
T Consensus       117 -l~~---~na~~li~~~DvvvD~tD-Nf~tRylindac~~~~~PlV~ga~~~~~  165 (390)
T PRK07411        117 -LSS---ENALDILAPYDVVVDGTD-NFPTRYLVNDACVLLNKPNVYGSIFRFE  165 (390)
T ss_pred             -CCH---HHHHHHHCCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCCCE
T ss_conf             -555---248874228868996788-8899999899999969987997647778


No 340
>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed
Probab=95.09  E-value=0.033  Score=35.81  Aligned_cols=34  Identities=32%  Similarity=0.628  Sum_probs=31.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             8805698157111688999997898599973998
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      ..+|.|||-|..|..+|..|++.|++|.|+|+..
T Consensus       256 ~~~VaVIGAGIAGas~A~~LA~rG~~VtVlDr~~  289 (660)
T PRK01747        256 NRDAAIIGGGIAGAALALALARRGWQVTLYEADE  289 (660)
T ss_pred             CCCEEEECCHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             8718998938999999999997899689994798


No 341
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.05  E-value=0.26  Score=29.17  Aligned_cols=78  Identities=15%  Similarity=0.218  Sum_probs=54.1

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             1571116889999978985999-739989999999712211278403289899986057788999976990699999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDK   88 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~   88 (475)
                      |-.-+|..+|..|++.|++|.+ ++++.+..++..++......+..                .+-.-|.+.+.++++++.
T Consensus        11 gs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dvs~~~~v~~~~~~   74 (249)
T PRK06077         11 SGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEGI----------------GVLADVSTREGCRTLAKA   74 (249)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHHHHHHHH
T ss_conf             3678999999999987998999848876899999999997599589----------------998479999999999999


Q ss_pred             HHHCCCCCCEEEECC
Q ss_conf             972078998999679
Q gi|254780716|r   89 LKPLLSPEDILLDGG  103 (475)
Q Consensus        89 l~~~l~~g~iiID~s  103 (475)
                      ....+..=|++|..-
T Consensus        75 ~~~~~g~iDiLVnNA   89 (249)
T PRK06077         75 ALDNFGVVDILVNNA   89 (249)
T ss_pred             HHHHHCCCCEEEECC
T ss_conf             999819988899857


No 342
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism]
Probab=95.04  E-value=0.2  Score=30.02  Aligned_cols=210  Identities=14%  Similarity=0.094  Sum_probs=115.1

Q ss_pred             CEEEEEEC-CHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCC-EECC--CHHHHHHHCCCCCEEEEECCC
Q ss_conf             80569815-711168899999789-859997399899999997122112784-0328--989998605778899997699
Q gi|254780716|r    4 ADIGIIGL-GSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKV-IVTK--NLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         4 ~~IGiIGL-G~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~-~~~~--s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .+||+||- |--|..+.+-|+.+- .++..+..+..+-+.+.+......... ..+.  ++++.  ..+.++++|+++|+
T Consensus         3 ~kV~IvGasGYtG~EL~rlL~~Hp~ve~~~~ss~~~~g~~~~~~~p~l~g~~~l~~~~~~~~~~--~~~~~DvvFlalPh   80 (349)
T COG0002           3 IKVGIVGASGYTGLELLRLLAGHPDVELILISSRERAGKPVSDVHPNLRGLVDLPFQTIDPEKI--ELDECDVVFLALPH   80 (349)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEEEECHHHCCCCHHHHCCCCCCCCCCCCCCCCHHHH--HCCCCCEEEEECCC
T ss_conf             1599977887748999999865997379996316645870687582423534554335774553--01568889990686


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHC---CCCEECCCCCCCCCCC---CCCC-EE-EEECCHH-
Q ss_conf             069999999997207899899967986578999999999847---9943067546760003---5684-37-8845489-
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK---GIYFIGIGVSGGVKGA---RSGA-SL-MVGGNEK-  149 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~k---gi~fid~pVSGG~~gA---~~G~-sl-MvGG~~~-  149 (475)
                      |...+-| ..   .+++|..|||+|+.+.-.....+++.-+.   +-..++--|-|=++--   .++. .+ -+|+-.. 
T Consensus        81 g~s~~~v-~~---l~~~g~~VIDLSadfR~~d~~~ye~~Yg~~h~~~~~l~~avYGLpEl~~e~i~~A~lIAnPGCypTa  156 (349)
T COG0002          81 GVSAELV-PE---LLEAGCKVIDLSADFRLKDPEVYEKWYGFTHAGPELLEDAVYGLPELHREKIRGAKLIANPGCYPTA  156 (349)
T ss_pred             HHHHHHH-HH---HHHCCCEEEECCCCCCCCCHHHHHHHHCCCCCCCHHHHCCCCCCCCCCHHHHHCCCEEECCCCHHHH
T ss_conf             3688989-99---9747994998873200577777788627777780133154334731298888338773679832889


Q ss_pred             HHHHHHHHHHHHHCCCCCCC--EEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCC
Q ss_conf             99888999998750156786--189856987467898877678788899989999999964289978999999860688
Q gi|254780716|r  150 AYNRVENILLSISAKYQNSP--CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTG  226 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~~--cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~  226 (475)
                      +.-.+.|+++.=--. .+.+  .-...|-+|+|--.++-+..-|-..      .+..-+-..+..-.||......|.+.
T Consensus       157 ~iLal~PL~~~~ll~-~~~~~ivdakSG~SGaGrk~s~~~~~~e~~~------~~~~Y~~~~HrH~pEi~q~l~~l~~~  228 (349)
T COG0002         157 AILALAPLVKAGLLD-PDSPPIVDAKSGVSGAGRKASVKNHFPEVND------SLRPYGLTGHRHTPEIEQHLGRLAGR  228 (349)
T ss_pred             HHHHHHHHHHCCCCC-CCCCEEEEEEEECCCCCCCCCCCCCCHHHCC------CCCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             999888998769978-8886489976746767878530025511036------63335445667659999986010167


No 343
>PRK12746 short chain dehydrogenase; Provisional
Probab=95.04  E-value=0.22  Score=29.77  Aligned_cols=43  Identities=16%  Similarity=0.458  Sum_probs=34.9

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCC
Q ss_conf             05698--1571116889999978985999-7399899999997122
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKIS   47 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~   47 (475)
                      ++.+|  |-+-+|..+|+.|++.|++|.+ |+|+.++.+++.++-.
T Consensus         7 KvalITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~   52 (254)
T PRK12746          7 KVALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIE   52 (254)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             8899948476899999999998799999965999899999999998


No 344
>PRK08339 short chain dehydrogenase; Provisional
Probab=95.02  E-value=0.33  Score=28.43  Aligned_cols=81  Identities=16%  Similarity=0.231  Sum_probs=51.0

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|.++|+.|++.|.+|.+.+|+.++.++..++...... .              +...+..-+.+.+.+
T Consensus         9 K~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~-~--------------~~~~~~~D~~~~~~v   73 (263)
T PRK08339          9 KLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESD-V--------------EVHYIVADLTKREDL   73 (263)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCC-C--------------CEEEEECCCCCHHHH
T ss_conf             9899916260999999999998699999997988999999999985049-8--------------579998489999999


Q ss_pred             HHHHHHHHHCCCCCCEEEE
Q ss_conf             9999999720789989996
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLD  101 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID  101 (475)
                      ++++..+... ..-|++|.
T Consensus        74 ~~~~~~~~~~-g~~dilv~   91 (263)
T PRK08339         74 ERTVKELKNI-GDPDIFFF   91 (263)
T ss_pred             HHHHHHHHHH-CCCCEEEE
T ss_conf             9999999956-99989998


No 345
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism]
Probab=95.00  E-value=0.19  Score=30.21  Aligned_cols=127  Identities=14%  Similarity=0.155  Sum_probs=73.9

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCC-CCCC-CCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             9988056981571116889999978985-9997399899999997122-1127-84032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKIS-GLSQ-KVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~-~~~~-~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+.+++-+||+|-.|.+.+.+|+..|.. +.++|.+.-....+..+.- .... +..-+.+.++....+. |.+.+....
T Consensus        28 l~~s~vlvvG~GglG~~~~~~la~aGvg~l~i~D~d~v~~snL~rq~~~~~~dig~~Ka~~a~~~l~~ln-~~v~v~~~~  106 (254)
T COG0476          28 LKDSRVLVVGAGGLGSPAAKYLALAGVGKLTIVDFDTVELSNLQRQFLFTEADVGKPKAEVAAKALRKLN-PLVEVVAYL  106 (254)
T ss_pred             HHHCEEEEECCCCCCCHHHHHHHHCCCCEEEEEECCEEEECCCCCEEECCHHHCCCCHHHHHHHHHHHHC-CCCEEEEEE
T ss_conf             7648289977763351999999982698599985885770015650303341168888999999999978-994899852


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             90699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      .. ...+.   ........|+++|++-. +..-......+...++-+++.++-|-.
T Consensus       107 ~~-l~~~~---~~~~~~~~d~v~d~~dn-~~~r~~iN~~~~~~~~pli~~~~~~~~  157 (254)
T COG0476         107 ER-LDEEN---AEELIAQFDVVLDCTDN-FETRYLINDACVKLGIPLVHGGAIGFE  157 (254)
T ss_pred             CC-CCHHH---HHHHHHCCCEEEECCCC-HHHHHHHHHHHHHHCCCEEECCCCCCE
T ss_conf             33-66778---99987158899973351-778999999999849988963126626


No 346
>PRK07102 short chain dehydrogenase; Provisional
Probab=94.94  E-value=0.35  Score=28.23  Aligned_cols=44  Identities=25%  Similarity=0.291  Sum_probs=36.1

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             998805698157-1116889999978985999739989999999712
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~   46 (475)
                      |++  |=+.|-+ -+|..+|+.|+++|++|.+.+|+.++.+++.++.
T Consensus         1 MK~--vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l   45 (243)
T PRK07102          1 MKK--ILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADL   45 (243)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH
T ss_conf             997--999157459999999999987998999989889999999999


No 347
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.93  E-value=0.36  Score=28.21  Aligned_cols=82  Identities=16%  Similarity=0.298  Sum_probs=53.7

Q ss_pred             EEEEECC-HHHHHHHHHHHHCCCEEEEEECC-HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698157-11168899999789859997399-899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGIIGLG-SMGSNLSLNILDKGFRLAVYNKD-FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~-~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +=+.|-+ -+|.++|+.|++.|++|.+.+|+ .+..+++.++......+                ...+-+-|.+.+.++
T Consensus        10 ~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~~Dl~~~~~~~   73 (250)
T PRK12825         10 ALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRR----------------AQAVQADVTDAAALE   73 (250)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCC----------------EEEEEEECCCHHHHH
T ss_conf             9993895589999999999879989999798878999999999853994----------------899994189999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+.....+=|++|...
T Consensus        74 ~~~~~~~~~~g~iDilInnA   93 (250)
T PRK12825         74 AAVEELVERFGAIDILVNNA   93 (250)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999769998999899


No 348
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins. Amino acid dehydrogenase(DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and are found in glutamate, leucine, and phenylalanine DHs (DHs), methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel  domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an al
Probab=94.89  E-value=0.14  Score=31.27  Aligned_cols=62  Identities=15%  Similarity=0.349  Sum_probs=50.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             8056981571116889999978-985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~-G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-|+|.|.+|.++|.-|+.. +-+|.++||                                   ++++.+-+.+..+
T Consensus        24 ~~v~v~G~G~vg~~ia~ll~~~~~k~V~~~d~-----------------------------------Di~v~~t~~~~~~   68 (86)
T cd05191          24 KTVVVLGAGEVGKGIAKLLADEGGKKVVLCDR-----------------------------------DILVTATPAGVPV   68 (86)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEECCC-----------------------------------CEEEECCCCCCCC
T ss_conf             58999778604289999999817970787155-----------------------------------5288605778712


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.   ..+...++.+++|+.
T Consensus        69 ~~~---~~~~~~~~~vv~~~a   86 (86)
T cd05191          69 LEE---ATAKINEGAVVIDLA   86 (86)
T ss_pred             HHH---HHHHCCCCCEEEECC
T ss_conf             787---764216871888539


No 349
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional
Probab=94.88  E-value=0.37  Score=28.13  Aligned_cols=18  Identities=22%  Similarity=0.606  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHCCCCH
Q ss_conf             476999999999839984
Q gi|254780716|r  403 IPSLRRIVVTCTENGYPV  420 (475)
Q Consensus       403 ~~~lr~vv~~~i~~gip~  420 (475)
                      .+..|+++.++-+.|.++
T Consensus       677 ~DvarKl~ILAre~G~~~  694 (817)
T PRK09436        677 MDVARKLLILAREAGYEL  694 (817)
T ss_pred             CCHHHHHHHHHHHHCCCC
T ss_conf             438999999999858888


No 350
>KOG0023 consensus
Probab=94.87  E-value=0.27  Score=29.13  Aligned_cols=40  Identities=28%  Similarity=0.543  Sum_probs=29.8

Q ss_pred             EEEEEECCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHH
Q ss_conf             05698157111688999997-898599973998999999971
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILD-KGFRLAVYNKDFELTDVFIKK   45 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~-~G~~V~vydr~~~~~~~l~~~   45 (475)
                      .||++|||-.| .||-.+++ .|++|.+.|++..+-++..+.
T Consensus       184 ~vgI~GlGGLG-h~aVq~AKAMG~rV~vis~~~~kkeea~~~  224 (360)
T KOG0023         184 WVGIVGLGGLG-HMAVQYAKAMGMRVTVISTSSKKKEEAIKS  224 (360)
T ss_pred             EEEEECCCCCC-HHHHHHHHHHCCEEEEEECCCHHHHHHHHH
T ss_conf             89885576401-689999987086799992785348999985


No 351
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. This Pfam entry contains the following members: N-acetyl-glutamine semialdehyde dehydrogenase (AgrC) Aspartate-semialdehyde dehydrogenase
Probab=94.86  E-value=0.083  Score=32.85  Aligned_cols=95  Identities=16%  Similarity=0.248  Sum_probs=55.8

Q ss_pred             EEEEEE-CCHHHHHHHHHHHHCC-CEE-EEEECCHHHHHHHHHHCCCC--CCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             056981-5711168899999789-859-99739989999999712211--278403289899986057788999976990
Q gi|254780716|r    5 DIGIIG-LGSMGSNLSLNILDKG-FRL-AVYNKDFELTDVFIKKISGL--SQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         5 ~IGiIG-LG~MG~~mA~nL~~~G-~~V-~vydr~~~~~~~l~~~~~~~--~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      +||+|| -|.-|.-+.+.|.++- +++ .++.++++.-+.+.......  .... ...++.+  ..++..+++|+++|++
T Consensus         1 kvaIiGatGyvG~eLirlL~~hp~~~i~~l~~s~~saG~~~~~~~~~~~~~~~~-~~~~~~~--~~~~~~Dvvf~alp~~   77 (121)
T pfam01118         1 KVAIVGATGYVGQELLRLLAEHPPLELVALVASSRSAGKKVAFAGPWLTGGVDL-LLEDVDP--EDLKDVDIVFFALPAG   77 (121)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHCCCCCCCCCC-EEEECCH--HHHCCCCEEEECCCHH
T ss_conf             999989361999999999971887551378850565896014416542466664-4775897--7853898999838768


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             699999999972078998999679865
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                       ...++...+   ++.|-.|||.|..+
T Consensus        78 -~s~~~~~~~---~~~g~~VIDlS~df  100 (121)
T pfam01118        78 -VSKELAPKL---LEAGAVVIDLSSAF  100 (121)
T ss_pred             -HHHHHHHHH---HHCCCEEEECCHHH
T ss_conf             -999999998---71598998785675


No 352
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=94.85  E-value=0.26  Score=29.20  Aligned_cols=84  Identities=17%  Similarity=0.315  Sum_probs=64.1

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEE-EEC-CHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHH
Q ss_conf             1571116889999978985999-739-98999999971221127840328989998605778899997699069999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAV-YNK-DFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLID   87 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~v-ydr-~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~   87 (475)
                      |+|=.|.++..+|++.||+|.. |-. +.++.+++.++-...+..+.                ++-.=|.+-++..+.+.
T Consensus         8 g~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~----------------~~~~DV~~~e~c~~~v~   71 (244)
T TIGR01829         8 GTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFA----------------VVEGDVSSFEDCKAAVA   71 (244)
T ss_pred             CCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEE----------------EEECCCCCHHHHHHHHH
T ss_conf             87744689999998759889881789825899999986269851478----------------98727677789999999


Q ss_pred             HHHHCCCCCCEEEECCCCCHHH
Q ss_conf             9972078998999679865789
Q gi|254780716|r   88 KLKPLLSPEDILLDGGNSHFCD  109 (475)
Q Consensus        88 ~l~~~l~~g~iiID~sts~~~~  109 (475)
                      ++..-+-|=||+|..-=...+.
T Consensus        72 ~v~a~lGpvDvLVNNAGITRD~   93 (244)
T TIGR01829        72 KVEAELGPVDVLVNNAGITRDK   93 (244)
T ss_pred             HHHHCCCCEEEEEECCCCCCCH
T ss_conf             9997119536898688644030


No 353
>PRK08945 short chain dehydrogenase; Provisional
Probab=94.84  E-value=0.37  Score=28.05  Aligned_cols=78  Identities=14%  Similarity=0.193  Sum_probs=50.8

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC--CCHHHHHHHHH
Q ss_conf             1571116889999978985999739989999999712211278403289899986057788999976--99069999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV--TDGDPVDQLID   87 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v--p~g~~v~~vi~   87 (475)
                      |-+-+|..+|+.|+++|.+|.+.+|+.++.+++.++-.....               ..+.++-+-+  .+.+.++++++
T Consensus        21 as~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~---------------~~~~~~~~d~~~~~~~~~~~~~~   85 (245)
T PRK08945         21 AGDGIGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGG---------------PQPAIIPLDLLGATEQNYQDLAD   85 (245)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCC---------------CCEEEEEEECCCCCHHHHHHHHH
T ss_conf             861899999999998799899996988999999999997479---------------84489994467599999999999


Q ss_pred             HHHHCCCCCCEEEEC
Q ss_conf             997207899899967
Q gi|254780716|r   88 KLKPLLSPEDILLDG  102 (475)
Q Consensus        88 ~l~~~l~~g~iiID~  102 (475)
                      .+.....+=|++|..
T Consensus        86 ~i~~~~g~iD~lVnN  100 (245)
T PRK08945         86 TIEEQFGRLDGVLHN  100 (245)
T ss_pred             HHHHHHCCCCEEEEC
T ss_conf             999980998799988


No 354
>PRK07707 consensus
Probab=94.77  E-value=0.39  Score=27.92  Aligned_cols=44  Identities=20%  Similarity=0.504  Sum_probs=36.2

Q ss_pred             CCCCEEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHC
Q ss_conf             998805698--1571116889999978985999-739989999999712
Q gi|254780716|r    1 MKQADIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKI   46 (475)
Q Consensus         1 M~k~~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~   46 (475)
                      |+|  +.+|  |-+-+|..+|+.|++.|++|.+ |++++++.+++.++.
T Consensus         1 M~K--valVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~   47 (239)
T PRK07707          1 MKK--YALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQEEL   47 (239)
T ss_pred             CCC--EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             998--99996688789999999999879989998399989999999984


No 355
>PRK00676 hemA glutamyl-tRNA reductase; Validated
Probab=94.74  E-value=0.11  Score=31.89  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=14.7

Q ss_pred             CCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             84378845489998889999987
Q gi|254780716|r  139 GASLMVGGNEKAYNRVENILLSI  161 (475)
Q Consensus       139 G~slMvGG~~~~~~~~~piL~~i  161 (475)
                      |+==||=|+.+..-+++.-++.-
T Consensus        99 GLDSmVlGE~QIlGQVK~Ay~~A  121 (338)
T PRK00676         99 GMDSLILGETEIQGQVKRAYLKA  121 (338)
T ss_pred             CCHHHHCCCHHHHHHHHHHHHHH
T ss_conf             34035328689999999999999


No 356
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional
Probab=94.68  E-value=0.22  Score=29.75  Aligned_cols=152  Identities=16%  Similarity=0.170  Sum_probs=81.8

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC-CCEEEEEECCHHHHHH--HHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECC
Q ss_conf             9988056981571116889999978-9859997399899999--997122112784032898999860577889999769
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDV--FIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVT   77 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~-G~~V~vydr~~~~~~~--l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp   77 (475)
                      |+. +||+-|.|..|+..|.-+... ..+|.+.+.+....+.  ..+.|-    .+  +....+.++.++...       
T Consensus         1 m~i-kV~INGyGtIGkRVAdav~~q~DmelVGV~k~~pd~~a~~a~~kG~----~v--y~~~~~~~~~F~~aG-------   66 (338)
T PRK04207          1 MMI-KVAVNGYGTIGKRVADAVAAQDDMEVVGVSKTKPDYEARVAVERGY----PL--YVADPERLDAFEKAG-------   66 (338)
T ss_pred             CCE-EEEEECCCCHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHCCC----CE--EECCHHHHHHHHHCC-------
T ss_conf             948-9998248605589988873599818997867999778999998699----67--853776665687569-------


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             90699999999972078998999679865789999999998479943067546760003568437884548999888999
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENI  157 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~pi  157 (475)
                        -.+.-.++   ..++.-|+||||+-......-+  +.-.+.|+..|   ..||+.....+.+|-.+.+.+.       
T Consensus        67 --i~v~Gtie---dll~~aDvVvDcTP~g~G~~Nk--~~Y~~~g~kaI---fQGGEk~~va~~sFna~~Ny~~-------  129 (338)
T PRK04207         67 --IEVAGTIE---DLLEKADIVVDATPGGVGAKNK--PLYEKAGVKAI---FQGGEKAEVAEVSFNALANYEE-------  129 (338)
T ss_pred             --CCCCCCHH---HHHHCCCEEEECCCCCCCCCCH--HHHHHCCCCEE---EECCCCCCCCCCEEEEECCHHH-------
T ss_conf             --86667688---9752189999899976440022--76887598379---9658876767750673014577-------


Q ss_pred             HHHHHCCCCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             9987501567861898569874678988776
Q gi|254780716|r  158 LLSISAKYQNSPCCALLGPDGSGHFVKMIHN  188 (475)
Q Consensus       158 L~~iaak~~~~~cv~y~G~~GsGh~vKMVhN  188 (475)
                        ++....-   -+.=|--.|-+-.++-+++
T Consensus       130 --a~Gk~~v---rvvSCNTTgL~R~l~~L~~  155 (338)
T PRK04207        130 --AIGKDYV---RVVSCNTTGLCRTLYPLRE  155 (338)
T ss_pred             --HCCCCCE---EEEEECCCCHHHHHHHHHH
T ss_conf             --6387637---9965320345788999987


No 357
>PRK07074 short chain dehydrogenase; Provisional
Probab=94.68  E-value=0.41  Score=27.77  Aligned_cols=78  Identities=22%  Similarity=0.391  Sum_probs=51.3

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|..|.++||+.++.+++.++...  .++.                .+..-+.+.+.++
T Consensus         4 valITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~~--~~~~----------------~~~~Dv~~~~~~~   65 (256)
T PRK07074          4 TALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVDALGD--AAVA----------------PVICDLTDAASVE   65 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCEE----------------EEEEECCCHHHHH
T ss_conf             899988468999999999998699999997988999999998269--9779----------------9997279999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      .+.+.+..+ .+=|++|.-
T Consensus        66 ~~~~~i~~~-g~iDiLVNN   83 (256)
T PRK07074         66 RLAAALANE-GPVDVLVAN   83 (256)
T ss_pred             HHHHHHHHH-CCCCEEEEC
T ss_conf             999999985-998799988


No 358
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated
Probab=94.67  E-value=0.13  Score=31.55  Aligned_cols=125  Identities=15%  Similarity=0.159  Sum_probs=72.6

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCC-CC-CCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             88056981571116889999978985-9997399899999997122-11-278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKIS-GL-SQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~-~~-~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      ++.|-+||+|-.|.+.|..|+..|.- +.+.|.+.=....+..+-- .. .-+..-+.+.++.+..+. |.+-+..++..
T Consensus        42 ~a~VlvvG~GGLG~~~~~yLaaaGvG~i~ivD~D~v~~sNL~RQil~~~~dvG~~K~~~a~~~l~~~N-p~v~v~~~~~~  120 (392)
T PRK07878         42 NARVLVIGAGGLGSPTLLYLAAAGVGTIGIVEFDVVDESNLQRQIIHGQSDVGRSKAQSARDSIVEIN-PLVNVRLHEFR  120 (392)
T ss_pred             HCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHC-CCCCCEEHHHC
T ss_conf             19789987875789999999982897599987899674557720056843358707999999999878-98531211313


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             699999999972078998999679865789999999998479943067546760
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                       ...   +.....++.-|+||||+- ++..-.-....|...++-++-+.+.|-+
T Consensus       121 -l~~---~n~~~li~~~DvViD~tD-N~~tR~lindac~~~~~PlV~ga~~~~~  169 (392)
T PRK07878        121 -LEP---SNAVDLFAQYDLILDGTD-NFATRYLVNDAAVLAGKPYVWGSIYRFE  169 (392)
T ss_pred             -CCH---HHHHHHHCCCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEEEECCCE
T ss_conf             -788---898764317768986689-9899999999999969987997605758


No 359
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase, an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase.
Probab=94.66  E-value=0.15  Score=30.95  Aligned_cols=99  Identities=12%  Similarity=0.170  Sum_probs=53.7

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHC-CCEEE-EEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             0569815-71116889999978-98599-973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDK-GFRLA-VYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~-G~~V~-vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +||+||- |--|.-|.+-|.++ .+++. +|-...+.-+.+...+..........-+..++.  ....+++|+++|++..
T Consensus         1 kVaIvGatGyvG~eli~lL~~hp~~~~~~l~as~~~~G~~i~~~~~~l~~~~~~~~~~~~~~--~~~~Dvvf~a~p~~~s   78 (122)
T smart00859        1 KVAIVGATGYVGQELLRLLAEHPDFEVVALAASARSAGKRVSEAGPHLKGEVVLELEPEDFE--ELAVDIVFLALPHGVS   78 (122)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHCCCCCCCCCCEECCCCCC--CCCCCEEEECCCCHHH
T ss_conf             98998945199999999998589974577774046589757885966457735056533110--0179999993882788


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             9999999972078998999679865
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                       .++...+....+.|..|||.|..+
T Consensus        79 -~~~~~~~~~~~~~g~~VIDlSadf  102 (122)
T smart00859       79 -KEIAPLLPKAAEAGVKVIDLSSAF  102 (122)
T ss_pred             -HHHHHHHHHHHHCCCEEEECCHHH
T ss_conf             -999998898875698798684775


No 360
>PRK06484 short chain dehydrogenase; Validated
Probab=94.66  E-value=0.41  Score=27.74  Aligned_cols=78  Identities=15%  Similarity=0.304  Sum_probs=54.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.||+.+..++..++...   ..                ..+-.-|.+.+.++
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~~g~---~~----------------~~~~~Dvsd~~~v~   67 (530)
T PRK06484          7 VVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAERLGS---RH----------------VALQLDVSDEAQVE   67 (530)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC---CC----------------EEEEEECCCHHHHH
T ss_conf             999978366899999999998799999996888999999997099---71----------------79998489999999


Q ss_pred             HHHHHHHHCCCCCCEEEEC
Q ss_conf             9999997207899899967
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~  102 (475)
                      ++++.+.....+=|++|..
T Consensus        68 ~~v~~~~~~~G~iDiLVNN   86 (530)
T PRK06484         68 HAMDGLLQQFGRIDVLVNN   86 (530)
T ss_pred             HHHHHHHHHCCCCCEEEEC
T ss_conf             9999999972999899989


No 361
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=94.66  E-value=0.41  Score=27.74  Aligned_cols=81  Identities=7%  Similarity=0.195  Sum_probs=53.3

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.||+.. .++..++.......+.                .+-.-|.+.+.+
T Consensus         9 KvalITGas~GIG~aiA~~la~~Ga~V~~~~r~~~-~~~~~~~~~~~~~~~~----------------~~~~Dv~~~~~~   71 (260)
T PRK12823          9 KVAVVTGAAQGIGRGVALRAAAEGARVVLVDRSEL-VHEVAAELVAAGGEAL----------------ALTADLETYAGA   71 (260)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             98999488678999999999987999999969468-9999999985499489----------------998126885899


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      ++.++.+...+.+=|++|..
T Consensus        72 ~~~~~~~~~~~G~iDiLVnn   91 (260)
T PRK12823         72 QAVMAAAVEAFGRIDVLINN   91 (260)
T ss_pred             HHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999983998799977


No 362
>PRK06484 short chain dehydrogenase; Validated
Probab=94.66  E-value=0.41  Score=27.73  Aligned_cols=13  Identities=31%  Similarity=0.396  Sum_probs=5.7

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             9999999847994
Q gi|254780716|r  111 QIRSLQLSEKGIY  123 (475)
Q Consensus       111 ~~~~~~l~~kgi~  123 (475)
                      +.++.++.++||+
T Consensus       163 kslA~Ela~~gIR  175 (530)
T PRK06484        163 RSLACELAPKGIR  175 (530)
T ss_pred             HHHHHHHHHCCEE
T ss_conf             9999986340949


No 363
>PRK06114 short chain dehydrogenase; Provisional
Probab=94.65  E-value=0.41  Score=27.72  Aligned_cols=82  Identities=11%  Similarity=0.242  Sum_probs=54.5

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--1571116889999978985999739989-999999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFE-LTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~-~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.|++.+ ..++..++....+..+.                .+-.-|.+.+.+
T Consensus        18 valVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dvt~~~~v   81 (262)
T PRK06114         18 VAFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAI----------------QIAADVTSKSDL   81 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8999684789999999999987998999958974699999999996599589----------------998168999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.......+=|++|...
T Consensus        82 ~~~v~~~~~~~G~iDiLVNnA  102 (262)
T PRK06114         82 AAAVARTEAELGALTLAVNAA  102 (262)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999819998999899


No 364
>PRK12827 short chain dehydrogenase; Provisional
Probab=94.63  E-value=0.33  Score=28.50  Aligned_cols=86  Identities=16%  Similarity=0.162  Sum_probs=54.5

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.|++.++.++..++...            ++-..-.+...+-.-|.+.+.++
T Consensus         8 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~------------~~~~~g~~~~~~~~Dv~~~~~v~   75 (251)
T PRK12827          8 RVLITGGSGGLGRAIAVRLAADGADVIVLDIHPMRGRAEAEAVAA------------LIEAAGGKALGLAFDVRDFAATR   75 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHH------------HHHHCCCEEEEEEECCCCHHHHH
T ss_conf             899968255899999999998799899984888532899999999------------99964984999990389999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        76 ~~v~~~~~~~G~iDiLVNnA   95 (251)
T PRK12827         76 AALDAGVEEFGRLDILVNNA   95 (251)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999839997999899


No 365
>PRK07236 hypothetical protein; Provisional
Probab=94.59  E-value=0.05  Score=34.49  Aligned_cols=37  Identities=14%  Similarity=0.185  Sum_probs=34.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |++.+|-|||-|.=|..+|.-|.++|++|.+|+|+++
T Consensus         4 ~~~~kV~IVGaGiaGL~~A~~L~~~G~~v~v~Er~~~   40 (386)
T PRK07236          4 MSKPRAVVVGGSLGGLFAANLLRRAGWDVDVFERSPT   40 (386)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9999689999368999999999858999899868998


No 366
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=94.59  E-value=0.43  Score=27.62  Aligned_cols=37  Identities=16%  Similarity=0.219  Sum_probs=14.8

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHH
Q ss_conf             5698157111688999997898-599973998999999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVF   42 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l   42 (475)
                      |.++|.|-+|...+.-+...|- .|.+-|++++|.+..
T Consensus       180 VlV~GaG~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A  217 (358)
T TIGR03451       180 VAVIGCGGVGDAAIAGAALAGASKIIAVDIDDRKLEWA  217 (358)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             99967376999999999983991899991988999999


No 367
>PRK12550 shikimate 5-dehydrogenase; Reviewed
Probab=94.53  E-value=0.18  Score=30.32  Aligned_cols=11  Identities=36%  Similarity=0.534  Sum_probs=4.1

Q ss_pred             EEEECCCCHHH
Q ss_conf             89856987467
Q gi|254780716|r  171 CALLGPDGSGH  181 (475)
Q Consensus       171 v~y~G~~GsGh  181 (475)
                      +.-+|.+|++.
T Consensus       125 ~lilGaGGaar  135 (272)
T PRK12550        125 VALRGSGGMAK  135 (272)
T ss_pred             EEEECCCHHHH
T ss_conf             89973623389


No 368
>PRK05993 short chain dehydrogenase; Provisional
Probab=94.52  E-value=0.44  Score=27.51  Aligned_cols=80  Identities=18%  Similarity=0.285  Sum_probs=56.1

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             998805698157-1116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |+| .|=+-|-+ -+|..+|+.|+++|++|....|+.+..+.+.+++      +                ..+.+-|.+.
T Consensus         3 m~K-~vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~------~----------------~~~~~Dv~d~   59 (277)
T PRK05993          3 MKR-SILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAEG------L----------------EAFYLDYAEP   59 (277)
T ss_pred             CCC-EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC------C----------------EEEEEECCCH
T ss_conf             986-8999256869999999999987999999979999999998489------8----------------1999726677


Q ss_pred             HHHHHHHHHHHHCC-CCCCEEEECC
Q ss_conf             69999999997207-8998999679
Q gi|254780716|r   80 DPVDQLIDKLKPLL-SPEDILLDGG  103 (475)
Q Consensus        80 ~~v~~vi~~l~~~l-~~g~iiID~s  103 (475)
                      +.+++.++.++... .+-|++|..+
T Consensus        60 ~~v~~~v~~~~~~~~g~id~lvNnA   84 (277)
T PRK05993         60 ESIAALVAQVLELSGGKLDALFNNG   84 (277)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9999999999998089706999666


No 369
>PRK06057 short chain dehydrogenase; Provisional
Probab=94.48  E-value=0.45  Score=27.45  Aligned_cols=78  Identities=22%  Similarity=0.330  Sum_probs=56.8

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.|+++++.+++.++...     .                .+-.-|.+.+.+
T Consensus         8 KvalVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~-----~----------------~~~~Dv~~~~~v   66 (255)
T PRK06057          8 RVAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAADELGG-----L----------------FVQVDVTDEDAV   66 (255)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC-----E----------------EEEEECCCHHHH
T ss_conf             9899968488899999999998699899996988999999986499-----7----------------999816999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++........=|++|...
T Consensus        67 ~~~v~~~~~~~G~iDiLVNnA   87 (255)
T PRK06057         67 NALFDTAAETYGSVDIAFNNA   87 (255)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999819987899888


No 370
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme.   Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=94.41  E-value=0.13  Score=31.38  Aligned_cols=77  Identities=17%  Similarity=0.335  Sum_probs=55.1

Q ss_pred             CEEEEEECCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             8056981571-116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGS-MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~-MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-+||-++ .|.|+|.-|..+|..|.+++....                    ++.+.+   ...++|+..+....-+
T Consensus        45 k~vvViGrS~iVG~Pla~lL~~~~atVt~chs~T~--------------------~l~~~~---~~ADIvIsA~G~~~li  101 (168)
T cd01080          45 KKVVVVGRSNIVGKPLAALLLNRNATVTVCHSKTK--------------------NLKEHT---KQADIVIVAVGKPGLV  101 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCC--------------------CHHHHH---HHCCEEEEECCCCCCC
T ss_conf             56999878730089999999848997999768988--------------------979974---1045355415876637


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHH
Q ss_conf             999999972078998999679865789
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCD  109 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~  109 (475)
                      .      ...+++|.++||.|.+..++
T Consensus       102 ~------~~~vk~gavvIDvGin~~~~  122 (168)
T cd01080         102 K------GDMVKPGAVVIDVGINRVPD  122 (168)
T ss_pred             C------HHHCCCCCEEEECCCCCCCC
T ss_conf             8------99958998899666542334


No 371
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed
Probab=94.38  E-value=0.092  Score=32.55  Aligned_cols=68  Identities=22%  Similarity=0.294  Sum_probs=42.8

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEE
Q ss_conf             880569815711168899999789859997399899999997122112784032898999860577889999
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILM   74 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil   74 (475)
                      .+.||+||=|..|+-||.--.+-|++|.++|.+++.-..-+... .......-.+.+.+|++.++   +|-.
T Consensus         7 ~~tIGIlGgGQLgrMla~aA~~lG~~v~vldp~~~~PA~~va~~-~~~~~~~D~~al~~fa~~~D---viT~   74 (377)
T PRK06019          7 GKTIGIIGGGQLGRMLALAAAPLGYKVIVLDPDADCPAAQVADR-VIVADYDDVAALRELAEQCD---VITY   74 (377)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCE-EEECCCCCHHHHHHHHHCCC---EEEE
T ss_conf             99999987868999999999978998999848984984783784-89868898999999984599---9997


No 372
>PRK06101 short chain dehydrogenase; Provisional
Probab=94.34  E-value=0.48  Score=27.24  Aligned_cols=41  Identities=17%  Similarity=0.374  Sum_probs=34.2

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             569815-71116889999978985999739989999999712
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~   46 (475)
                      |=+.|- +-+|..+|+.|+++|++|.+.+|+.++.+++.+++
T Consensus         4 vlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~~   45 (241)
T PRK06101          4 VLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQS   45 (241)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
T ss_conf             999224049999999999987998999989999999999732


No 373
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain.
Probab=94.29  E-value=0.18  Score=30.41  Aligned_cols=75  Identities=16%  Similarity=0.357  Sum_probs=54.5

Q ss_pred             CEEEEEECCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             8056981571-116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLGS-MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG~-MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-+||-+. .|.|||.=|.++|..|.+++....                    ++.+.+.   ..++|+..+....-+
T Consensus        37 k~vvViGrS~iVG~Pla~lL~~~~atVtichs~T~--------------------nl~~~~~---~ADIvI~A~G~p~~i   93 (159)
T pfam02882        37 KNVVVIGRSNIVGKPLALLLLNANATVTVCHSKTK--------------------DLAEITR---EADIVVVAVGKPGLI   93 (159)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCC--------------------CHHHHHH---CCCEEEEECCCCCCC
T ss_conf             66999888731489999999877998999818999--------------------9789630---034442315885505


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCH
Q ss_conf             9999999720789989996798657
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHF  107 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~  107 (475)
                      +.      ..+++|.++||.|.+..
T Consensus        94 ~~------~~ik~gavvIDvGi~~~  112 (159)
T pfam02882        94 KA------DWVKPGAVVIDVGINRV  112 (159)
T ss_pred             CH------HHCCCCCEEEEECCCCC
T ss_conf             69------88589988998022065


No 374
>PRK09135 pteridine reductase; Provisional
Probab=94.29  E-value=0.49  Score=27.16  Aligned_cols=85  Identities=19%  Similarity=0.385  Sum_probs=56.6

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999-73998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+ |+++.+..+.+.++......               .+...+-.-|.+.+.
T Consensus         7 KvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~---------------~~~~~~~~Dv~~~~~   71 (249)
T PRK09135          7 KVALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRP---------------GSAAALQADLLDPDA   71 (249)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCC---------------CCEEEEECCCCCHHH
T ss_conf             88999688758999999999987998999818987999999999985059---------------818999816999999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             99999999720789989996798
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~st  104 (475)
                      ++++++.+.....+=|++|...-
T Consensus        72 v~~~~~~~~~~~G~iDiLVNNAg   94 (249)
T PRK09135         72 LEQLVAAAVAAFGRLDALVNNAS   94 (249)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCC
T ss_conf             99999999998399989998998


No 375
>PRK06483 short chain dehydrogenase; Provisional
Probab=94.27  E-value=0.5  Score=27.14  Aligned_cols=80  Identities=20%  Similarity=0.219  Sum_probs=53.7

Q ss_pred             CCCCEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             998805698157-111688999997898599973998999-999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELT-DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~-~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+| .|=+.|-+ -+|..+|+.|++.|++|.+.+|+.+.. +++.+.+      ..                .+-.-|.+
T Consensus         1 M~k-tVlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~------~~----------------~~~~Dv~~   57 (236)
T PRK06483          1 MSA-PILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAG------AT----------------CIQADFST   57 (236)
T ss_pred             CCC-EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCC------CE----------------EEEECCCC
T ss_conf             998-79997899889999999999889989999598479999998569------98----------------99922799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             0699999999972078998999679
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.++++++.+......=|++|...
T Consensus        58 ~~~v~~~~~~~~~~~g~id~lVnNA   82 (236)
T PRK06483         58 NAGIMAFIDELKQHTDGLRAIIHNA   82 (236)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999999999839975999777


No 376
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=94.27  E-value=0.38  Score=28.03  Aligned_cols=71  Identities=17%  Similarity=0.213  Sum_probs=51.6

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             0569815-71116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      +|++||- |.-|+.++.-..+.|++|+..-|+++|...+.... ...   .-..++..+.+.+..-+.||.....+
T Consensus         2 KIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~~~~~-i~q---~Difd~~~~a~~l~g~DaVIsA~~~~   73 (211)
T COG2910           2 KIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAARQGVT-ILQ---KDIFDLTSLASDLAGHDAVISAFGAG   73 (211)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCCCE-EEC---CCCCCHHHHHHHHCCCCEEEEECCCC
T ss_conf             0789953745679999999867980489980767665223530-200---02227456676635876699721578


No 377
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional
Probab=94.26  E-value=0.5  Score=27.12  Aligned_cols=140  Identities=16%  Similarity=0.185  Sum_probs=76.3

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             99880569815-711168899999789-8599973998999999971221127840328989998605778899997699
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDKG-FRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~G-~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      |+. +|+++|- |--|.-+.+-|.++- +++  ..++.++.++.         .     --.|+   ++..+++|+|+|+
T Consensus         1 M~~-kV~I~GasGytG~EL~rlL~~Hp~vel--~~i~~~~~k~~---------~-----~~~~~---~~~~DvvFlalPh   60 (314)
T PRK11863          1 MKP-KVFIDGEAGTTGLQIRERLAGRSDIEL--LSIPEAKRKDP---------A-----ARREL---LNAADIAILCLPD   60 (314)
T ss_pred             CCC-EEEEECCCCCHHHHHHHHHHCCCCEEE--EEECCCCCCCH---------H-----HHHHH---HHCCCEEEECCCC
T ss_conf             982-699989988569999999975998299--99671125575---------5-----67877---5069999999997


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCC------CCCCC-EE-EEECCHH-
Q ss_conf             069999999997207899899967986578999999999847994306754676000------35684-37-8845489-
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKG------ARSGA-SL-MVGGNEK-  149 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~g------A~~G~-sl-MvGG~~~-  149 (475)
                      +...+. +..+   ++.|..|||.|.-+.-         .. +  +    |-|=|+=      ..++. -+ -+|+-.. 
T Consensus        61 ~~s~~~-v~~~---~~~g~kVIDLSaDfRl---------~~-~--w----vYGlPEl~~~~r~~I~~a~~IAnPGCyaTa  120 (314)
T PRK11863         61 DAAREA-VALI---DNPATRVIDASTAHRT---------AP-G--W----VYGFPELAPGQRERIAAARRVANPGCYPTG  120 (314)
T ss_pred             HHHHHH-HHHH---HHCCCEEEECCCCCCC---------CC-C--C----EEECCCCCHHHHHHHHHCCEEECCCCHHHH
T ss_conf             789999-9988---6279889989854457---------99-9--7----733650687789998629863279828999


Q ss_pred             HHHHHHHHHHHHHCCCCCC-C--EEEEECCCCHHHH
Q ss_conf             9988899999875015678-6--1898569874678
Q gi|254780716|r  150 AYNRVENILLSISAKYQNS-P--CCALLGPDGSGHF  182 (475)
Q Consensus       150 ~~~~~~piL~~iaak~~~~-~--cv~y~G~~GsGh~  182 (475)
                      +.-.+.|+++.=-  .+.. +  +-.-.|-+|+|.-
T Consensus       121 ~iL~L~PL~~~gl--i~~~~~i~i~a~SG~SGAGk~  154 (314)
T PRK11863        121 AIALLRPLVDAGL--LPADYPVSINAVSGYSGGGKA  154 (314)
T ss_pred             HHHHHHHHHHCCC--CCCCCCEEEEEECCCCCCCCC
T ss_conf             9999999997688--788884699841025667766


No 378
>PRK12937 short chain dehydrogenase; Provisional
Probab=94.24  E-value=0.5  Score=27.10  Aligned_cols=83  Identities=19%  Similarity=0.414  Sum_probs=55.1

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698--1571116889999978985999-73998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+ |+++.+..+++.++......++                ..+-.-|.+.+.
T Consensus         6 K~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~Dv~~~~~   69 (245)
T PRK12937          6 KVAIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRA----------------IAVQADVADAAA   69 (245)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE----------------EEEECCCCCHHH
T ss_conf             8899948577899999999998799999976998689999999999659958----------------999837899999


Q ss_pred             HHHHHHHHHHCCCCCCEEEECC
Q ss_conf             9999999972078998999679
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +++.++.+......=|++|...
T Consensus        70 ~~~~v~~~~~~~g~iDilVnNA   91 (245)
T PRK12937         70 VDRLFEAAETAFGRIDVLVNSA   91 (245)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9999999999819988999805


No 379
>TIGR01724 hmd_rel coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase-related protein; InterPro: IPR010063   This entry identifies a sister clade to the authenticated coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin reductase, (IPR010062 from INTERPRO). All members are restricted to archaeal methanogens and their function is unknown..
Probab=94.20  E-value=0.44  Score=27.52  Aligned_cols=152  Identities=13%  Similarity=0.148  Sum_probs=92.3

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             11688999997898599973998999999971221127840328989998605778899997699069999999997207
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLL   93 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l   93 (475)
                      -|..||..++..|++|..-..+++-.++-.=. ..+..+++...+-.|.+   +...+-++.-|-|+.+-.+...+++.+
T Consensus        31 GG~~ma~efa~aGhdv~l~eP~~~~~~d~~W~-~ve~aGv~v~~~d~eaa---~~~e~~vlftPfG~~t~~ia~~i~~~~  106 (341)
T TIGR01724        31 GGSRMAIEFAKAGHDVVLAEPNREVLSDDLWK-KVEDAGVKVVSDDVEAA---KHGEIHVLFTPFGKATLSIAKTIIEHV  106 (341)
T ss_pred             CCHHHHHHHHHCCCCEEEECCCHHHHHHHHHH-HHHHCCCEEEEHHHHHH---CCCCEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             60488998874287068607761231146777-78751664530135433---017557886353178999999999746


Q ss_pred             CCCCEEEECCCCCHHHHHHH-HH--HHHHC--CCCEE-CCCCCCCCCCCCCCCEEEEECC---------HHHHHHHHHHH
Q ss_conf             89989996798657899999-99--99847--99430-6754676000356843788454---------89998889999
Q gi|254780716|r   94 SPEDILLDGGNSHFCDTQIR-SL--QLSEK--GIYFI-GIGVSGGVKGARSGASLMVGGN---------EKAYNRVENIL  158 (475)
Q Consensus        94 ~~g~iiID~sts~~~~t~~~-~~--~l~~k--gi~fi-d~pVSGG~~gA~~G~slMvGG~---------~~~~~~~~piL  158 (475)
                      .++.+|.++.|..+.---+. ..  +++.+  |+.-+ -++|-|+|...    -..+||.         ++-.+++-.+.
T Consensus       107 Pe~~~i~ntCt~~~~vly~~le~~l~~~r~dvG~ssmhP~~vPGtP~~~----~y~i~G~~~~~~~~at~~q~~~~~el~  182 (341)
T TIGR01724       107 PENAVICNTCTVSPVVLYYSLEKILRLKRKDVGISSMHPAAVPGTPQHG----HYVIGGKATEGKELATEEQIKKLVELA  182 (341)
T ss_pred             CCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC----EEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8653662024333368888878887432210320013566788988765----267505420012212589999999999


Q ss_pred             HHHHCCCCCCCEEEEECCCCHH
Q ss_conf             9875015678618985698746
Q gi|254780716|r  159 LSISAKYQNSPCCALLGPDGSG  180 (475)
Q Consensus       159 ~~iaak~~~~~cv~y~G~~GsG  180 (475)
                      +..+.       ..|+-|.---
T Consensus       183 ~s~Gk-------~~y~~Padv~  197 (341)
T TIGR01724       183 KSVGK-------KAYVVPADVS  197 (341)
T ss_pred             HHCCC-------CCEECCCHHH
T ss_conf             84187-------4301032036


No 380
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=94.20  E-value=0.51  Score=27.03  Aligned_cols=19  Identities=16%  Similarity=0.088  Sum_probs=9.7

Q ss_pred             CCCEECCCHHHHHHHCCCC
Q ss_conf             7840328989998605778
Q gi|254780716|r   51 QKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus        51 ~~~~~~~s~~e~v~~l~~p   69 (475)
                      -.+.+++.-.+.++.+..-
T Consensus        24 ~~V~g~D~d~~~i~~l~~g   42 (411)
T TIGR03026        24 HEVTGVDIDQEKVDKLNKG   42 (411)
T ss_pred             CCEEEEECCHHHHHHHHCC
T ss_conf             9489998999999999779


No 381
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=94.15  E-value=0.53  Score=26.97  Aligned_cols=82  Identities=16%  Similarity=0.253  Sum_probs=52.9

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--1571116889999978985999-739989999999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+ |+++.+..++..++.........                .+-.-|.+.+.+
T Consensus         9 valVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~----------------~~~~Dv~~~~~v   72 (261)
T PRK08936          9 VVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAI----------------AVKGDVTVESDV   72 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEE----------------EEECCCCCHHHH
T ss_conf             8999684778999999999987999999728987899999999996599389----------------998279999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.......+=|++|...
T Consensus        73 ~~~v~~~~~~~G~iDiLVNNA   93 (261)
T PRK08936         73 VNLIQSAVKEFGTLDVMINNA   93 (261)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999829988999899


No 382
>PRK00711 D-amino acid dehydrogenase small subunit; Validated
Probab=94.11  E-value=0.078  Score=33.07  Aligned_cols=32  Identities=16%  Similarity=0.366  Sum_probs=29.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             05698157111688999997898599973998
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      +|-|||-|.+|...|.+|+++|++|.|.||..
T Consensus         2 ~VvIIGaGi~G~stA~~La~~G~~V~vler~~   33 (416)
T PRK00711          2 RVVVLGSGVVGVTSAWYLARAGHEVTVIDRQP   33 (416)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             79999944999999999996899689996999


No 383
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=94.11  E-value=0.45  Score=27.49  Aligned_cols=184  Identities=15%  Similarity=0.187  Sum_probs=101.4

Q ss_pred             HHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHH
Q ss_conf             1168899999789859997399--89999999712211278403289899986057788999976990699999999972
Q gi|254780716|r   14 MGSNLSLNILDKGFRLAVYNKD--FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKP   91 (475)
Q Consensus        14 MG~~mA~nL~~~G~~V~vydr~--~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~   91 (475)
                      .|..||+.|++.|.+|.+-|++  .+..+...+.....+.++.+                +-.=+++.+.+++.++.+..
T Consensus        13 IG~~iA~~LA~aGa~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~----------------~~~D~T~~~e~~~~~~~~~~   76 (258)
T TIGR01963        13 IGLAIAKALAAAGANVVVNDLGEADEGAEAAAKVATDAGGSVIY----------------LVADVTKEEEIADMIQAVAA   76 (258)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEE----------------EECCCCCHHHHHHHHHHHHH
T ss_conf             78999999987298899846788789999999999961883577----------------51478888999999999999


Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHHHHHHHHCCCCC-CC
Q ss_conf             0789989996798657899999999984799430675467600035684-378845489998889999987501567-86
Q gi|254780716|r   92 LLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVENILLSISAKYQN-SP  169 (475)
Q Consensus        92 ~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~piL~~iaak~~~-~~  169 (475)
                      ....-||+|+  |               .||-++. ||==-|.---.-. .+|..+.--+.+.+.|..+.   +..| + 
T Consensus        77 ~fG~~DiLVN--N---------------AG~QhVa-PiEeFP~~~w~~iiav~LtsaF~t~raAlP~Mk~---~gwGGR-  134 (258)
T TIGR01963        77 EFGGLDILVN--N---------------AGIQHVA-PIEEFPPEKWDRIIAVMLTSAFHTIRAALPHMKK---QGWGGR-  134 (258)
T ss_pred             HHCCCCEEEE--C---------------CCEEECC-CCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCC---CCCCCE-
T ss_conf             8568874884--4---------------6401417-6547786678737302168889999750643213---785537-


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             189856987467898877678788899989999999964-2899789999998606884430799999999974056799
Q gi|254780716|r  170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITG  248 (475)
Q Consensus       170 cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~~k~~~~g  248 (475)
                       |.+++..          ||.+-   ..+==+|-=-||+ .||+--  ... |--.++        ||++.+.-=.-  .
T Consensus       135 -IiNIAS~----------HGLvA---Sp~KSAYVAAKHG~~GLTKv--~AL-E~A~~g--------iT~NaiCPGYV--~  187 (258)
T TIGR01963       135 -IINIASV----------HGLVA---SPFKSAYVAAKHGLIGLTKV--LAL-EVAAHG--------ITANAICPGYV--R  187 (258)
T ss_pred             -EEEEEEE----------CCCCC---CCCHHHHHHHHHHHHHHHHH--HHH-HCCCCC--------CEEEEECCCCC--C
T ss_conf             -9971010----------00003---53213456774302121155--554-204788--------75866728756--7


Q ss_pred             CCCHHH-CCCCCCCC
Q ss_conf             952001-02333658
Q gi|254780716|r  249 MPIIDV-ICDKASQK  262 (475)
Q Consensus       249 ~~lid~-i~d~~~~k  262 (475)
                      .||+++ |.|.|...
T Consensus       188 TPLV~~Qi~DqAk~r  202 (258)
T TIGR01963       188 TPLVEKQIADQAKTR  202 (258)
T ss_pred             CHHHHHHHHHHHHHC
T ss_conf             554676589998651


No 384
>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007   One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also capable of irreversible reduction of diacetyl with NADH to acetoin. There has been a reuctance to classify the enzyme as either 1.1.1.4 from EC, which is (R,R)-butanediol dehydrogenase, or 1.1.1.5 from EC, which is acetoin dehydrogenase without a specified stereochemistry . Another member of this family, from Corynebacterium glutamicum (Brevibacterium flavum), is called L-2,3-butanediol dehydrogenase .    This enzyme is a homotetramer in the family of short chain dehydrogenases (IPR002198 from INTERPRO). .
Probab=94.08  E-value=0.38  Score=28.04  Aligned_cols=74  Identities=20%  Similarity=0.284  Sum_probs=47.5

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEECC--HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
Q ss_conf             711168899999789859997399--899999997122112784032898999860577889999769906999999999
Q gi|254780716|r   12 GSMGSNLSLNILDKGFRLAVYNKD--FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKL   89 (475)
Q Consensus        12 G~MG~~mA~nL~~~G~~V~vydr~--~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l   89 (475)
                      +=.|..+|.||++.||.|.+.|.+  ++.+.+..++....+.+...                +-+=|.+=+.+++.+++-
T Consensus        10 qGIG~gIa~RLa~DGF~vav~D~n~Qe~~A~~t~~~i~~~G~~Ava----------------~~~DV~~k~~~~~~i~~A   73 (258)
T TIGR02415        10 QGIGKGIAERLAKDGFNVAVADLNNQEETAKETAKEINQKGGKAVA----------------YKLDVSDKSQVFEAIDQA   73 (258)
T ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEE----------------EECCCCCHHHHHHHHHHH
T ss_conf             4323899999983461378725666368999999999866973799----------------864734567899999999


Q ss_pred             HHCCCCCCEEEE
Q ss_conf             720789989996
Q gi|254780716|r   90 KPLLSPEDILLD  101 (475)
Q Consensus        90 ~~~l~~g~iiID  101 (475)
                      ..-+-.=|++|.
T Consensus        74 ~~~fG~fdV~VN   85 (258)
T TIGR02415        74 VEKFGGFDVMVN   85 (258)
T ss_pred             HHHCCCCEEEEE
T ss_conf             997089327865


No 385
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=94.05  E-value=0.55  Score=26.84  Aligned_cols=101  Identities=13%  Similarity=0.265  Sum_probs=55.9

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHCCC--EEEEEECCHH--HHH----HHHHHCCCCC--CCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             0569815-7111688999997898--5999739989--999----9997122112--78403289899986057788999
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDKGF--RLAVYNKDFE--LTD----VFIKKISGLS--QKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~G~--~V~vydr~~~--~~~----~l~~~~~~~~--~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      +|++||. |..|..+|..|+.++.  ++..+|++++  +++    ++.+......  ..+....+.++    ++..++|+
T Consensus         2 KV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~----~~daDivV   77 (309)
T cd05294           2 KVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDALAAAGIDAEIKISSDLSD----VAGSDIVI   77 (309)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCCCCCCCCCCEEEECCCHHH----HCCCCEEE
T ss_conf             89999999769999999998379987599960556434231123554503433688767982798899----68999999


Q ss_pred             EECC---------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             9769---------------90699999999972078998999679865789999
Q gi|254780716|r   74 MMVT---------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        74 l~vp---------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      +.-.               +.+.+.++...+..+- ++.++|-.|  +|-|+..
T Consensus        78 itAG~~rk~g~tR~dLl~~Na~I~~~i~~~i~~~~-p~~ivivvt--NPvDv~t  128 (309)
T cd05294          78 ITAGVPRKEGMSRLDLAKKNAKIVKKYAKQIAEFA-PDTKILVVT--NPVDVMT  128 (309)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC-CCEEEEECC--CCHHHHH
T ss_conf             87898899599878999989999999998764269-984999768--9657799


No 386
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]
Probab=93.99  E-value=0.4  Score=27.85  Aligned_cols=75  Identities=16%  Similarity=0.339  Sum_probs=39.0

Q ss_pred             EEEEEECCH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             056981571-1168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGIIGLGS-MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiIGLG~-MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      ++-+||-++ .|.|||.=|+..+.+|.+++...                    .++.+.+   .+.++++..+--+.-+.
T Consensus       158 ~~vVVGrS~iVGkPla~lL~~~naTVtvcHs~T--------------------~~l~~~~---k~ADIvv~AvG~p~~i~  214 (283)
T COG0190         158 NVVVVGRSNIVGKPLALLLLNANATVTVCHSRT--------------------KDLASIT---KNADIVVVAVGKPHFIK  214 (283)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEECCCC--------------------CCHHHHH---HHCCEEEEECCCCCCCC
T ss_conf             899989987676799999986799899975778--------------------8878986---23899999548756455


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHH
Q ss_conf             9999997207899899967986578
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFC  108 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~  108 (475)
                            ...+++|.++||.|.+...
T Consensus       215 ------~d~vk~gavVIDVGinrv~  233 (283)
T COG0190         215 ------ADMVKPGAVVIDVGINRVN  233 (283)
T ss_pred             ------CCCCCCCCEEEECCCCCCC
T ss_conf             ------1413578789964775404


No 387
>PRK08589 short chain dehydrogenase; Validated
Probab=93.94  E-value=0.57  Score=26.69  Aligned_cols=82  Identities=13%  Similarity=0.250  Sum_probs=54.2

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             05698--1571116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.|++. +.++.+++......++                ..+-.-|.+.+.+
T Consensus         7 KvalVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~-~~~~~~~~i~~~g~~~----------------~~~~~Dvsd~~~v   69 (272)
T PRK08589          7 KVAVITGASTGIGQASAIALAQEGAYVLAVDIAE-AVSETVDKIKSNGGKA----------------KAYHVDISDEQQV   69 (272)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHHHHHHCCCCE----------------EEEEECCCCHHHH
T ss_conf             9899978256999999999998699999983827-8999999999559948----------------9999607999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+.....+=||+|...
T Consensus        70 ~~~v~~~~~~~G~iDiLVNNA   90 (272)
T PRK08589         70 KDFASDIKEQFGHIDVLFNNA   90 (272)
T ss_pred             HHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999829987899898


No 388
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: IPR012729    Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees. The Escherichia coli ThiF and MoeB proteins are seemingly more closely related than the E. coli ThiF and Campylobacter (for example) ThiF. This entry represents the divergent clade of putative ThiF proteins as found in Campylobacter..
Probab=93.92  E-value=0.37  Score=28.05  Aligned_cols=131  Identities=23%  Similarity=0.387  Sum_probs=76.5

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCE---EEEEEC------CH----------HHHHHHHHHCCCCCCCCEEC------
Q ss_conf             988056981571116889999978985---999739------98----------99999997122112784032------
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFR---LAVYNK------DF----------ELTDVFIKKISGLSQKVIVT------   56 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~---V~vydr------~~----------~~~~~l~~~~~~~~~~~~~~------   56 (475)
                      .+..|.+-|||=+|+++|.||++.|..   ++=||+      ++          .|++++.+.-.    .+-|+      
T Consensus        20 ~~a~VAicGlGGLGS~~AinLAR~GigkLiLvDfDvvepsNLnRQqY~~s~~G~~KteAlke~i~----einPy~~ie~~   95 (200)
T TIGR02354        20 KKASVAICGLGGLGSNVAINLARAGIGKLILVDFDVVEPSNLNRQQYKVSDVGKKKTEALKENIS----EINPYVEIEII   95 (200)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECEECCCCCCHHHHHHHHCCCHHHHHHHHHHH----HHCCCCEEEEE
T ss_conf             05827897016116899999987302202566404323665613257876248621799998786----50884212311


Q ss_pred             ------CCHHHHHHHCCCCCEEEEECCCHHHHHHHH-HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCC
Q ss_conf             ------898999860577889999769906999999-9997207899899967986578999999999847994306754
Q gi|254780716|r   57 ------KNLEQMVEAVCKPRKILMMVTDGDPVDQLI-DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGV  129 (475)
Q Consensus        57 ------~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi-~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pV  129 (475)
                            ++++.|++..|   +|+=-- +.+.+.+.+ +.++...+.-.+|.=.|=..|.|+-.+..+=-.+..+.++=+.
T Consensus        96 d~ki~E~N~~~~fkdaD---iv~EAF-Dna~aKam~~n~vl~~ykdk~li~ASGlAGy~D~NsI~trKI~k~FY~cGDg~  171 (200)
T TIGR02354        96 DEKIDEENLDKLFKDAD---IVCEAF-DNAEAKAMLVNAVLEKYKDKKLIAASGLAGYDDANSIKTRKISKRFYVCGDGK  171 (200)
T ss_pred             ECCCCHHHHHHHHHCCC---EEEECC-CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCEECCCCEEEECCC
T ss_conf             02127667987840674---788716-99889999999999767864587602664524211000121146303874472


Q ss_pred             CCCCCCCCCCCEEEE
Q ss_conf             676000356843788
Q gi|254780716|r  130 SGGVKGARSGASLMV  144 (475)
Q Consensus       130 SGG~~gA~~G~slMv  144 (475)
                      +    +|..|..||.
T Consensus       172 ~----~ak~G~gLma  182 (200)
T TIGR02354       172 S----DAKSGRGLMA  182 (200)
T ss_pred             C----CCCCCCCCCC
T ss_conf             2----2001631025


No 389
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]
Probab=93.89  E-value=0.59  Score=26.62  Aligned_cols=172  Identities=17%  Similarity=0.206  Sum_probs=93.5

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHCC-CE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             0569815-711168899999789-85-99973998999999971221127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDKG-FR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~G-~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|+++|- |+||+.+.+.+.... +. +.+++|.++..               .-.+..+++. +.     .+-+|-.  
T Consensus         4 ki~V~Ga~GRMG~~ii~~v~~~~~~~L~aa~~~~~~~~---------------~g~d~ge~~g-~~-----~~gv~v~--   60 (266)
T COG0289           4 KVAVAGASGRMGRTLIRAVLEAPDLELVAAFDRPGSLS---------------LGSDAGELAG-LG-----LLGVPVT--   60 (266)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCC---------------CCCCHHHHCC-CC-----CCCCEEE--
T ss_conf             69997578727899999985289946999981378422---------------3431123214-46-----5573320--


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             99999999720789989996798657899999999984799430675467600035684378845489998889999987
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSI  161 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~i  161 (475)
                           +.+......-|++||.|  .|..+....+.+.+.++..    |.|+.           |-+++..++++..-+.+
T Consensus        61 -----~~~~~~~~~~DV~IDFT--~P~~~~~~l~~~~~~~~~l----VIGTT-----------Gf~~e~~~~l~~~a~~v  118 (266)
T COG0289          61 -----DDLLLVKADADVLIDFT--TPEATLENLEFALEHGKPL----VIGTT-----------GFTEEQLEKLREAAEKV  118 (266)
T ss_pred             -----CCHHHCCCCCCEEEECC--CCHHHHHHHHHHHHCCCCE----EEECC-----------CCCHHHHHHHHHHHHHC
T ss_conf             -----63433046898899899--8254699999999769986----99799-----------99989999999998538


Q ss_pred             HCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             50156786189856987467898877678788899989999999964289978999999860688443079999999997
Q gi|254780716|r  162 SAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS  241 (475)
Q Consensus       162 aak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~~~~~~~~i~~vf~~w~~~~~~syLl~i~~~il~  241 (475)
                      .        +.+...-.-|-.          -+||+...+-.+|.   ++ +.||-+.-.+-++..-+.--|....-|-.
T Consensus       119 ~--------vv~a~NfSiGvn----------ll~~l~~~aak~l~---~~-DiEIiE~HHr~K~DAPSGTAl~lae~ia~  176 (266)
T COG0289         119 P--------VVIAPNFSLGVN----------LLFKLAEQAAKVLD---DY-DIEIIEAHHRHKKDAPSGTALKLAEAIAE  176 (266)
T ss_pred             C--------EEEECCCHHHHH----------HHHHHHHHHHHHCC---CC-CEEEHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9--------899656407999----------99999999998667---78-87863232366788986789999999998


Q ss_pred             HC
Q ss_conf             40
Q gi|254780716|r  242 SS  243 (475)
Q Consensus       242 ~k  243 (475)
                      .+
T Consensus       177 ~~  178 (266)
T COG0289         177 AR  178 (266)
T ss_pred             HH
T ss_conf             60


No 390
>PRK07041 short chain dehydrogenase; Provisional
Probab=93.87  E-value=0.59  Score=26.60  Aligned_cols=41  Identities=10%  Similarity=0.199  Sum_probs=33.2

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             569815-71116889999978985999739989999999712
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~   46 (475)
                      +=+.|- +-+|.++|+.|++.|.+|.+.+|++++.++..++.
T Consensus        10 ~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~   51 (240)
T PRK07041         10 VLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARAL   51 (240)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH
T ss_conf             999577888999999999987999999959889999999984


No 391
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364. This clade of FAD dependent oxidoreductases (members of the pfam01266 family) is syntenically associated with a family of proposed phosphonatase-like enzymes (TIGR03351) and is also found (less frequently) in association with phosphonate transporter components. A likely role for this enzyme involves the oxidative deamination of an aminophosphonate differring slightly from 2-aminoethylphosphonate, possibly 1-hydroxy-2-aminoethylphosphonate (see the comments for TIGR03351). Many members of the larger FAD dependent oxidoreductase family act as amino acid oxidative deaminases.
Probab=93.82  E-value=0.074  Score=33.25  Aligned_cols=32  Identities=22%  Similarity=0.432  Sum_probs=30.1

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             05698157111688999997898599973998
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      +|-|||-|.||...|.+|++.|.+|.|.|+..
T Consensus         2 Dv~VIGaGi~Gls~A~~La~~G~~V~vle~~~   33 (365)
T TIGR03364         2 DLIIVGAGILGLAHAYAAARRGLSVTVIERSS   33 (365)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             29999932999999999997899499998999


No 392
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006    One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+.    This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=93.81  E-value=0.082  Score=32.92  Aligned_cols=34  Identities=21%  Similarity=0.426  Sum_probs=32.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      ..|+|||-|-=|.+-|--|.++|.+|.||||.|+
T Consensus       144 ~rVAviGAGPAGLaCAD~L~RaGV~v~VfDRhP~  177 (480)
T TIGR01318       144 KRVAVIGAGPAGLACADILARAGVQVVVFDRHPE  177 (480)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             2789977886025799987517855999747703


No 393
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=93.75  E-value=0.62  Score=26.45  Aligned_cols=82  Identities=16%  Similarity=0.289  Sum_probs=53.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--1571116889999978985999739989999999-712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-KKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~-~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+|  |-+-+|.++|+.|++.|++|.+.+|+.++..+.. +........+                ..+-.-+.+.+.+
T Consensus         7 ~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~Dlt~~~~v   70 (248)
T PRK05557          7 VALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKA----------------LAVQGDVADAESI   70 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCE----------------EEEEECCCCHHHH
T ss_conf             899948976899999999998799899996985658999999999639958----------------9999038999999


Q ss_pred             HHHHHHHHHCCCCCCEEEECC
Q ss_conf             999999972078998999679
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++.++.+.....+=|++|...
T Consensus        71 ~~~~~~~~~~~g~iD~linnA   91 (248)
T PRK05557         71 ERAVDEAKAEFGGVDILVNNA   91 (248)
T ss_pred             HHHHHHHHHHCCCCCEEEECC
T ss_conf             999999999829971999899


No 394
>KOG1200 consensus
Probab=93.72  E-value=0.43  Score=27.62  Aligned_cols=35  Identities=20%  Similarity=0.304  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
Q ss_conf             11168899999789859997399899999997122
Q gi|254780716|r   13 SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS   47 (475)
Q Consensus        13 ~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~   47 (475)
                      -.|++++..|+++|++|.|.|++.+.+++......
T Consensus        25 GIGrAia~~la~~Garv~v~dl~~~~A~ata~~L~   59 (256)
T KOG1200          25 GIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLG   59 (256)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
T ss_conf             07799999997469679975032244799986268


No 395
>TIGR00518 alaDH alanine dehydrogenase; InterPro: IPR008141 Alanine dehydrogenases () and pyridine nucleotide transhydrogenase () have been shown to share regions of similarity . Alanine dehydrogenase catalyzes the NAD-dependent reversible reductive amination of pyruvate into alanine. Pyridine nucleotide transhydrogenase catalyzes the reduction of NADP^+ to NADPH with the concomitant oxidation of NADH to NAD^+. This enzyme is located in the plasma membrane of prokaryotes and in the inner membrane of the mitochondria of eukaryotes. The transhydrogenation between NADH and NADP is coupled with the translocation of a proton across the membrane. In prokaryotes the enzyme is composed of two different subunits, an alpha chain (gene pntA) and a beta chain (gene pntB), while in eukaryotes it is a single chain protein. The sequence of alanine dehydrogenase from several bacterial species are related with those of the alpha subunit of bacterial pyridine nucleotide transhydrogenase and of the N-terminal half of the eukaryotic enzyme. The two most conserved regions correspond respectively to the N-terminal extremity of these proteins and to a central glycine-rich region which is part of the NAD(H)-binding site.; GO: 0000286 alanine dehydrogenase activity, 0006118 electron transport.
Probab=93.72  E-value=0.34  Score=28.37  Aligned_cols=99  Identities=15%  Similarity=0.251  Sum_probs=69.4

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEE--ECCCHH
Q ss_conf             880569815711168899999789859997399899999997122112784032898999860577889999--769906
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILM--MVTDGD   80 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil--~vp~g~   80 (475)
                      ..++-++|-|..|.+-|+--..-|-.|.+.|.+.++...+-+.......  .-+.+..++.+.+...+.++-  ++|..+
T Consensus       168 ~g~~~~~ggg~~g~~~~~~~~g~g~~~~~~d~n~d~l~~l~~~f~~~~~--~~~~~~~~~~~~~~~~dl~~~~~l~~g~~  245 (372)
T TIGR00518       168 PGDVTILGGGVVGTNAAKMAVGLGADVTILDLNVDRLRQLDDLFGGRID--TRYSNAYELEDAVPEADLLIGAVLIPGAK  245 (372)
T ss_pred             CCCEEEEECCCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCHH--HHCCCHHHHHHHHHHHHHEEEEEEECCCC
T ss_conf             4526786076112102344313675156762354665554565312011--10145345544332210101211205754


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99999999972078998999679
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +-.-|-+.+...+.||.+++|..
T Consensus       246 ~p~l~~~~~~~~~~pg~~~~d~~  268 (372)
T TIGR00518       246 APKLVSEELVEQMKPGAVLVDVA  268 (372)
T ss_pred             CCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             53022167887517872578653


No 396
>KOG1399 consensus
Probab=93.67  E-value=0.076  Score=33.17  Aligned_cols=37  Identities=24%  Similarity=0.536  Sum_probs=33.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |...++.+||.|.=|.+.|++|.+.|++|.+|.|+.+
T Consensus         4 ~~~~~vaIIGAG~sGL~~ar~l~~~g~~v~vfEr~~~   40 (448)
T KOG1399           4 MMSKDVAVIGAGPAGLAAARELLREGHEVVVFERTDD   40 (448)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             7778548978566888999999877998369970587


No 397
>PRK11259 solA N-methyltryptophan oxidase; Provisional
Probab=93.62  E-value=0.099  Score=32.31  Aligned_cols=34  Identities=32%  Similarity=0.515  Sum_probs=31.3

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             8805698157111688999997898599973998
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      +.+|-|||-|.+|...|.+|+++|.+|.+.|+..
T Consensus         3 r~DVvVIGaGi~G~s~A~~La~~G~~V~vle~~~   36 (377)
T PRK11259          3 RYDVIVIGLGSMGSAAGYYLARAGLRVLGIDRFM   36 (377)
T ss_pred             EEEEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             0489999952999999999997899599992899


No 398
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional
Probab=93.61  E-value=0.12  Score=31.80  Aligned_cols=35  Identities=26%  Similarity=0.443  Sum_probs=33.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             99880569815711168899999789859997399
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKD   35 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~   35 (475)
                      |+|.+|-|||-|.-|..+|.-|++.|++|.++++.
T Consensus         1 M~~~DV~IvGaG~vGl~lAl~La~~G~~V~iiE~~   35 (384)
T PRK08849          1 MNKYDIAVVGGGMVGAATAIGFAKQGRSVAVIEGF   35 (384)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98189999992499999999999579959999689


No 399
>PRK08374 homoserine dehydrogenase; Provisional
Probab=93.60  E-value=0.65  Score=26.27  Aligned_cols=142  Identities=14%  Similarity=0.191  Sum_probs=69.5

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCC----CEE---EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             99880569815711168899999789----859---99739989999999712211278403289899986057788999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKG----FRL---AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G----~~V---~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      |+ -+||++|+|+.|+.+++-|.++.    .++   .+-|++......+         .+   ....+......+    +
T Consensus         1 m~-i~I~l~G~G~VG~~~~~~L~~~~~~~g~~l~vv~i~~~~~~~~~~~---------d~---~~~~~~~~~~~~----~   63 (316)
T PRK08374          1 ME-VKVSLFGFGTVGRALAEILAEKSRVFGVELKVVSITDRSGTVWGDF---------DL---LEAKEVKESTGK----L   63 (316)
T ss_pred             CE-EEEEEECCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC---------CH---HHHHHHHHCCCC----C
T ss_conf             95-1299993388999999999971887298659999995567634565---------55---665553320254----3


Q ss_pred             EECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHH
Q ss_conf             97699069999999997207899899967986578999999999847994306754676000356843788454899988
Q gi|254780716|r   74 MMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNR  153 (475)
Q Consensus        74 l~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~  153 (475)
                      .-.++....+.....++... +.+|+||++++.+  ..+....+-++|.+.+-|-=         ++  +    ...|++
T Consensus        64 ~~~~~~~~~~~~~~~i~~~~-~~dvvVd~t~~~~--~~~~~~~al~~G~hVVTANK---------~~--l----A~~~~e  125 (316)
T PRK08374         64 SNIGDYEVYNFTPEEIVEEV-DPDIVVDVSSWDE--AHEWYLTALKEGKSVVTSNK---------PP--I----ANHYDE  125 (316)
T ss_pred             CCCCCHHHCCCCHHHHHCCC-CCCEEEECCCCHH--HHHHHHHHHHCCCCEECCCH---------HH--H----HHHHHH
T ss_conf             44553012048989983488-9998998799969--99999999988992997886---------99--9----851999


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCHHHHH
Q ss_conf             899999875015678618985698746789
Q gi|254780716|r  154 VENILLSISAKYQNSPCCALLGPDGSGHFV  183 (475)
Q Consensus       154 ~~piL~~iaak~~~~~cv~y~G~~GsGh~v  183 (475)
                      +..    .|.+  ++-.+.|=+..|+|-=+
T Consensus       126 L~~----~A~~--~~~~~~yEasVggGiPi  149 (316)
T PRK08374        126 LLN----EANE--RNLGYFFEATVMAGTPI  149 (316)
T ss_pred             HHH----HHHH--CCCEEEEEEEECCCCCC
T ss_conf             999----9997--49849995340002031


No 400
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and  m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional
Probab=93.56  E-value=0.4  Score=27.83  Aligned_cols=94  Identities=13%  Similarity=0.230  Sum_probs=60.6

Q ss_pred             CEEEEEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             805698157-1116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    4 ADIGIIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         4 ~~IGiIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      .++-+||-+ .-|.|+|.-|.++|-.|.+++....                    ++.+.+   .+.++|+..+....-+
T Consensus        29 k~vvVvGrS~~VG~Pla~lL~~~~atVt~~hs~t~--------------------~l~~~~---~~ADIvI~a~G~p~~i   85 (140)
T cd05212          29 KKVLVVGRSGIVGAPLQCLLQRDGATVYSCDWKTI--------------------QLQSKV---HDADVVVVGSPKPEKV   85 (140)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCC--------------------CHHHHH---HHCCEEEECCCCCCCC
T ss_conf             99999999812499999999978898999469995--------------------989985---2349999816876727


Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             999999972078998999679865789999999998479943067546760
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
                      +.      ..+++|.++||.|.+...+     +...++ ..++ .||-||.
T Consensus        86 ~~------~~vk~GavvIDvGi~~~~~-----~~v~~~-a~~i-TPVPGGV  123 (140)
T cd05212          86 PT------EWIKPGATVINCSPTKLSG-----DDVKES-ASLY-VPMTGGV  123 (140)
T ss_pred             CH------HHCCCCCEEEEECCCCCCC-----HHHHCE-EEEE-CCCCCCC
T ss_conf             89------7767998899803775677-----214416-5287-7899954


No 401
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain.
Probab=93.52  E-value=0.67  Score=26.18  Aligned_cols=91  Identities=15%  Similarity=0.141  Sum_probs=62.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .++-++|-|--|+.+|.++...|-.|.|++.+|-+.-+..-.|      +. ..+.+|.+..   .+++++.--...   
T Consensus        24 k~vvV~GYG~~GkGvA~~~rg~Ga~V~V~EvDPi~aleA~mdG------f~-V~~~~ea~~~---aDi~VTaTG~~~---   90 (162)
T pfam00670        24 KVAVVCGYGDVGKGCAASLKGQGARVIVTEIDPICALQAAMEG------FQ-VVTLEEVVKK---ADIFVTTTGNKD---   90 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCCEEEEEECCCHHHHHHHHCC------CC-CCCHHHHHHC---CCEEEECCCCCC---
T ss_conf             7899967876677799986229998999947930699998649------95-4788898604---999999248977---


Q ss_pred             HHH-HHHHHCCCCCCEEEECCCCCHH
Q ss_conf             999-9997207899899967986578
Q gi|254780716|r   84 QLI-DKLKPLLSPEDILLDGGNSHFC  108 (475)
Q Consensus        84 ~vi-~~l~~~l~~g~iiID~sts~~~  108 (475)
                       |+ .+-+..++.|.|+-..|..+-+
T Consensus        91 -vi~~eh~~~mKdgaIlaN~GHfd~E  115 (162)
T pfam00670        91 -IITGEHMAKMKNDAIVCNIGHFDNE  115 (162)
T ss_pred             -CCCHHHHHHHCCCEEEECCCCCCCE
T ss_conf             -4739999984488699877756522


No 402
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids t
Probab=93.50  E-value=0.68  Score=26.15  Aligned_cols=113  Identities=16%  Similarity=0.145  Sum_probs=64.2

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEE--------EEC---CHHHHHHHHHH---CCCC-C------CCCEECCCHHH
Q ss_conf             88056981571116889999978985999--------739---98999999971---2211-2------78403289899
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAV--------YNK---DFELTDVFIKK---ISGL-S------QKVIVTKNLEQ   61 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~v--------ydr---~~~~~~~l~~~---~~~~-~------~~~~~~~s~~e   61 (475)
                      ...+.+=|.|+.|+..|+.|.+.|.+|..        ||.   +.+....+.+.   .... .      ...... +.++
T Consensus        38 g~~vaIQGfGnVG~~aA~~l~e~GakvVaVsD~~G~i~~~~Gld~~~l~~l~~~k~~~~~~~~~~~~~~~~~~~~-~~~~  116 (254)
T cd05313          38 GKRVAISGSGNVAQYAAEKLLELGAKVVTLSDSKGYVYDPDGFTGEKLAELKEIKEVRRGRVSEYAKKYGTAKYF-EGKK  116 (254)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCEEC-CCCC
T ss_conf             999999897799999999999779979999857850887999988999999999974687102444138985663-8975


Q ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHH-HHHHCCCCC--CEEEECCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             98605778899997699069999999-997207899--89996798657899999999984799430
Q gi|254780716|r   62 MVEAVCKPRKILMMVTDGDPVDQLID-KLKPLLSPE--DILLDGGNSHFCDTQIRSLQLSEKGIYFI  125 (475)
Q Consensus        62 ~v~~l~~pr~Iil~vp~g~~v~~vi~-~l~~~l~~g--~iiID~sts~~~~t~~~~~~l~~kgi~fi  125 (475)
                      +.+  -.+++.+   |+  +++.+++ +-.+.+...  ++|+.+.|.  ..|.+..+.|.++||.++
T Consensus       117 ~~~--~~cDIli---Pa--A~en~I~~~nA~~i~a~~ck~IvEgANg--P~T~eAd~iL~~kGI~vi  174 (254)
T cd05313         117 PWE--VPCDIAF---PC--ATQNEVDAEDAKLLVKNGCKYVAEGANM--PCTAEAIEVFRQAGVLFA  174 (254)
T ss_pred             HHH--CCCCEEE---EC--CCCCCCCHHHHHHHHHCCCEEEEECCCC--CCCHHHHHHHHHCCCEEE
T ss_conf             133--0476997---43--5466789999999996798299865889--998789999998898896


No 403
>pfam03059 NAS Nicotianamine synthase protein. Nicotianamine synthase EC:2.5.1.43 catalyses the trimerisation of S-adenosylmethionine to yield one molecule of nicotianamine. Nicotianamine has an important role in plant iron uptake mechanisms. Plants adopt two strategies (termed I and II) of iron acquisition. Strategy I is adopted by all higher plants except graminaceous plants, which adopt strategy II. In strategy I plants, the role of nicotianamine is not fully determined: possible roles include the formation of more stable complexes with ferrous than with ferric ion, which might serve as a sensor of the physiological status of iron within a plant, or which might be involved in the transport of iron. In strategy II (graminaceous) plants, nicotianamine is the key intermediate (and nicotianamine synthase the key enzyme) in the synthesis of the mugineic family (the only known family in plants) of phytosiderophores. Phytosiderophores are iron chelators whose secretion by the roots is great
Probab=93.49  E-value=0.68  Score=26.14  Aligned_cols=20  Identities=25%  Similarity=0.492  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHCCCCCCEEE
Q ss_conf             99999999972078998999
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILL  100 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiI  100 (475)
                      .-..+++.|...+.+|..++
T Consensus       209 ~K~~I~~hL~k~m~~Ga~l~  228 (277)
T pfam03059       209 EKAKVIDHLGKHMAPGALLV  228 (277)
T ss_pred             HHHHHHHHHHHHCCCCCEEE
T ss_conf             59999999997458996799


No 404
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=93.48  E-value=0.68  Score=26.13  Aligned_cols=85  Identities=20%  Similarity=0.349  Sum_probs=58.4

Q ss_pred             CCEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             880569815-7111688999997898599973998999999971221127840328989998605778899997699069
Q gi|254780716|r    3 QADIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         3 k~~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +..+=+-|- +-.|..+|+.|+++|++|..--|+.++.+++.++-.... .+              .++++-.-+.+.+.
T Consensus         6 ~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~-~v--------------~v~vi~~DLs~~~~   70 (265)
T COG0300           6 GKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKT-GV--------------EVEVIPADLSDPEA   70 (265)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHH-CC--------------EEEEEECCCCCHHH
T ss_conf             8679997788648999999999779979999676999999999998730-86--------------27999776788367


Q ss_pred             HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             999999997207899899967
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~  102 (475)
                      +..+.+.+.....+=|++|..
T Consensus        71 ~~~l~~~l~~~~~~IdvLVNN   91 (265)
T COG0300          71 LERLEDELKERGGPIDVLVNN   91 (265)
T ss_pred             HHHHHHHHHHCCCCCCEEEEC
T ss_conf             999999998248852389977


No 405
>pfam01266 DAO FAD dependent oxidoreductase. This family includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase EC:1.1.99.5, Sarcosine oxidase beta subunit EC:1.5.3.1, D-alanine oxidase EC:1.4.99.1, D-aspartate oxidase EC:1.4.3.1.
Probab=93.45  E-value=0.11  Score=31.99  Aligned_cols=32  Identities=19%  Similarity=0.440  Sum_probs=29.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             05698157111688999997898599973998
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      +|-|||-|.+|...|.+|++.|++|.++|+..
T Consensus         1 dv~IIGaGi~Gls~A~~La~~G~~V~vie~~~   32 (309)
T pfam01266         1 DVVVIGGGIVGLSTAYELARRGLSVTLLERGD   32 (309)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999927999999999997899599994999


No 406
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]
Probab=93.44  E-value=0.31  Score=28.65  Aligned_cols=103  Identities=17%  Similarity=0.277  Sum_probs=55.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHH----CCCCCCCCEECCCHHHHHHHCCCCCEEEEEC--
Q ss_conf             05698157111688999997898--599973998999999971----2211278403289899986057788999976--
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKK----ISGLSQKVIVTKNLEQMVEAVCKPRKILMMV--   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~----~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v--   76 (475)
                      +|++||.|..|+.+|..|+..++  ++..||+..++.+-....    ............+ .+ -+.++..++|+++-  
T Consensus         2 KV~viGaG~VG~s~a~~l~~~~~~~el~LiDi~~~~~~G~a~DL~~~~~~~~~~~~i~~~-~~-y~~~~~aDiVvitAG~   79 (313)
T COG0039           2 KVAVIGAGNVGSSLAFLLLLQGLGSELVLIDINEEKAEGVALDLSHAAAPLGSDVKITGD-GD-YEDLKGADIVVITAGV   79 (313)
T ss_pred             EEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHCCHHHCCHHCCCCEEEECC-CC-HHHHCCCCEEEEECCC
T ss_conf             399989874789999999625556659999746665640110253340002676188347-87-0231699899996888


Q ss_pred             C-------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             9-------------90699999999972078998999679865789999
Q gi|254780716|r   77 T-------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        77 p-------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                      |             +.+.+.++..++..... +.+++-.|  +|-|+.-
T Consensus        80 prKpGmtR~DLl~~Na~I~~~i~~~i~~~~~-d~ivlVvt--NPvD~~t  125 (313)
T COG0039          80 PRKPGMTRLDLLEKNAKIVKDIAKAIAKYAP-DAIVLVVT--NPVDILT  125 (313)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEEC--CCHHHHH
T ss_conf             8998997799998659999999999996599-72999945--9478899


No 407
>PRK07060 short chain dehydrogenase; Provisional
Probab=93.44  E-value=0.37  Score=28.11  Aligned_cols=38  Identities=11%  Similarity=0.197  Sum_probs=32.9

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
Q ss_conf             15711168899999789859997399899999997122
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS   47 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~   47 (475)
                      |-+-+|..+|+.|++.|.+|.+.||+.+..+++.++..
T Consensus        17 ~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~   54 (245)
T PRK07060         17 ASSGIGRACAVALAARGARVVAAARNQADLDRLAGETG   54 (245)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC
T ss_conf             77689999999999879999999799899999998639


No 408
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional
Probab=93.31  E-value=0.72  Score=25.95  Aligned_cols=41  Identities=24%  Similarity=0.430  Sum_probs=33.3

Q ss_pred             EEEEECCHHHHHHHHHHH-HCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             569815711168899999-78985999739989999999712
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNIL-DKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~-~~G~~V~vydr~~~~~~~l~~~~   46 (475)
                      +=-.|-|+.|++...-++ +.||+|..-|.+.+-++.+.+++
T Consensus         3 avhFGAGNigRGFI~~ll~~~g~~v~Fvdvn~~li~~Ln~~~   44 (381)
T PRK02318          3 ALHFGAGNIGRGFIGKLLADNGFEVTFADVNQEIIDALNKRK   44 (381)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCC
T ss_conf             699787422126689999977976999958788999986069


No 409
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homologou
Probab=93.30  E-value=0.4  Score=27.86  Aligned_cols=125  Identities=14%  Similarity=0.134  Sum_probs=68.8

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCC--EECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             05698157111688999997898-59997399899999997122112784--0328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKV--IVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~--~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      +|-+||.|-.|..+++||+..|+ ++.+.|.+.=....|..+.--..+.+  .-+...++.+..+. |.+-+..... ..
T Consensus         1 KVlvvGaGglGce~~k~La~~Gvg~i~iiD~D~Ie~SNLnRQfLf~~~dvGk~Ka~vAa~~l~~~N-p~~~I~~~~~-~v   78 (234)
T cd01484           1 KVLLVGAGGIGCELLKNLALMGFGQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKSEVAAEAVNDRN-PNCKVVPYQN-KV   78 (234)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCCEECCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHC-CCCEEEEEEC-CC
T ss_conf             989994888799999999983998699975990056770130244644268822999999999878-9977999805-56


Q ss_pred             H-HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCC
Q ss_conf             9-9999999720789989996798657899999999984799430675467600
Q gi|254780716|r   82 V-DQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVK  134 (475)
Q Consensus        82 v-~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~  134 (475)
                      . +++++  ....+.=|+|+|+.- +.+.-.-....|-..++-++|.|++|...
T Consensus        79 ~~e~~~~--~~f~~~~DvVi~alD-N~~aR~~vN~~c~~~~~PLIegGt~G~~G  129 (234)
T cd01484          79 GPEQDFN--DTFFEQFHIIVNALD-NIIARRYVNGMLIFLIVPLIESGTEGFKG  129 (234)
T ss_pred             CCCCCCC--HHHHHHCCEEEECCC-CHHHHHHHHHHHHHHCCCEEEECCCCCEE
T ss_conf             8621057--988852999998857-88899999999998099859720246147


No 410
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]
Probab=93.28  E-value=0.73  Score=25.92  Aligned_cols=117  Identities=15%  Similarity=0.228  Sum_probs=78.3

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC-CCCEE--CCCHHHHHHHCCCCCEEEEECCCHHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112-78403--2898999860577889999769906999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS-QKVIV--TKNLEQMVEAVCKPRKILMMVTDGDPVDQLI   86 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~-~~~~~--~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi   86 (475)
                      |-|.++--+|  ++...-+|+..+++++..+-...+.++.. .++..  -..++ ....+++|+.||+-  -|...++++
T Consensus        44 GtGsi~iE~a--~~~p~~~v~AIe~~~~a~~~~~~N~~~fg~~n~~vv~g~Ap~-~L~~~~~~daiFIG--Gg~~i~~il  118 (187)
T COG2242          44 GTGSITIEWA--LAGPSGRVIAIERDEEALELIERNAARFGVDNLEVVEGDAPE-ALPDLPSPDAIFIG--GGGNIEEIL  118 (187)
T ss_pred             CCCHHHHHHH--HHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCHH-HHCCCCCCCEEEEC--CCCCHHHHH
T ss_conf             8668999999--739885599992588899999999998499967999546457-63699999999987--987778999


Q ss_pred             HHHHHCCCCC-CEEEECCCCCHHHHHHHHHHHHHCCC-CEECCCCCCCC
Q ss_conf             9997207899-89996798657899999999984799-43067546760
Q gi|254780716|r   87 DKLKPLLSPE-DILLDGGNSHFCDTQIRSLQLSEKGI-YFIGIGVSGGV  133 (475)
Q Consensus        87 ~~l~~~l~~g-~iiID~sts~~~~t~~~~~~l~~kgi-~fid~pVSGG~  133 (475)
                      +.....|++| .+|++..|  .+......+.+++.|+ ..+-..||-+.
T Consensus       119 e~~~~~l~~ggrlV~nait--lE~~~~a~~~~~~~g~~ei~~v~is~~~  165 (187)
T COG2242         119 EAAWERLKPGGRLVANAIT--LETLAKALEALEQLGGREIVQVQISRGK  165 (187)
T ss_pred             HHHHHHCCCCCEEEEEEEC--HHHHHHHHHHHHHCCCCEEEEEEEECCE
T ss_conf             9999971868769998600--8889999999997298569999842352


No 411
>PRK12744 short chain dehydrogenase; Provisional
Probab=93.27  E-value=0.72  Score=25.96  Aligned_cols=80  Identities=15%  Similarity=0.287  Sum_probs=50.6

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHH----HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEE--ECC
Q ss_conf             5698--157111688999997898599973998999----99997122112784032898999860577889999--769
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELT----DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILM--MVT   77 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~----~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil--~vp   77 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+++.++.    +++.++....                  ..+.+.+  -|.
T Consensus        10 valVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~------------------g~~~~~~~~Dv~   71 (257)
T PRK12744         10 VVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAA------------------GAKAVAFQADLT   71 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHC------------------CCCEEEEECCCC
T ss_conf             89992887589999999999879989999378743689999999999973------------------992899976889


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             90699999999972078998999679
Q gi|254780716|r   78 DGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        78 ~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.+.++++++.+.....+=|++|...
T Consensus        72 ~~~~v~~~~~~~~~~~G~iDilVnnA   97 (257)
T PRK12744         72 TAAAVEKLFDDAKAAFGRPDIAINTV   97 (257)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99999999999999809988999766


No 412
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=93.25  E-value=0.74  Score=25.88  Aligned_cols=79  Identities=16%  Similarity=0.330  Sum_probs=54.1

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             1571116889999978985999-739989999999712211278403289899986057788999976990699999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAV-YNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDK   88 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~v-ydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~   88 (475)
                      |-+-+|..+|+.|++.|.+|.+ |+++.+..+++.++..... +              .+++.+-.-+.+.+.++++++.
T Consensus        16 gs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~l~~~~-g--------------~~~~~~~~Dv~~~~~~~~~~~~   80 (260)
T PRK08416         16 GTRGIGKAIVYEFAQSGVNIAFTYNSNVEEADKIAQDLEKKY-G--------------IKARAYPLNILEPETYKELFKK   80 (260)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHH-C--------------CCEEEEECCCCCHHHHHHHHHH
T ss_conf             340999999999998799999985998899999999998841-9--------------8369997788999999999999


Q ss_pred             HHHCCCCCCEEEECC
Q ss_conf             972078998999679
Q gi|254780716|r   89 LKPLLSPEDILLDGG  103 (475)
Q Consensus        89 l~~~l~~g~iiID~s  103 (475)
                      +...+..=|++|...
T Consensus        81 i~~~~g~iDilVnnA   95 (260)
T PRK08416         81 IDADFDRVDFFISNA   95 (260)
T ss_pred             HHHHHCCCCEEEECC
T ss_conf             999819978998643


No 413
>pfam03720 UDPG_MGDP_dh_C UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=93.22  E-value=0.53  Score=26.94  Aligned_cols=81  Identities=20%  Similarity=0.319  Sum_probs=54.2

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             11168899999789859997399899999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   13 SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        13 ~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
                      .....++..|.++|.+|.+||...+.-+         ..+.....++.+.++.   .+.|++++++.+=-.--+..+...
T Consensus        17 S~s~~l~~~L~~~g~~v~~~DP~v~~~~---------~~~~~~~~~~~~~~~~---~D~iii~t~h~~f~~i~~~~~~~~   84 (99)
T pfam03720        17 SPALDIIEELLEEGAEVRVYDPYVPEEH---------EDGVTLVDDLEEALKG---ADAIVILTDHDEFRSLDWAKLKKL   84 (99)
T ss_pred             CCHHHHHHHHHHCCCEEEEECCCCCHHH---------HCCEEEECCHHHHHHC---CCEEEEEECCHHHHCCCHHHHHHH
T ss_conf             8589999999987998999999579567---------0534553358889626---897999737288715899999975


Q ss_pred             CCCCCEEEECCCCC
Q ss_conf             78998999679865
Q gi|254780716|r   93 LSPEDILLDGGNSH  106 (475)
Q Consensus        93 l~~g~iiID~sts~  106 (475)
                      ++ ..+|+|+-+..
T Consensus        85 ~k-~~~I~D~~~i~   97 (99)
T pfam03720        85 MK-PPVVFDGRNVL   97 (99)
T ss_pred             CC-CCEEEEECCCC
T ss_conf             69-99999805862


No 414
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=93.22  E-value=0.75  Score=25.85  Aligned_cols=82  Identities=15%  Similarity=0.235  Sum_probs=50.2

Q ss_pred             EEEEECC---HHHHHHHHHHHHCCCEEEEEECC-----------HHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCE
Q ss_conf             5698157---11168899999789859997399-----------899999997122112784032898999860577889
Q gi|254780716|r    6 IGIIGLG---SMGSNLSLNILDKGFRLAVYNKD-----------FELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRK   71 (475)
Q Consensus         6 IGiIGLG---~MG~~mA~nL~~~G~~V~vydr~-----------~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~   71 (475)
                      +=+.|-+   -+|.++|+.|++.|.+|.+..++           .+...++.++....+                .+...
T Consensus         9 alVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g----------------~~~~~   72 (257)
T PRK12859          9 AVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKNG----------------VKVSS   72 (257)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC----------------CEEEE
T ss_conf             99928899986299999999987998999836520111234537579999999999549----------------85999


Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99976990699999999972078998999679
Q gi|254780716|r   72 ILMMVTDGDPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        72 Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      +-.-|.+.+.++.+++.+...+..-|++|...
T Consensus        73 ~~~Dl~~~~~~~~~i~~~~~~~g~iDilVnnA  104 (257)
T PRK12859         73 MELDLTQNDAPKELINKVTEQLGYPHILINNA  104 (257)
T ss_pred             EECCCCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             98358999999999999999829998999899


No 415
>TIGR02352 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727   This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as Escherichia coli that instead use tyrosine and the ThiH protein .; GO: 0016491 oxidoreductase activity, 0050660 FAD binding.
Probab=93.21  E-value=0.14  Score=31.25  Aligned_cols=36  Identities=17%  Similarity=0.444  Sum_probs=31.5

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
Q ss_conf             569815711168899999789859997399899999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDV   41 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~   41 (475)
                      |.|||=|+.|..+|..|+++|+.|.++|++++....
T Consensus         1 ~~ViGGGvIGL~~A~~L~~~G~~V~l~~~~~~~g~~   36 (357)
T TIGR02352         1 VLVIGGGVIGLSVAVELAERGHSVTLLDRDPTVGGG   36 (357)
T ss_pred             CEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHH
T ss_conf             978453187899999999749938999658604567


No 416
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=93.19  E-value=0.75  Score=25.81  Aligned_cols=33  Identities=15%  Similarity=0.209  Sum_probs=10.9

Q ss_pred             EEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHH
Q ss_conf             5698157111688999997898-59997399899
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFEL   38 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~   38 (475)
                      +-++|.|.+|...+.-+...|- +|.+.|+++++
T Consensus       173 VlV~G~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~r  206 (343)
T PRK09880        173 VFISGVGPIGCLIVSAVKTLGAAEIVCADLSPRS  206 (343)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHH
T ss_conf             9998477679999999998699879999797899


No 417
>KOG3124 consensus
Probab=93.14  E-value=0.11  Score=32.01  Aligned_cols=162  Identities=19%  Similarity=0.275  Sum_probs=91.0

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCE----EEEEECCHHHHHH--HHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             056981571116889999978985----9997399899999--9971221127840328989998605778899997699
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFR----LAVYNKDFELTDV--FIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~----V~vydr~~~~~~~--l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .|||||-|+|-..+++.+...|+.    +..+-.+ ++...  +.+.      .+..+.+-.+.+.   ..+++++++..
T Consensus         2 ~~gfigag~ma~ala~g~~~~Gi~~~~~i~~s~~~-~~~~~~~~~~~------g~~~~~~n~~~~~---~s~v~~~svKp   71 (267)
T KOG3124           2 KVGFIGAGNMAQALASGFVASGIIEANRIWASVQT-ERSLGLMFEAL------GVKTVFTNLEVLQ---ASDVVFLSVKP   71 (267)
T ss_pred             CEEEECHHHHHHHHHHCCCCCCCCCHHHEEEECCC-HHHHHHHHHCC------CCEEEECHHHHHH---HCCCEEEEECC
T ss_conf             63586355569999710434687752222452573-16666665507------8534412377775---06532675361


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEEC---CHHHHHHHH
Q ss_conf             06999999999720789989996798657899999999984799430675467600035684378845---489998889
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGG---NEKAYNRVE  155 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG---~~~~~~~~~  155 (475)
                       ..+.+|..++.+.+..++|++-+--...-.+..  ..+. -..+.+-+ +.-.+.--..|.+.|..|   ..+.-+.++
T Consensus        72 -~~i~~vls~~~~~~~~~~iivS~aaG~tl~~l~--~~l~-~~~rviRv-mpNtp~~v~eg~sv~~~g~~~~~~D~~l~~  146 (267)
T KOG3124          72 -QVIESVLSEIKPKVSKGKIIVSVAAGKTLSSLE--SKLS-PPTRVIRV-MPNTPSVVGEGASVYAIGCHATNEDLELVE  146 (267)
T ss_pred             -HHHHHHHHCCCCCCCCCEEEEEEEECCCHHHHH--HHCC-CCCCEEEE-CCCCHHHHHCCCEEEEECCCCCHHHHHHHH
T ss_conf             -127988604752122560899975144689889--7548-87725881-489800341674798507874154699999


Q ss_pred             HHHHHHHCCCC-CCCEE-EEECCCCHHH
Q ss_conf             99998750156-78618-9856987467
Q gi|254780716|r  156 NILLSISAKYQ-NSPCC-ALLGPDGSGH  181 (475)
Q Consensus       156 piL~~iaak~~-~~~cv-~y~G~~GsGh  181 (475)
                      .+|...+.-.. .+.|+ .+.|=+|||-
T Consensus       147 ~ll~~vG~~~evpE~~iDavTgLsGSgP  174 (267)
T KOG3124         147 ELLSAVGLCEEVPEKCIDAVTGLSGSGP  174 (267)
T ss_pred             HHHHHCCCCEECCHHHHHHHHHCCCCCH
T ss_conf             9998638521074876267761367749


No 418
>PRK09126 hypothetical protein; Provisional
Probab=93.11  E-value=0.15  Score=31.01  Aligned_cols=37  Identities=19%  Similarity=0.443  Sum_probs=34.7

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |++.+|-|||-|--|..+|.-|.+.|++|.++++.+.
T Consensus         1 Mm~~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~~~   37 (392)
T PRK09126          1 MMHSDILVVGAGPAGLSFARSLAGSGLKVTLIERQPL   37 (392)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9989999999258999999999868998999908985


No 419
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=93.10  E-value=0.78  Score=25.72  Aligned_cols=74  Identities=18%  Similarity=0.334  Sum_probs=53.3

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|++|.+.||+.++..+   ..     .+                ..+-.-|.+.+.++
T Consensus        10 ~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l~~---~~-----~~----------------~~~~~Dv~~~~~v~   65 (253)
T PRK08220         10 TVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQLNE---QY-----PF----------------ATFVLDVADAAAVA   65 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHC---CC-----CE----------------EEEEEECCCHHHHH
T ss_conf             89995885689999999999879999999788778748---99-----77----------------99997379999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+.....+=|++|...
T Consensus        66 ~~~~~~~~~~g~iDilVnnA   85 (253)
T PRK08220         66 QVCQRLLAETGPLDVLVNVA   85 (253)
T ss_pred             HHHHHHHHHCCCCCEEEECC
T ss_conf             99999999739988899899


No 420
>PRK05086 malate dehydrogenase; Provisional
Probab=93.03  E-value=0.58  Score=26.67  Aligned_cols=102  Identities=18%  Similarity=0.230  Sum_probs=53.7

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHC---CCEEEEEECCHHH---HHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC-
Q ss_conf             0569815-71116889999978---9859997399899---99999712211278403289899986057788999976-
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDK---GFRLAVYNKDFEL---TDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV-   76 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~---G~~V~vydr~~~~---~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v-   76 (475)
                      +|++||- |+.|+.+|.-|..+   +-++..+|+.+..   +-++.. .. ..-...... -.+.-+.++..++|++.- 
T Consensus         2 KV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~Di~~~~~G~alDL~h-~~-~~~~~~~~~-~~~~~~~l~~adiVvitAG   78 (312)
T PRK05086          2 KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSH-IP-TAVKIKGFS-GEDPTPALEGADVVLISAG   78 (312)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHC-CC-CCCCCCEEE-CCCHHHHHCCCCEEEECCC
T ss_conf             89999899869999999998289877749997588886105656547-87-546653461-6986787179999998789


Q ss_pred             --------------CCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             --------------990699999999972078998999679865789999
Q gi|254780716|r   77 --------------TDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQI  112 (475)
Q Consensus        77 --------------p~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~  112 (475)
                                    .+.+.+.++...+..+. |+.+++-.|  +|-|+.-
T Consensus        79 ~~rkpG~tR~dLl~~Na~I~~~i~~~I~~~~-p~aiiivvs--NPvD~mt  125 (312)
T PRK05086         79 VARKPGMDRSDLFNVNAGIVKNLVEKVAKTC-PKACIGIIT--NPVNTTV  125 (312)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEEC--CCHHHHH
T ss_conf             8998589889999987899999999887208-971899954--8327789


No 421
>PRK06125 short chain dehydrogenase; Provisional
Probab=93.03  E-value=0.79  Score=25.65  Aligned_cols=38  Identities=11%  Similarity=0.212  Sum_probs=32.7

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
Q ss_conf             15711168899999789859997399899999997122
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKIS   47 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~   47 (475)
                      |-+-||..+|+.|++.|.+|.+.+|+.++.++..++..
T Consensus        15 ~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~   52 (259)
T PRK06125         15 ASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLR   52 (259)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             77689999999999879989999798899999999998


No 422
>PRK08300 acetaldehyde dehydrogenase; Validated
Probab=92.99  E-value=0.8  Score=25.61  Aligned_cols=124  Identities=21%  Similarity=0.256  Sum_probs=69.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCE----EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             9988056981571116889999978985----999739989999999712211278403289899986057788999976
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFR----LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~----V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      |.|-++++||-|+.|.-+...+.+..+-    +.+-|...+-.....+.|      +                       
T Consensus         2 ~~k~~vAIiGsGnIGtDLm~Ki~Rs~~le~~~~vG~dp~S~GL~rA~~lG------v-----------------------   52 (298)
T PRK08300          2 MSKIKVAIIGSGNIGTDLMIKILRSPHLEPVAMVGIDPESDGLARARRLG------V-----------------------   52 (298)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCC------C-----------------------
T ss_conf             87534999888833899999986577610699980598984999999849------9-----------------------


Q ss_pred             CCHHHHHHHHHHHHHCC--CCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC-CCC----------C-CCCCCCEE
Q ss_conf             99069999999997207--8998999679865789999999998479943067546-760----------0-03568437
Q gi|254780716|r   77 TDGDPVDQLIDKLKPLL--SPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS-GGV----------K-GARSGASL  142 (475)
Q Consensus        77 p~g~~v~~vi~~l~~~l--~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS-GG~----------~-gA~~G~sl  142 (475)
                      +   ...+=+++++...  ..-||+-|.++.  ..-.+..+.+++.|+..+|..-+ -|+          . .+.+=.-+
T Consensus        53 ~---ts~~GId~ll~~~~~~~idiVFDATSA--~aH~~h~~~l~~~g~~~IDLTPAaiGp~~VP~VNl~~~l~~~NvNMV  127 (298)
T PRK08300         53 A---TTAEGIDGLLAHPEFDDIDIVFDATSA--GAHVENAAKLRELGVRVIDLTPAAIGPYCVPAVNLDEHLDAPNVNMV  127 (298)
T ss_pred             C---CCCCCHHHHHHCCCCCCCCEEEECCCH--HHHHHHHHHHHHCCCEEEECCCCCCCCEEECCCCHHHHCCCCCCCEE
T ss_conf             6---637679999618335687889978980--66899999999739879967700269878763778995579986436


Q ss_pred             EEECCHHHHHHHHHHHHHHHC
Q ss_conf             884548999888999998750
Q gi|254780716|r  143 MVGGNEKAYNRVENILLSISA  163 (475)
Q Consensus       143 MvGG~~~~~~~~~piL~~iaa  163 (475)
                      -|||...     -|+..+++.
T Consensus       128 TCGGQAt-----iPiv~Avsr  143 (298)
T PRK08300        128 TCGGQAT-----IPIVAAVSR  143 (298)
T ss_pred             EECCCHH-----HHHHHHHHH
T ss_conf             5557302-----189999874


No 423
>TIGR00465 ilvC ketol-acid reductoisomerase; InterPro: IPR013023 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine . The enzyme forms a tetramer of similar but non-identical chains, and requires magnesium as a cofactor. ; GO: 0016491 oxidoreductase activity, 0009082 branched chain family amino acid biosynthetic process.
Probab=92.98  E-value=0.46  Score=27.41  Aligned_cols=98  Identities=22%  Similarity=0.240  Sum_probs=62.1

Q ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHH---HHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             880569815711168899999789859997399899---99999712211278403289899986057788999976990
Q gi|254780716|r    3 QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFEL---TDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         3 k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~---~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      ...+++||.|..|.+-+.|+.+.|.++.+--+....   ...+.+.   ....-.+-..+..+-+..+..++++.++|+.
T Consensus         3 ~~~~~~~g~g~~g~~~~~~~~~~g~~~~~g~~~~~~~~~~~~~~~~---~~~gw~pg~~~~~~~~~~~~~~~~~~l~pd~   79 (344)
T TIGR00465         3 GKTVAIIGYGSQGHAQGLNLRDSGLNVIVGLRKGGIAEKRASWKKA---EEDGWVPGFKVLTVEEAAKRADLILNLLPDE   79 (344)
T ss_pred             CCEEEEEECCCCCCHHHCCCCCCCCEEEEEECCCCHHHHHHHHHHH---HHCCCCCCCHHHHHHHHHCCCCEEEEECCHH
T ss_conf             8617887327532000012111453157740543023455556544---2124556511233454430134544323213


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             699999999972078998999679
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      ..-......+.|.+..|.++.-.-
T Consensus        80 ~~~~~~~~~~~p~~~~g~~~~~~~  103 (344)
T TIGR00465        80 VQPEVYEAEIKPLLKEGKTLGFSH  103 (344)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             445666777665552264213202


No 424
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=92.98  E-value=0.8  Score=25.60  Aligned_cols=105  Identities=18%  Similarity=0.213  Sum_probs=58.5

Q ss_pred             CEEEEEEC-CHHHHHHHHHHHHCC-------CEEEEEECCHHH--HH----HHHHHCCCCCCCCEECCCHHHHHHHCCCC
Q ss_conf             80569815-711168899999789-------859997399899--99----99971221127840328989998605778
Q gi|254780716|r    4 ADIGIIGL-GSMGSNLSLNILDKG-------FRLAVYNKDFEL--TD----VFIKKISGLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         4 ~~IGiIGL-G~MG~~mA~nL~~~G-------~~V~vydr~~~~--~~----~l~~~~~~~~~~~~~~~s~~e~v~~l~~p   69 (475)
                      .+|.+||- |..|+++|..|+...       ..+..||..+..  .+    ++.+........+....++.+   .++..
T Consensus         3 ~KV~IiGAaG~IG~~la~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~amDl~~~a~~~~~~v~~~~~~~~---a~~~a   79 (322)
T cd01338           3 VRVAVTGAAGQIGYSLLFRIASGEMFGPDQPVILQLLELPQALKALEGVAMELEDCAFPLLAEIVITDDPNV---AFKDA   79 (322)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCHHCCCCCEEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEEECCHHH---HHCCC
T ss_conf             099998999689999999997111307997269999757575666765774453267654587797488789---83788


Q ss_pred             CEEEEECC---------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             89999769---------------906999999999720789989996798657899999
Q gi|254780716|r   70 RKILMMVT---------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR  113 (475)
Q Consensus        70 r~Iil~vp---------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~  113 (475)
                      ++|++.--               +.+.+.++...+..+..|+.+++-.||  |-|+.-.
T Consensus        80 DvVvitaG~prkPG~tR~DLl~~Na~I~~~~~~~i~~~a~p~~~vivvsN--Pvd~~~~  136 (322)
T cd01338          80 DWALLVGAKPRGPGMERADLLKANGKIFTAQGKALNDVASRDVKVLVVGN--PCNTNAL  136 (322)
T ss_pred             CEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC--HHHHHHH
T ss_conf             78999368789989818999998689999999999975798838999578--1888999


No 425
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=92.97  E-value=0.81  Score=25.59  Aligned_cols=72  Identities=18%  Similarity=0.289  Sum_probs=55.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             11168899999789859997399899999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   13 SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        13 ~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
                      -.|.+.|+.|+++|++|..-.|..++.+++.++...  ..+                ..+-+-|.+.+.++..++.+...
T Consensus        17 GiG~A~A~~l~~~G~~vvl~aRR~drL~~la~~~~~--~~~----------------~~~~~DVtD~~~~~~~i~~~~~~   78 (246)
T COG4221          17 GIGEATARALAEAGAKVVLAARREERLEALADEIGA--GAA----------------LALALDVTDRAAVEAAIEALPEE   78 (246)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCE----------------EEEEECCCCHHHHHHHHHHHHHH
T ss_conf             688999999997899699986368899999986256--743----------------78961367889999999999975


Q ss_pred             CCCCCEEEEC
Q ss_conf             7899899967
Q gi|254780716|r   93 LSPEDILLDG  102 (475)
Q Consensus        93 l~~g~iiID~  102 (475)
                      ..+=|++|.-
T Consensus        79 ~g~iDiLvNN   88 (246)
T COG4221          79 FGRIDILVNN   88 (246)
T ss_pred             HCCCCEEEEC
T ss_conf             1760589966


No 426
>PRK09072 short chain dehydrogenase; Provisional
Probab=92.90  E-value=0.82  Score=25.53  Aligned_cols=80  Identities=15%  Similarity=0.295  Sum_probs=49.8

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             0569815-711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+=+.|- +-+|..+|+.|++.|++|.+.+|+.++.+++.++...  .++                ..+..-|.+.+.++
T Consensus         7 ~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~~--~~~----------------~~~~~Dls~~~~~~   68 (262)
T PRK09072          7 RVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPYP--GRV----------------RWVVADLTSEAGRE   68 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC--CCE----------------EEEEEECCCHHHHH
T ss_conf             899948623999999999998799899998989999999998458--976----------------99997179999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+.+.+. ...+=|++|...
T Consensus        69 ~~~~~~~-~~g~iDiLInNA   87 (262)
T PRK09072         69 AVLARAR-EMGGINVLINNA   87 (262)
T ss_pred             HHHHHHH-HHCCCCEEEECC
T ss_conf             9999999-849998999899


No 427
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004    One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate .  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. .
Probab=92.80  E-value=0.18  Score=30.48  Aligned_cols=143  Identities=19%  Similarity=0.202  Sum_probs=70.5

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEEC-----------------CHHH----HHHHHHHCCCCCC-CCEE-CCC
Q ss_conf             988056981571116889999978985999739-----------------9899----9999971221127-8403-289
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK-----------------DFEL----TDVFIKKISGLSQ-KVIV-TKN   58 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr-----------------~~~~----~~~l~~~~~~~~~-~~~~-~~s   58 (475)
                      ++.+|++||-|-=|...|..|+++||+|+||.-                 .++-    ++.|.+-|-..-- -+.+ .-|
T Consensus       141 t~~kVAViGaGPAGL~cA~elAk~Gh~VtvfEALhKPGGV~~YGIPefRLpKei~~~E~k~LkklGv~fr~~~lvGkt~T  220 (462)
T TIGR01316       141 TKKKVAVIGAGPAGLACASELAKKGHEVTVFEALHKPGGVLAYGIPEFRLPKEIVETEVKKLKKLGVKFRTDYLVGKTVT  220 (462)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCEEEEEEECCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCEECCCHH
T ss_conf             88779998468214688999974798699997148998567536888548757889888876326637994437505112


Q ss_pred             HHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCC
Q ss_conf             89998605778899997699069999999997207899899967986578999999999847994306754676000356
Q gi|254780716|r   59 LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARS  138 (475)
Q Consensus        59 ~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~  138 (475)
                      ++||.+.- .-|-||+-+-+|.+=.--+        ||+-+-  +=-+-.|-..|.+..+....---|.||.=|      
T Consensus       221 L~eL~~~Y-GfDAVFIgtGAG~pkl~Ni--------pG~~L~--gvysA~dfLtR~nLmKAyefp~~dtPv~~g------  283 (462)
T TIGR01316       221 LEELLEKY-GFDAVFIGTGAGLPKLLNI--------PGEELK--GVYSANDFLTRVNLMKAYEFPKKDTPVEVG------  283 (462)
T ss_pred             HHHHHHHC-CCCEEEEEECCCCCEECCC--------CCHHHC--CHHHHHHHHHHHHHHHHHCCCCCCCCEEEC------
T ss_conf             88888751-9707999506898700167--------843434--002234688777776542366788756544------


Q ss_pred             CCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             84378845489998889999987
Q gi|254780716|r  139 GASLMVGGNEKAYNRVENILLSI  161 (475)
Q Consensus       139 G~slMvGG~~~~~~~~~piL~~i  161 (475)
                      ...+.+||---+.+....-|..=
T Consensus       284 K~vvviGgGntAvD~artAlRLG  306 (462)
T TIGR01316       284 KKVVVIGGGNTAVDAARTALRLG  306 (462)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCC
T ss_conf             76899878536787776664528


No 428
>PRK08017 short chain dehydrogenase; Provisional
Probab=92.76  E-value=0.86  Score=25.40  Aligned_cols=79  Identities=16%  Similarity=0.217  Sum_probs=52.1

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             99880569815-71116889999978985999739989999999712211278403289899986057788999976990
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
                      |+| .|=+.|- +-+|..+|+.|+++|++|.+.+|+++..+++.+.+.                      ..+.+-+.+.
T Consensus         1 M~K-~vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~~~~~----------------------~~~~~D~~~~   57 (256)
T PRK08017          1 MQK-SVLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMNSMGF----------------------TGVLIDLDSP   57 (256)
T ss_pred             CCC-EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC----------------------CEEEEECCCH
T ss_conf             997-89996587689999999999879999999699899999985699----------------------4699835898


Q ss_pred             HHHHHHHHHHHHCCC-CCCEEEEC
Q ss_conf             699999999972078-99899967
Q gi|254780716|r   80 DPVDQLIDKLKPLLS-PEDILLDG  102 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~-~g~iiID~  102 (475)
                      +.++..+++++.... .-|++|..
T Consensus        58 ~~~~~~~~~~~~~~~g~id~linn   81 (256)
T PRK08017         58 ESVDRAADEVIALTDNRLYGIFNN   81 (256)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             999999999999848974899988


No 429
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR000706   N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms. In prokaryotes, lower eukaryotes and plants it is the first intermediate in the biosynthesis of arginine, whereas in ureotelic (excreting nitrogen mostly in the form of urea) vertebrates, it is an essential allosteric cofactor for carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle. The pathway that leads from glutamate to arginine in lower organisms employs eight steps, starting with the acetylation of glutamate to form NAG. In these species, NAG can be produced by two enzymatic reactions: one catalysed by NAG synthase (NAGS) and the other by ornithine acetyltransferase (OAT). In ureotelic species, NAG is produced exclusively by NAGS. In lower organisms, NAGS is feedback-inhibited by L-arginine, whereas mammalian NAGS activity is significantly enhanced by this amino acid. The NAGS genes of bacteria, fungi and mammals are more diverse than other arginine-biosynthesis and urea-cycle genes. The evolutionary relationship between the distinctly different roles of NAG and its metabolism in lower and higher organisms remains to be determined .   The pathway from glutamate to arginine is:   NAGS; N-acetylglutamate synthase (2.3.1.1 from EC) (glutamate to N-acetylglutamate) NAGK; N-acetylglutamate kinase (2.7.2.8 from EC) (N-acetylglutamate to N-acetylglutamate-5P) NAGSA; N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (N-acetylglutamate-5P to N-acetylglumate semialdehyde) Acetylornithine aminotransferase (2.6.1.11 from EC) (N-acetylglumate semialdehyde to N-acetylornithine) Acetylornithine deacetylase (3.5.1.16 from EC) (N-acetylornithine to ornithine) Arginase (3.5.3.1 from EC) (ornithine to arginine) N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (AGPR) ,  is the enzyme that catalyzes the third step in the biosynthesis of arginine from glutamate, the NADP-dependent reduction of N-acetyl-5-glutamyl phosphate into N-acetylglutamate 5-semialdehyde. In bacteria it is a monofunctional protein of 35 to 38 kD (gene argC), while in fungi it is part of a bifunctional mitochondrial enzyme (gene ARG5,6, arg11 or arg-6) which contains a N-terminal acetylglutamate kinase (2.7.2.8 from EC) domain and a C-terminal AGPR domain. In the Escherichia coli enzyme, a cysteine has been shown to be implicated in the catalytic activity, and the region around this residue is well conserved.; GO: 0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity, 0006526 arginine biosynthetic process.
Probab=92.73  E-value=0.5  Score=27.15  Aligned_cols=211  Identities=14%  Similarity=0.078  Sum_probs=128.6

Q ss_pred             EEEEEEC-CHHHHHHHHHHHHC-CCEEE-EEECCHH-HHHHHHHHCCCCCCCCE--ECCCHHH--HHHHC-CCCCEEEEE
Q ss_conf             0569815-71116889999978-98599-9739989-99999971221127840--3289899--98605-778899997
Q gi|254780716|r    5 DIGIIGL-GSMGSNLSLNILDK-GFRLA-VYNKDFE-LTDVFIKKISGLSQKVI--VTKNLEQ--MVEAV-CKPRKILMM   75 (475)
Q Consensus         5 ~IGiIGL-G~MG~~mA~nL~~~-G~~V~-vydr~~~-~~~~l~~~~~~~~~~~~--~~~s~~e--~v~~l-~~pr~Iil~   75 (475)
                      +|||||- |=-|..+.|=|..+ ..+|. .+-.+.. .-+.+.+-...+.....  ....+.+  +-+.. +++|+||+.
T Consensus         2 ~V~IvGAsGYtG~EL~RLL~~HP~~e~~~~~ss~~~~aG~~~~~~~P~L~g~~~~~~~~~~~~~~~~~~~L~~~DvVFlA   81 (361)
T TIGR01850         2 KVGIVGASGYTGGELLRLLANHPEVEITYLVSSRESLAGKPLSEVHPHLRGLVDYLNLEPLDDAKLEEIELEDADVVFLA   81 (361)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCEEEEEEEEEEEHHCCCCHHHHCCCHHHHHCCCCCCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             68999334446899999984199537888887620113852577366111010023336667667888621376789986


Q ss_pred             CCCHHHHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHHHHC--CCCEECCCCCCCCCCC-----CCCC-EE-EEE
Q ss_conf             699069999999997-207899899967986578999999999847--9943067546760003-----5684-37-884
Q gi|254780716|r   76 VTDGDPVDQLIDKLK-PLLSPEDILLDGGNSHFCDTQIRSLQLSEK--GIYFIGIGVSGGVKGA-----RSGA-SL-MVG  145 (475)
Q Consensus        76 vp~g~~v~~vi~~l~-~~l~~g~iiID~sts~~~~t~~~~~~l~~k--gi~fid~pVSGG~~gA-----~~G~-sl-MvG  145 (475)
                      +|+|-.     .++. +.+++|-.|||+|=-+.-+....+++.-..  +-..++--|=|=++=-     .++. .+ =+|
T Consensus        82 lPhgvs-----~~~~p~~l~~g~~ViDLSADFRl~d~~~Ye~wYG~h~~~~ll~~avYGLpEl~~~re~i~~A~liAnPG  156 (361)
T TIGR01850        82 LPHGVS-----MELAPELLEAGVKVIDLSADFRLKDPEVYEKWYGFHAAPELLQEAVYGLPELHGAREEIKGARLIANPG  156 (361)
T ss_pred             CCHHHH-----HHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHCCCEEECCC
T ss_conf             872556-----999999984798699888343369979999966778896666311556767010588984295764488


Q ss_pred             CCHH-HHHHHHHHHHHHHCCCCCC-CEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHH
Q ss_conf             5489-9988899999875015678-6189856987467898877678788899989999999964-28997899999986
Q gi|254780716|r  146 GNEK-AYNRVENILLSISAKYQNS-PCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDS-LNKNPLEISHLFSK  222 (475)
Q Consensus       146 G~~~-~~~~~~piL~~iaak~~~~-~cv~y~G~~GsGh~vKMVhNgIey~~mq~iaE~~~~l~~~-~~~~~~~i~~vf~~  222 (475)
                      |=.. +.=.+.|+++.---..... =+-.-.|-+|+|.-.|+-...-|      ..|.+..=+=. .+.+-.||..-..+
T Consensus       157 CYpTA~~LaL~PL~~~~l~~~~~~~i~dakSGvSGAGr~as~~~~~~E------~~en~~pY~~~G~HRH~PEI~q~L~~  230 (361)
T TIGR01850       157 CYPTATLLALAPLLKEGLIDPTSEIIVDAKSGVSGAGRKASEKSHFPE------VNENLRPYKVTGGHRHTPEIEQELGK  230 (361)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCHHH------HHCCCEECCCCCCCCCHHHHHHHHHH
T ss_conf             617899999899998315676776589887445566777763357344------32770620379985027999998767


Q ss_pred             CCCC
Q ss_conf             0688
Q gi|254780716|r  223 WDTG  226 (475)
Q Consensus       223 w~~~  226 (475)
                      |.++
T Consensus       231 ~~~~  234 (361)
T TIGR01850       231 LAGG  234 (361)
T ss_pred             HHCC
T ss_conf             6304


No 430
>PRK06701 short chain dehydrogenase; Provisional
Probab=92.72  E-value=0.87  Score=25.35  Aligned_cols=81  Identities=17%  Similarity=0.202  Sum_probs=51.8

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHH-HHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698--15711168899999789859997399899-99999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFEL-TDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~-~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +.+|  |-.-+|..+|+.|++.|.+|.+.+++.++ .+++.++.......                ...+-.-|.+.+.+
T Consensus        47 valVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G~~----------------~~~~~~Dv~d~~~v  110 (289)
T PRK06701         47 VALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEGVK----------------CLLIPGDVSDEQFC  110 (289)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCE----------------EEEEECCCCCHHHH
T ss_conf             89996825799999999999879989998289467899999999963990----------------89998478999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +++++........=|++|..
T Consensus       111 ~~~v~~~~~~fG~iDiLVNN  130 (289)
T PRK06701        111 KDAVEETVRELGRLDILVNN  130 (289)
T ss_pred             HHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999985999899988


No 431
>KOG2653 consensus
Probab=92.70  E-value=0.71  Score=26.02  Aligned_cols=101  Identities=17%  Similarity=0.209  Sum_probs=54.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCEEEHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHH
Q ss_conf             999999999999999999999996110145667988999985189468537899999998708885-2000798999999
Q gi|254780716|r  321 KDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSS-TNLLNIPSISEKV  399 (475)
Q Consensus       321 ~~L~~a~~~~~i~syaQGf~ll~~as~~y~w~l~l~~ia~iW~~GCIIrs~lL~~i~~~~~~~~~l-~~Ll~~~~~~~~i  399 (475)
                      +.+++.+-..-+-..++...+++..-.-  =+-.+++++.-|..| -+.|-|++-..++|+-..+. .+|+  +.+.+.-
T Consensus       187 KMVHNGIEYGDMqLI~EaY~vlk~~~gl--s~~eia~vF~~WN~g-eleSfLieIT~dIlk~~d~~G~~lv--~kI~D~a  261 (487)
T KOG2653         187 KMVHNGIEYGDMQLICEAYDVLKSVLGL--SNDEIAEVFDDWNKG-ELESFLIEITADILKFKDEDGKPLV--DKILDKA  261 (487)
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHCCC-CHHHHHHHHHHHHHCEECCCCCCHH--HHHHHHH
T ss_conf             4532674311389999999999984586--678899999764333-1668999986887600056787168--9998641


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             9524769999999998399847999999
Q gi|254780716|r  400 KKTIPSLRRIVVTCTENGYPVPSLSAAL  427 (475)
Q Consensus       400 ~~~~~~lr~vv~~~i~~gip~P~lsssL  427 (475)
                      .....+ +|++..+.+.|+|+|.+..|+
T Consensus       262 GqKGTG-kwt~~~Ale~g~Pv~lI~eav  288 (487)
T KOG2653         262 GQKGTG-KWTVISALELGVPVTLIGEAV  288 (487)
T ss_pred             CCCCCC-HHHHHHHHHHCCCHHHHHHHH
T ss_conf             687762-899998998189717999999


No 432
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233   This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , . A separate methylase (MenG/UbiE) catalyses the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase.; GO: 0008425 2-polyprenyl-6-methoxy-14-benzoquinone methyltransferase activity, 0006744 ubiquinone biosynthetic process.
Probab=92.67  E-value=0.88  Score=25.31  Aligned_cols=97  Identities=20%  Similarity=0.195  Sum_probs=67.4

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCCCCCC------CCE-ECCCHHHHHHHC---CCCCEEEE
Q ss_conf             56981571116889999978985-99973998999999971221127------840-328989998605---77889999
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKISGLSQ------KVI-VTKNLEQMVEAV---CKPRKILM   74 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~~~~~------~~~-~~~s~~e~v~~l---~~pr~Iil   74 (475)
                      +=|+=.|==|+=++--|++.|+. |.+-|.+.+.++..........-      .+. -+.|++|+++.-   ..-|+|+.
T Consensus        86 ~~vLDVGCGGGlLsE~lAR~Ga~~V~GID~~~~~i~~Ak~Ha~~~~~~~~~~K~i~Y~~~~~E~l~~~~h~~~~FD~V~~  165 (275)
T TIGR01983        86 LRVLDVGCGGGLLSEPLARLGANKVTGIDASEENIEVAKLHAKKDPLQEALDKKIEYRCTSVEELAEEQHTKKSFDVVTC  165 (275)
T ss_pred             CEEEEECCCHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             77998427857888999755884257752117799999988873340233111145444307887305578415733764


Q ss_pred             E-----CCCHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             7-----6990699999999972078998999679865
Q gi|254780716|r   75 M-----VTDGDPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        75 ~-----vp~g~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
                      |     ||+.   ..++......++||-+++= ||.+
T Consensus       166 mEvlEHV~dp---~~f~~~c~~llkPgG~lF~-STIN  198 (275)
T TIGR01983       166 MEVLEHVPDP---QAFIKACAQLLKPGGILFF-STIN  198 (275)
T ss_pred             EEEEECCCCH---HHHHHHHHHHCCCCCCEEE-ECCC
T ss_conf             3200002788---8999999985089984897-3000


No 433
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent; InterPro: IPR011275   This entry contains bacterial and archaeal malate dehydrogenases, which convert malate into oxaloacetate in the citric acid cycle. The critical residues which discriminate malate dehydrogenase from lactate dehydrogenase have been characterised , and have been used to determine members of this group. ; GO: 0030060 L-malate dehydrogenase activity, 0006108 malate metabolic process.
Probab=92.66  E-value=0.88  Score=25.30  Aligned_cols=102  Identities=18%  Similarity=0.250  Sum_probs=70.7

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC--CEEEEEEC------CHHHHHHHHHHCC--CCCCCCEECCCHHHHHHHCCCCCEEEE
Q ss_conf             0569815711168899999789--85999739------9899999997122--112784032898999860577889999
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG--FRLAVYNK------DFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILM   74 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G--~~V~vydr------~~~~~~~l~~~~~--~~~~~~~~~~s~~e~v~~l~~pr~Iil   74 (475)
                      +|-+||-|..|+-=|-.|+.|-  -+|..-|.      .+-|+=++.+...  ..+.++++.++.+|-++|    ++|.+
T Consensus         3 KisvIGAGfvGaTTAf~lA~KeLard~VLlDiPqvEg~pqGKALDmyEasPv~gFD~kvTGtnnYaDTAnS----DivVi   78 (308)
T TIGR01763         3 KISVIGAGFVGATTAFLLAEKELARDVVLLDIPQVEGVPQGKALDMYEASPVEGFDVKVTGTNNYADTANS----DIVVI   78 (308)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCHHHHHHCCCCCCCCCEEECCCCCHHHCCC----CEEEE
T ss_conf             58997068612589999986740671689850555868886332211027766311236257870021188----37998


Q ss_pred             E---------------CCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             7---------------69906999999999720789989996798657899999
Q gi|254780716|r   75 M---------------VTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIR  113 (475)
Q Consensus        75 ~---------------vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~  113 (475)
                      .               =.+.+.+.+|+.++.++ +|+.|||-.+|  |-|.+-.
T Consensus        79 TaG~pRKPGMsReDL~s~Na~I~R~v~~~i~~~-Spn~iIvvv~N--PlDaMTy  129 (308)
T TIGR01763        79 TAGLPRKPGMSREDLVSVNADIVREVTSRIVEY-SPNAIIVVVSN--PLDAMTY  129 (308)
T ss_pred             CCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHC-CCCCEEEEECC--CHHHHHH
T ss_conf             167887547887899861334689999999731-89968999718--0578999


No 434
>PRK06847 hypothetical protein; Provisional
Probab=92.63  E-value=0.13  Score=31.32  Aligned_cols=37  Identities=22%  Similarity=0.312  Sum_probs=32.4

Q ss_pred             CCC-CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             998-8056981571116889999978985999739989
Q gi|254780716|r    1 MKQ-ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k-~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |.. .+|-|||-|.-|..+|.-|.+.|++|.+|++.++
T Consensus         1 m~~~kkV~IVGaG~aGL~lA~~L~~~Gi~v~V~E~~~~   38 (375)
T PRK06847          1 MGAVKKVLIVGGGIGGMSAAIALRKAGISVDLVEIDPE   38 (375)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             98998799999668999999999967999999908999


No 435
>PRK07069 short chain dehydrogenase; Validated
Probab=92.60  E-value=0.9  Score=25.25  Aligned_cols=78  Identities=14%  Similarity=0.198  Sum_probs=52.2

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHH-HHHHCCCCCCCCEECCCHHHHHHHCCCCC--EEEEECCCHHHHHHHH
Q ss_conf             15711168899999789859997399899999-99712211278403289899986057788--9999769906999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDV-FIKKISGLSQKVIVTKNLEQMVEAVCKPR--KILMMVTDGDPVDQLI   86 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~-l~~~~~~~~~~~~~~~s~~e~v~~l~~pr--~Iil~vp~g~~v~~vi   86 (475)
                      |-+-+|..+|+.|++.|.+|.+.||+.++..+ +.++....                .....  .+-.-|.+.+.++.++
T Consensus         7 gs~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~----------------~~~~~~~~~~~Dv~~~~~v~~~v   70 (251)
T PRK07069          7 AAGGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAA----------------HGEGVAFAAVQDVTDEAQWQALL   70 (251)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHC----------------CCCCEEEEEECCCCCHHHHHHHH
T ss_conf             57889999999999869999999689435899999999861----------------59963999957799999999999


Q ss_pred             HHHHHCCCCCCEEEECC
Q ss_conf             99972078998999679
Q gi|254780716|r   87 DKLKPLLSPEDILLDGG  103 (475)
Q Consensus        87 ~~l~~~l~~g~iiID~s  103 (475)
                      +.....+..=|++|...
T Consensus        71 ~~~~~~~G~iDilVNnA   87 (251)
T PRK07069         71 AQAADAMGGLSVLVNNA   87 (251)
T ss_pred             HHHHHHCCCCCEEEECC
T ss_conf             99999829998999899


No 436
>PRK08177 short chain dehydrogenase; Provisional
Probab=92.60  E-value=0.9  Score=25.24  Aligned_cols=39  Identities=18%  Similarity=0.308  Sum_probs=30.3

Q ss_pred             EEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
Q ss_conf             569815-711168899999789859997399899999997
Q gi|254780716|r    6 IGIIGL-GSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK   44 (475)
Q Consensus         6 IGiIGL-G~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~   44 (475)
                      +=+.|- .=+|..+|+.|+++|++|.+..|++++.+.+.+
T Consensus         4 ~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~   43 (225)
T PRK08177          4 ALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQA   43 (225)
T ss_pred             EEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             9992734299999999999886999999798877899872


No 437
>KOG1201 consensus
Probab=92.59  E-value=0.9  Score=25.23  Aligned_cols=39  Identities=23%  Similarity=0.467  Sum_probs=29.0

Q ss_pred             EEECC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
Q ss_conf             98157-1116889999978985999739989999999712
Q gi|254780716|r    8 IIGLG-SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKI   46 (475)
Q Consensus         8 iIGLG-~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~   46 (475)
                      +-|-| -+|+.||+.+++.|..+.+||++++-.++.+++.
T Consensus        43 ITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~   82 (300)
T KOG1201          43 ITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEI   82 (300)
T ss_pred             EECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHH
T ss_conf             9689860789999999970784899955651239999999


No 438
>PRK05442 malate dehydrogenase; Provisional
Probab=92.59  E-value=0.9  Score=25.23  Aligned_cols=109  Identities=17%  Similarity=0.157  Sum_probs=61.2

Q ss_pred             CCCC-EEEEEE-CCHHHHHHHHHHHHCC-------CEEEEEECCHHH--HHH----HHHHCCCCCCCCEECCCHHHHHHH
Q ss_conf             9988-056981-5711168899999789-------859997399899--999----997122112784032898999860
Q gi|254780716|r    1 MKQA-DIGIIG-LGSMGSNLSLNILDKG-------FRLAVYNKDFEL--TDV----FIKKISGLSQKVIVTKNLEQMVEA   65 (475)
Q Consensus         1 M~k~-~IGiIG-LG~MG~~mA~nL~~~G-------~~V~vydr~~~~--~~~----l~~~~~~~~~~~~~~~s~~e~v~~   65 (475)
                      |+++ +|.++| -|..|++++.+|+...       ..++.||..+..  .+-    +.+-.-....++....++.+.   
T Consensus         1 m~~p~kV~I~GAaG~ig~~l~~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~ameL~d~a~p~l~~v~~~~~~~~a---   77 (325)
T PRK05442          1 MKAPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEIPQAQKALKGVVMELEDCAFPLLAGVVITDDPKVA---   77 (325)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEHHCCCCCCCCCEEEECCHHHH---
T ss_conf             99972999988886888999999866132089984699996577766655667734211675444876850887898---


Q ss_pred             CCCCCEEEEEC--C-------------CHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             57788999976--9-------------9069999999997207899899967986578999999
Q gi|254780716|r   66 VCKPRKILMMV--T-------------DGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS  114 (475)
Q Consensus        66 l~~pr~Iil~v--p-------------~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~  114 (475)
                      ++..++|++.-  |             +.+.+.++...+..+..++-.++-.||  |-|+.-..
T Consensus        78 ~~~aDvviitag~prkPGmtR~DLl~~Na~I~~~~~~~i~~~a~~~~~vlVv~N--Pvd~~~~v  139 (325)
T PRK05442         78 FKDADVALLVGARPRGPGMERKDLLKANGEIFTAQGKALNEVAARDVKVLVVGN--PANTNALI  139 (325)
T ss_pred             HCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECC--CHHHHHHH
T ss_conf             379988998078679999748999976088999999999865798718999578--15879999


No 439
>PRK11728 hypothetical protein; Provisional
Probab=92.55  E-value=0.096  Score=32.42  Aligned_cols=36  Identities=33%  Similarity=0.521  Sum_probs=31.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--CCEEEEEECCHH
Q ss_conf             9988056981571116889999978--985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--GFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--G~~V~vydr~~~   37 (475)
                      |. -+|-+||-|.+|..+|+.|++.  +.+|.+.++...
T Consensus         1 m~-yDvvIIGgGIvG~siA~~Ls~~~~~~~V~vlEke~~   38 (400)
T PRK11728          1 MM-YDFVIIGGGIVGLSTAMQLQDRYPGARIALLEKESG   38 (400)
T ss_pred             CC-CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             95-309999967999999999995599983999968999


No 440
>TIGR02992 ectoine_eutC ectoine utilization protein EutC; InterPro: IPR014334   Members of this entry are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, Pseudomonas putida and Sinorhizobium meliloti 1021, where it is known to be induced by ectoine). Members belong to the ornithine cyclodeaminase/mu-crystallin family..
Probab=92.53  E-value=0.24  Score=29.52  Aligned_cols=92  Identities=15%  Similarity=0.221  Sum_probs=66.5

Q ss_pred             EEEEEECCHHHHH--HHHHHHHCCCEEEEEECCHHHHHHHHHHCC-CCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHH
Q ss_conf             0569815711168--899999789859997399899999997122-1127840328989998605778899997699069
Q gi|254780716|r    5 DIGIIGLGSMGSN--LSLNILDKGFRLAVYNKDFELTDVFIKKIS-GLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~--mA~nL~~~G~~V~vydr~~~~~~~l~~~~~-~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~   81 (475)
                      .+.++|-|.--.=  -|+-|.+.=-++.+|=|+..|.+.+..... ..+-.++..+++.+.++   ..++|++|-|+..|
T Consensus       131 ~~a~~GAG~QArLQL~AL~LvRdI~~ariWAR~~akAe~~A~~L~~~~G~~v~a~td~~~A~~---~ADI~vTtTP~~~P  207 (326)
T TIGR02992       131 VVAILGAGMQARLQLEALTLVRDIRSARIWARDSAKAEALALQLSSELGIDVTAATDVRAALS---GADIIVTTTPSETP  207 (326)
T ss_pred             HHHHHCCCHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHCCEEEEECCCHHHHCC---CCCEEEECCCCCCC
T ss_conf             776752556789999998631521443210255678999999988746906875047686236---68879874879873


Q ss_pred             HHHHHHHHHHCCCCCCEEEECCC
Q ss_conf             99999999720789989996798
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDGGN  104 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~st  104 (475)
                      |.     ...+|+||..|+=||.
T Consensus       208 vl-----~a~wL~pGqh~tAMGs  225 (326)
T TIGR02992       208 VL-----KAEWLEPGQHVTAMGS  225 (326)
T ss_pred             CH-----HHHHCCCCCEEEEECC
T ss_conf             02-----0733678878986067


No 441
>KOG3007 consensus
Probab=92.47  E-value=0.82  Score=25.53  Aligned_cols=113  Identities=16%  Similarity=0.092  Sum_probs=70.1

Q ss_pred             EEEEECCHHHHHHHHHHHHC---CCEEEEEECCHHHHHHHHHHCCCCCCCC----EECCCHHHHHHHCCCCCEEEEECCC
Q ss_conf             56981571116889999978---9859997399899999997122112784----0328989998605778899997699
Q gi|254780716|r    6 IGIIGLGSMGSNLSLNILDK---GFRLAVYNKDFELTDVFIKKISGLSQKV----IVTKNLEQMVEAVCKPRKILMMVTD   78 (475)
Q Consensus         6 IGiIGLG~MG~~mA~nL~~~---G~~V~vydr~~~~~~~l~~~~~~~~~~~----~~~~s~~e~v~~l~~pr~Iil~vp~   78 (475)
                      .-++|-|......-.-..+.   =-+|.+|||+++.++++.+...+...++    ..+.++++.|.   ..++|+.+.++
T Consensus       141 L~i~GsG~qA~~hi~ih~~~~pslreVrIwnht~e~A~~la~~lsk~~~~iqie~~~~qsl~~aV~---~sDIIs~atls  217 (333)
T KOG3007         141 LTIFGSGLQAFWHIYIHIKLIPSLREVRIWNHTNEMALDLAKSLSKLFSNIQIELNQYQSLNGAVS---NSDIISGATLS  217 (333)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEEHHHHHCCCC---CCCEEEECCCC
T ss_conf             999736630489999999760443389864278078999999764146641788773001314554---67547730356


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             0699999999972078998999679865789999999998479943067
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      .++.-     ....++|| .-||.--++-.+..+...+|-+.+.-|+|.
T Consensus       218 tePil-----fgewlkpg-thIdlVGsf~p~mhEcDdelIq~a~vfVDs  260 (333)
T KOG3007         218 TEPIL-----FGEWLKPG-THIDLVGSFKPVMHECDDELIQSACVFVDS  260 (333)
T ss_pred             CCCEE-----EEEEECCC-CEEEEECCCCCHHHHHHHHHHHHHEEEEEC
T ss_conf             78613-----22340687-407640467701777749986533288836


No 442
>PRK11036 putative metallothionein SmtA; Provisional
Probab=92.46  E-value=0.94  Score=25.12  Aligned_cols=145  Identities=12%  Similarity=0.140  Sum_probs=77.8

Q ss_pred             EEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCC--CCCCCEE-CCCHHHHHHHCCCC-CEEEEE-----CCC
Q ss_conf             98157111688999997898599973998999999971221--1278403-28989998605778-899997-----699
Q gi|254780716|r    8 IIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISG--LSQKVIV-TKNLEQMVEAVCKP-RKILMM-----VTD   78 (475)
Q Consensus         8 iIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~--~~~~~~~-~~s~~e~v~~l~~p-r~Iil~-----vp~   78 (475)
                      +.=.|-=+..||..|++.|+.|++.|.+++-.+...+..+.  ...++.. ..+..++...++.+ ++|+..     |++
T Consensus        48 VLDvG~G~G~~a~~lA~~Gh~Vt~~D~S~~mL~~A~~~a~~~gv~~~~~~v~~~~q~l~~~~~~~fDlVlcHaVLE~v~d  127 (256)
T PRK11036         48 VLDAGGGEGQTAIKMAELGHQVTLCDLSAEMIQRAKQAAEAKGVSDNMQFIHCAAQDIAQHLETPVDLILFHAVLEWVAD  127 (256)
T ss_pred             EEEECCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHCCCCCCEEEEEHHHHHCCC
T ss_conf             99837987798999997799799866999999999999886496612798856899885423688667865136772378


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHH
Q ss_conf             06999999999720789989996798657899999999984799430675467600035684378845489998889999
Q gi|254780716|r   79 GDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENIL  158 (475)
Q Consensus        79 g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL  158 (475)
                      +.+   ++..+...++||-++=-+--..  +.....+.+.. +..++..+.-..     ++.++.+.-+. .-+.+...+
T Consensus       128 P~~---~l~~l~~~lkPGG~lSLmfyN~--~alv~~n~l~G-nf~~a~~~~~~~-----~~~~LtP~~p~-~p~~V~~~l  195 (256)
T PRK11036        128 PKS---VLQTLWSVLRPGGALSLMFYNA--NGLLMHNMVAG-NFDYVQAGMPKR-----KKRTLSPQYPR-DPAQVYQWL  195 (256)
T ss_pred             HHH---HHHHHHHHHCCCCEEEEEECCH--HHHHHHHHHHC-CHHHHHHHCCCC-----CCCCCCCCCCC-CHHHHHHHH
T ss_conf             999---9999999758993799984285--16999999825-899997306344-----55216899999-999999999


Q ss_pred             HHHHCC
Q ss_conf             987501
Q gi|254780716|r  159 LSISAK  164 (475)
Q Consensus       159 ~~iaak  164 (475)
                      +..+-+
T Consensus       196 ~~~g~~  201 (256)
T PRK11036        196 EEAGWQ  201 (256)
T ss_pred             HHCCCE
T ss_conf             977982


No 443
>pfam04016 DUF364 Domain of unknown function (DUF364). Archaeal domain of unknown function.
Probab=92.46  E-value=0.94  Score=25.12  Aligned_cols=104  Identities=14%  Similarity=0.168  Sum_probs=63.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             80569815711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      .+|++||-  |+ |++..|.++|.++.+++|++...+.        .+...   ...+--.-++.++++++  +....++
T Consensus       112 ~kV~vVG~--f~-P~~~~l~~~~~~~~V~Er~~~~~~~--------~~~~~---p~~~~~~lLp~~D~viI--TgstlvN  175 (229)
T pfam04016       112 KKVVVVGY--FA-PVLKRLRERGAEVTVLERNPRLLDP--------AEGDL---PDEAAEELLPEADVVII--TGSTLVN  175 (229)
T ss_pred             CEEEEECC--CH-HHHHHHHHCCCCEEEEECCCCCCCC--------CCCCC---CHHHHHHHCCCCCEEEE--EECHHHC
T ss_conf             98999857--75-8899998648967999668755788--------78888---97898875124889999--8403541


Q ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECC
Q ss_conf             99999972078998999679865789999999998479943067
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~  127 (475)
                      ..++.|+...+++..+|-.|-|.+-.    -+.+...|+.++.-
T Consensus       176 ~Tl~~lL~~~~~~~~vvl~GPS~p~~----P~~l~~~Gv~~lag  215 (229)
T pfam04016       176 GTLERLLALARKAAEVVLVGPSAPLL----PEALFGYGVDVLAG  215 (229)
T ss_pred             CCHHHHHHHCCCCCEEEEECCCCCCC----HHHHHHCCCCEEEE
T ss_conf             89899997476587799989986357----78996389767867


No 444
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]
Probab=92.44  E-value=0.94  Score=25.11  Aligned_cols=90  Identities=17%  Similarity=0.155  Sum_probs=60.5

Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCC-EECCCHHHHHHHCCCCCEEEEE-----CCCHHHHHH
Q ss_conf             5711168899999789859997399899999997122112784-0328989998605778899997-----699069999
Q gi|254780716|r   11 LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKV-IVTKNLEQMVEAVCKPRKILMM-----VTDGDPVDQ   84 (475)
Q Consensus        11 LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~-~~~~s~~e~v~~l~~pr~Iil~-----vp~g~~v~~   84 (475)
                      .|-=|..++..+++.|..|.+-|.+++.++-...+.....-.+ ..+.+.+|+...-.+-++|+.|     ||+.   ++
T Consensus        66 vGCGgG~Lse~mAr~Ga~VtgiD~se~~I~~Ak~ha~e~gv~i~y~~~~~edl~~~~~~FDvV~cmEVlEHv~dp---~~  142 (243)
T COG2227          66 VGCGGGILSEPLARLGASVTGIDASEKPIEVAKLHALESGVNIDYRQATVEDLASAGGQFDVVTCMEVLEHVPDP---ES  142 (243)
T ss_pred             ECCCCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCEEEEHHHHHCCCCH---HH
T ss_conf             458832864999977994697438767789998754424632252233299997248974489773587716999---99


Q ss_pred             HHHHHHHCCCCCCEEEECC
Q ss_conf             9999972078998999679
Q gi|254780716|r   85 LIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        85 vi~~l~~~l~~g~iiID~s  103 (475)
                      ++......++||-++...+
T Consensus       143 ~~~~c~~lvkP~G~lf~ST  161 (243)
T COG2227         143 FLRACAKLVKPGGILFLST  161 (243)
T ss_pred             HHHHHHHHCCCCCEEEEEC
T ss_conf             9999998629992899942


No 445
>PRK06196 oxidoreductase; Provisional
Probab=92.40  E-value=0.95  Score=25.07  Aligned_cols=69  Identities=13%  Similarity=0.164  Sum_probs=46.1

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             11168899999789859997399899999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   13 SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        13 ~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
                      =+|...|+.|++.|.+|++-.|++++.++.+++-.                    +..++-+-+.+-+.|.+..+++...
T Consensus        37 GIG~~tA~~La~~Ga~Vil~~R~~~k~~~a~~~i~--------------------~~~~~~lDLs~~~sVr~~a~~~~~~   96 (316)
T PRK06196         37 GLGLETTRALAQAGAHVVVPARRPDAAREALAGID--------------------GVEVVALDLADLASVRAFAERFLDS   96 (316)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--------------------CCCEEECCCCCHHHHHHHHHHHHHH
T ss_conf             79999999999789989999499999999998741--------------------7857983688999999999999975


Q ss_pred             CCCCCEEEE
Q ss_conf             789989996
Q gi|254780716|r   93 LSPEDILLD  101 (475)
Q Consensus        93 l~~g~iiID  101 (475)
                      ..+=|++|.
T Consensus        97 ~~~lDvLIn  105 (316)
T PRK06196         97 GRRIDILIN  105 (316)
T ss_pred             CCCCEEEEE
T ss_conf             798329995


No 446
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of some bacterial LDHs from firmicutes, gammaproteobacteria, and actinobacteria. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenase, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=92.38  E-value=0.95  Score=25.06  Aligned_cols=68  Identities=16%  Similarity=0.265  Sum_probs=43.4

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHH---CCCC--CCCC-EECCCHHHHHHHCCCCCEEEEEC
Q ss_conf             05698157111688999997898--599973998999999971---2211--2784-03289899986057788999976
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGF--RLAVYNKDFELTDVFIKK---ISGL--SQKV-IVTKNLEQMVEAVCKPRKILMMV   76 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~--~V~vydr~~~~~~~l~~~---~~~~--~~~~-~~~~s~~e~v~~l~~pr~Iil~v   76 (475)
                      +|++||.|..|.++|..|+.+|.  ++..||+++++++..+..   ....  .... ....+.++    +...++|+++.
T Consensus         1 KI~IIGaG~VG~~~A~~l~~~~~~~elvL~Di~~~~a~g~a~Dl~h~~~~~~~~~~~~~~~~y~~----~~~aDiVVita   76 (307)
T cd05290           1 KLVVIGAGHVGSAVLNYALALGLFSEIVLIDVNEGVAEGEALDFHHATALTYSTNTKIRAGDYDD----CADADIIVITA   76 (307)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCEEECCCCHHH----HCCCCEEEECC
T ss_conf             98999969899999999985699887999928898237999987612035899865866799899----46999999867


No 447
>PRK08628 short chain dehydrogenase; Provisional
Probab=92.38  E-value=0.96  Score=25.05  Aligned_cols=81  Identities=15%  Similarity=0.307  Sum_probs=52.4

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|..|.+++|+.+..+ ..++......                +...+-.-|.+.+.++
T Consensus         9 valVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~~~-~~~~~~~~~~----------------~~~~~~~Dvs~~~~v~   71 (258)
T PRK08628          9 VVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPDDE-FAEELRALQP----------------RAEFVQVDLQDDAQCR   71 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHH-HHHHHHHCCC----------------CEEEEEEECCCHHHHH
T ss_conf             8999277778999999999987998999808802399-9999995399----------------7899995279999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++++.....+=|++|...
T Consensus        72 ~~v~~~~~~~g~iDiLVnnA   91 (258)
T PRK08628         72 DAVAQTVAKFGRIDGLVNNA   91 (258)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999829988999888


No 448
>PRK06444 prephenate dehydrogenase; Provisional
Probab=92.37  E-value=0.96  Score=25.04  Aligned_cols=103  Identities=14%  Similarity=0.157  Sum_probs=67.1

Q ss_pred             EEE-ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHH
Q ss_conf             698-1571116889999978985999739989999999712211278403289899986057788999976990699999
Q gi|254780716|r    7 GII-GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQL   85 (475)
Q Consensus         7 GiI-GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~v   85 (475)
                      ++| |.|.||+=++.=|..+|+.|++-                                   +.++|+++||=. +..++
T Consensus         4 ~iig~~gr~g~~~~~~~~~~g~~v~i~-----------------------------------k~D~ifiaVPI~-~~~~i   47 (197)
T PRK06444          4 IIIGKNGRLGRVLCSILDDNGLGVYIK-----------------------------------KADHAFLSVPID-AALNY   47 (197)
T ss_pred             EEECCCCCHHHHHHHHHCCCCCEEEEC-----------------------------------CCCEEEEEEEHH-HHHHH
T ss_conf             996378716689999970378478972-----------------------------------788899982458-88999


Q ss_pred             HHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCC--CC-EEEE--ECCHHHHHHHHHHHH
Q ss_conf             99997207899899967986578999999999847994306754676000356--84-3788--454899988899999
Q gi|254780716|r   86 IDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARS--GA-SLMV--GGNEKAYNRVENILL  159 (475)
Q Consensus        86 i~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~--G~-slMv--GG~~~~~~~~~piL~  159 (475)
                      ++      ++|.++||.+..-+.        .++.+...+..----||.....  +. .+|+  =+.++.++..+.+|+
T Consensus        48 I~------~~~~tiiDv~SVK~p--------~k~~~~~IIs~HPMFGPdS~~~~~~~~vi~v~d~~~~~~~~~~k~lF~  112 (197)
T PRK06444         48 IE------SYDNNFVEISSVKWP--------FKKYSGKIVSIHPLFGPMSYNDGVHRTVIFINDISRDNYLNEINEMFR  112 (197)
T ss_pred             HH------HCCCEEEEEEECCCH--------HHHHCCCEEEECCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHC
T ss_conf             98------479738998863311--------777079879879987988531247876999725887779999999828


No 449
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR010110   This entry represents a clade of shikimate-5-dehydrogenases found in Corynebacterium, Mycobacteria and fungi. The fungal sequences are pentafunctional proteins known as AroM which contain the central five seven steps in the chorismate biosynthesis pathway. The Corynebacterium and Mycobacterial sequences represent the sole shikimate-5-dehydrogenases in species which otherwise have every enzyme of the chorismate biosynthesis pathway.; GO: 0004764 shikimate 5-dehydrogenase activity, 0005737 cytoplasm.
Probab=92.32  E-value=0.42  Score=27.67  Aligned_cols=86  Identities=17%  Similarity=0.263  Sum_probs=54.6

Q ss_pred             EEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCCCCCCCCEECCCHH-HH-HHHCCCCCEEEEECCCHHHHHH
Q ss_conf             98157111688999997898-599973998999999971221127840328989-99-8605778899997699069999
Q gi|254780716|r    8 IIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE-QM-VEAVCKPRKILMMVTDGDPVDQ   84 (475)
Q Consensus         8 iIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~-e~-v~~l~~pr~Iil~vp~g~~v~~   84 (475)
                      +||-|=--.+=.--|++-|. ++++-||+++|.++|++-+.... .+...+.+. +. ...++..++.+.|||++.+.|.
T Consensus       135 viGaGGtsrAA~yaL~sLG~~~I~~inR~~dKl~~L~~~~~~~~-~i~~~e~l~~~~~~i~v~~~~v~vStvPaD~p~d~  213 (291)
T TIGR01809       135 VIGAGGTSRAAVYALASLGVKDIYVINRSKDKLKKLVDLLVSEF-VIIRLESLDKELEEIEVKDVEVAVSTVPADKPLDD  213 (291)
T ss_pred             EECCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCEEEEEEEEEEECCCCCCCCH
T ss_conf             88387214899999986699706997358667668877413561-35665101334110202456788861578864688


Q ss_pred             HH-HHHHHCCC
Q ss_conf             99-99972078
Q gi|254780716|r   85 LI-DKLKPLLS   94 (475)
Q Consensus        85 vi-~~l~~~l~   94 (475)
                      +. +.+.+.|-
T Consensus       214 ~~l~~~~~fl~  224 (291)
T TIGR01809       214 EVLEALKRFLL  224 (291)
T ss_pred             HHHHHHHHHHH
T ss_conf             89999989875


No 450
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=92.25  E-value=0.23  Score=29.55  Aligned_cols=34  Identities=15%  Similarity=0.366  Sum_probs=31.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      .+|++||-|.-|..-|..|+++||+|.+|++.+.
T Consensus       138 kkVAVIGaGPAGLsaA~~La~~G~~VtVfE~~~~  171 (560)
T PRK12771        138 KRVAVIGGGPAGLSAAYQLRRLGHAVTIFEAGPK  171 (560)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             9899989778999999999976985899676788


No 451
>PRK13984 putative oxidoreductase; Provisional
Probab=92.22  E-value=0.21  Score=29.84  Aligned_cols=34  Identities=21%  Similarity=0.437  Sum_probs=31.3

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      .+|++||-|--|..-|..|++.||+|.||++.+.
T Consensus       284 KKVAVIGsGPAGLaaA~~Lar~Gh~VtVFE~~~~  317 (604)
T PRK13984        284 KKVAIVGSGPAGLSAAYFLATMGYEVEVYESLSK  317 (604)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             9899989868999999999986986899745677


No 452
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=92.18  E-value=1  Score=24.89  Aligned_cols=71  Identities=23%  Similarity=0.308  Sum_probs=43.7

Q ss_pred             CCCCEEEEEE-CCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHCCCC--CCCCEECCCHHHHHH-HCCCCCEEEEE
Q ss_conf             9988056981-57111688999997-8985999739989999999712211--278403289899986-05778899997
Q gi|254780716|r    1 MKQADIGIIG-LGSMGSNLSLNILD-KGFRLAVYNKDFELTDVFIKKISGL--SQKVIVTKNLEQMVE-AVCKPRKILMM   75 (475)
Q Consensus         1 M~k~~IGiIG-LG~MG~~mA~nL~~-~G~~V~vydr~~~~~~~l~~~~~~~--~~~~~~~~s~~e~v~-~l~~pr~Iil~   75 (475)
                      |+|  |=+.| .|-.|++++..|++ .+++|.+.|+..++.+.+.....-.  ...+  ..+ .++++ .+.++++|+=+
T Consensus         1 MKk--ILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~gDi--~~~-~~~~~~~~~~~D~V~Hl   75 (347)
T PRK11908          1 MKK--VLILGVNGFIGHHLTKRILETTDWEVYGMDMQTDRLGDLVNHPRMHFFEGDI--TIN-KEWIEYHVKKCDVVLPL   75 (347)
T ss_pred             CCE--EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEECCC--CCC-HHHHHHHHCCCCEEEEE
T ss_conf             988--9997574389999999999828978999979976367755799859997754--469-99999766059889752


Q ss_pred             C
Q ss_conf             6
Q gi|254780716|r   76 V   76 (475)
Q Consensus        76 v   76 (475)
                      -
T Consensus        76 A   76 (347)
T PRK11908         76 V   76 (347)
T ss_pred             H
T ss_conf             0


No 453
>PRK06475 salicylate hydroxylase; Provisional
Probab=92.17  E-value=0.19  Score=30.30  Aligned_cols=36  Identities=25%  Similarity=0.456  Sum_probs=32.8

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             988056981571116889999978985999739989
Q gi|254780716|r    2 KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         2 ~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      ++.+|-|||-|.-|..+|.-|.++|++|.+|++.++
T Consensus         1 tr~~VlIVGaGiaGL~~A~~L~~~G~~v~V~E~~~~   36 (400)
T PRK06475          1 TRGSILIAGAGVAGLSAALELAARGWAVTIIEKAQE   36 (400)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             999799989588999999999978999999917998


No 454
>PRK07208 hypothetical protein; Provisional
Probab=92.12  E-value=0.26  Score=29.26  Aligned_cols=187  Identities=16%  Similarity=0.166  Sum_probs=89.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             99880569815711168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      |.|.+|-|||-|.-|...|..|.++|++|.|++++..-       | +...+.    +.+.+.=. -.|.+++   ...+
T Consensus         1 ~~~kkv~IiGAG~~GL~aA~~L~~~g~~v~vlEk~~~v-------G-Gl~~t~----~~~G~~~d-~G~H~f~---s~~~   64 (474)
T PRK07208          1 TEKKSVVIIGAGPAGLTAAYELVKRGYPVTILEADPEV-------G-GISRTV----TYKGYRFD-IGGHRFF---TKSE   64 (474)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCC-------C-CEEEEE----EECCEEEE-ECCCEEC---CCCH
T ss_conf             99875999897689999999998689975999789987-------5-447788----98998998-4780548---8975


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             99999999972078998999679865789999999998479943067546760003568437884548999888999998
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLS  160 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~slMvGG~~~~~~~~~piL~~  160 (475)
                      .+.+.++++++    ++-++...        |. ...- .+-.|++-|++....  ...    . |..+....+..++.+
T Consensus        65 ~v~~~~~~ll~----~~~~~~~~--------r~-s~i~-~~g~~~~yP~~~~~~--l~~----l-~~~~~~~~~~~~~~~  123 (474)
T PRK07208         65 EVMDLWNEILP----DDDFLLRP--------RL-SRIY-YRGKFFDYPLKAFDA--LKN----L-GLKESALCVASYLKA  123 (474)
T ss_pred             HHHHHHHHHCC----CCEEEECC--------CC-EEEE-ECCEEEECCCCHHHH--HHH----C-CHHHHHHHHHHHHHH
T ss_conf             99999998528----77179713--------63-6999-999899249895788--642----7-862789999999875


Q ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHH---HHHHHHH--HHHHHCCCCHHHHHHHHHHCCCCCC-CHHHHH
Q ss_conf             750156786189856987467898877678788899---9899999--9996428997899999986068844-307999
Q gi|254780716|r  161 ISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQ---LIADIYG--ILRDSLNKNPLEISHLFSKWDTGKL-SSYLIK  234 (475)
Q Consensus       161 iaak~~~~~cv~y~G~~GsGh~vKMVhNgIey~~mq---~iaE~~~--~l~~~~~~~~~~i~~vf~~w~~~~~-~syLl~  234 (475)
                      -..+..        -+.          |-=|+...+   -++|.|.  +.++.-+.++++|+.-   |-..-+ ..-|.+
T Consensus       124 ~~~~~~--------~~~----------nfee~~~~~fG~~l~~~f~~pYt~K~Wg~~~~eLs~~---wa~~Rv~~~~l~~  182 (474)
T PRK07208        124 RLRPIK--------EEK----------SFEDWVINRFGRRLYSIFFKTYTEKVWGIPCDEISAD---WAAQRIKGLSLGK  182 (474)
T ss_pred             HHCCCC--------CCC----------CHHHHHHHHHCHHHHHHHHHHHHHCHHCCCHHHCCHH---HHHHHCCCCCHHH
T ss_conf             304888--------877----------9999999976889999999875212206894776968---8832225789899


Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999974056
Q gi|254780716|r  235 ITAEILSSSDT  245 (475)
Q Consensus       235 i~~~il~~k~~  245 (475)
                      +....+..+++
T Consensus       183 ~i~~~~~~~~~  193 (474)
T PRK07208        183 AIRRALRPKNN  193 (474)
T ss_pred             HHHHHHCCCCC
T ss_conf             99873254445


No 455
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=92.01  E-value=1  Score=24.75  Aligned_cols=21  Identities=10%  Similarity=0.150  Sum_probs=13.6

Q ss_pred             CCCCCCHHHHHHHHHHHHCCC
Q ss_conf             336587167789887751788
Q gi|254780716|r  258 KASQKGTGIRSIIEGHKLSSS  278 (475)
Q Consensus       258 ~~~~kgTg~Wt~~~a~~lgvp  278 (475)
                      ..+.-+.|.+++|.|-.+|..
T Consensus       172 V~G~G~iGl~a~~~ak~~Ga~  192 (349)
T TIGR03201       172 VIGAGGVGGYMVQTAKAMGAA  192 (349)
T ss_pred             EECCCHHHHHHHHHHHHCCCE
T ss_conf             989748999999999985997


No 456
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=91.95  E-value=1.1  Score=24.70  Aligned_cols=19  Identities=16%  Similarity=0.344  Sum_probs=13.5

Q ss_pred             CCCCHHHHHHHHHHHHCCC
Q ss_conf             6587167789887751788
Q gi|254780716|r  260 SQKGTGIRSIIEGHKLSSS  278 (475)
Q Consensus       260 ~~kgTg~Wt~~~a~~lgvp  278 (475)
                      ..-|.|..++|-|-.+|.-
T Consensus       171 a~G~vG~~aiqlak~~Ga~  189 (332)
T PRK13771        171 AGGGVGIHAVQVAKAYGAK  189 (332)
T ss_pred             CCCHHHHHHHHHHHHCCCE
T ss_conf             8775899999999986998


No 457
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=91.86  E-value=1.1  Score=24.64  Aligned_cols=135  Identities=15%  Similarity=0.217  Sum_probs=81.3

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCC--CCCEE-CCCHHHHHHHC-CCCCEEEEECCCHHHHHHH
Q ss_conf             15711168899999789859997399899999997122112--78403-28989998605-7788999976990699999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLS--QKVIV-TKNLEQMVEAV-CKPRKILMMVTDGDPVDQL   85 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~--~~~~~-~~s~~e~v~~l-~~pr~Iil~vp~g~~v~~v   85 (475)
                      |-|.++--+|+.. ..+-.|+..+++++..+-..++....+  .++.. ..+.-+....+ +.|+.||+-=. +...+++
T Consensus        50 GsGsvsiEaa~~~-~~~~~V~aIE~~~e~~~~~~~N~~kfg~~~nv~~i~G~ap~~l~~l~p~pD~vFIGG~-~g~l~~i  127 (198)
T PRK00377         50 GTGSVSVEAALIV-GEGGKVYAIDKDELAVELTKKNAEKFGVGDNVVLIEGEAPEVLPKLNPKSDRYFIGGG-GEELPEI  127 (198)
T ss_pred             CEEHHHHHHHHHC-CCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHCCCCCCCEEEEECC-CCCHHHH
T ss_conf             0329999999966-9787599996788899999999998099988599952548877208998898999788-7778999


Q ss_pred             HHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHCCC--CEECCCCCCCCC------CCCCCCEEEEECCH
Q ss_conf             999972078998-9996798657899999999984799--430675467600------03568437884548
Q gi|254780716|r   86 IDKLKPLLSPED-ILLDGGNSHFCDTQIRSLQLSEKGI--YFIGIGVSGGVK------GARSGASLMVGGNE  148 (475)
Q Consensus        86 i~~l~~~l~~g~-iiID~sts~~~~t~~~~~~l~~kgi--~fid~pVSGG~~------gA~~G~slMvGG~~  148 (475)
                      ++.+...|.+|. +|+..  ...+...+..+.+++.|.  ..+-.-||-+..      -.-.-|-+++.|.+
T Consensus       128 l~~~~~~L~~gGriVina--Vtlet~~~~~~~l~~~~~~~ev~qv~vsr~~~lg~~~~~~~~NPV~ii~~~K  197 (198)
T PRK00377        128 IQAALEKIGKGGRIVADA--ILLESLNKALSALEELGYKYEVTEVIIAKGMKTGKGTAMIARNPIFIITGEK  197 (198)
T ss_pred             HHHHHHHCCCCCEEEEEE--ECHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEECCCCEEEEEEEC
T ss_conf             999998579998999983--6298899999999976998149999946473257876660689979999978


No 458
>PRK12810 gltD glutamate synthase subunit beta; Reviewed
Probab=91.83  E-value=0.3  Score=28.79  Aligned_cols=33  Identities=18%  Similarity=0.469  Sum_probs=30.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      .+|++||-|-=|..-|..|++.||+|.+|++.+
T Consensus       144 kkVAVIGsGPAGLsaA~~Lar~G~~VtVfE~~~  176 (472)
T PRK12810        144 KKVAVVGSGPAGLAAADQLARAGHKVTVFERDD  176 (472)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             989998977899999999986697589972577


No 459
>pfam00743 FMO-like Flavin-binding monooxygenase-like. This family includes FMO proteins and cyclohexanone monooxygenase.
Probab=91.81  E-value=0.27  Score=29.13  Aligned_cols=34  Identities=18%  Similarity=0.420  Sum_probs=31.3

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHH
Q ss_conf             0569815711168899999789859997399899
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFEL   38 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~   38 (475)
                      .|+|||-|.-|...+++|++.|+++.+|+++.+-
T Consensus         3 rVAIIGAG~SGL~a~K~lle~G~~~~~FE~~~~i   36 (532)
T pfam00743         3 KVAVIGAGVSGLSSIKCCLEEGLEPTCFERSDDI   36 (532)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             7999897299999999998779982999779997


No 460
>PRK07856 short chain dehydrogenase; Provisional
Probab=91.74  E-value=0.71  Score=26.00  Aligned_cols=73  Identities=19%  Similarity=0.274  Sum_probs=52.5

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|..+|+.|++.|.+|.+.+|+.....     +    ..                +..+-.-|.+.+.++
T Consensus        10 ~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~-----~----~~----------------~~~~~~Dv~~~~~v~   64 (254)
T PRK07856         10 VVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAPEVD-----G----RP----------------AEFHACDIRDPDQVA   64 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCC-----C----CC----------------EEEEECCCCCHHHHH
T ss_conf             8999476768999999999987999999979855748-----9----84----------------399984699999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      ++++.+......=|++|...
T Consensus        65 ~~~~~~~~~~g~iDilVnNA   84 (254)
T PRK07856         65 ALVDAIAERHGRLDVLVNNA   84 (254)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999809988899889


No 461
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=91.69  E-value=1.1  Score=24.50  Aligned_cols=80  Identities=18%  Similarity=0.161  Sum_probs=50.8

Q ss_pred             EEEEECC---HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHH
Q ss_conf             5698157---1116889999978985999739989999999712211278403289899986057788999976990699
Q gi|254780716|r    6 IGIIGLG---SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPV   82 (475)
Q Consensus         6 IGiIGLG---~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v   82 (475)
                      +=+.|-|   -.|..+|+.|++.|.+|.+..|+.+..+...+.                 .+.....-.+-.-|.+.+.+
T Consensus        10 alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~-----------------~~~~g~~~~~~~Dvsd~~~v   72 (271)
T PRK06505         10 GLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPL-----------------AESLGSDLVLPCDVEDIASV   72 (271)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-----------------HHHCCCCEEEECCCCCHHHH
T ss_conf             9997999985499999999998699999981866889999999-----------------99649818998379999999


Q ss_pred             HHHHHHHHHCCCCCCEEEEC
Q ss_conf             99999997207899899967
Q gi|254780716|r   83 DQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        83 ~~vi~~l~~~l~~g~iiID~  102 (475)
                      +.+++.+.....+=|++|..
T Consensus        73 ~~~v~~~~~~~G~iDiLVnn   92 (271)
T PRK06505         73 DAVFEALEKKWGKLDFVVHA   92 (271)
T ss_pred             HHHHHHHHHHHCCCCEEEEC
T ss_conf             99999999983998789856


No 462
>PRK08013 hypothetical protein; Provisional
Probab=91.67  E-value=0.28  Score=29.00  Aligned_cols=36  Identities=28%  Similarity=0.557  Sum_probs=34.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             998805698157111688999997898599973998
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      |++.+|-|||-|.-|..+|.-|++.|++|.+.++.+
T Consensus         1 M~~~DV~IvGaGpvGl~lA~~La~~G~~v~viE~~~   36 (400)
T PRK08013          1 MQSVDVAIVGGGMVGLAVACGLQGSGLRVAVLEHRV   36 (400)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             996788999935999999999971899589991899


No 463
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=91.66  E-value=1.1  Score=24.48  Aligned_cols=105  Identities=19%  Similarity=0.144  Sum_probs=54.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHH-HHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEE--CCCHHH
Q ss_conf             05698157111688999997898599973998999-999971221127840328989998605778899997--699069
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELT-DVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMM--VTDGDP   81 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~-~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~--vp~g~~   81 (475)
                      +|.++|+|.-|.+.|+-|.++|..+.+-|+..+.. +++...          .....++-  .+..+.|+.+  +|...+
T Consensus         2 Ki~V~GlG~sG~s~a~~L~~~g~~~i~dD~~~~~~~~~~~~~----------~~~~~~~~--~~~~d~vv~SPGI~~~~p   69 (401)
T PRK03815          2 KISLFGYGKTTKALARFFVKNGGVDIYDDKFTEPKKDEEGNL----------LLPSNDFD--PNKSDLEIPSPGIPPSHP   69 (401)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHCC----------CCCHHHCC--CHHCCEEEECCCCCCCCH
T ss_conf             399984777189999999948797999899986222464040----------06843358--012868998998599879


Q ss_pred             -HH---HHHH--HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             -99---9999--9972078998999679865789999999998479
Q gi|254780716|r   82 -VD---QLID--KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG  121 (475)
Q Consensus        82 -v~---~vi~--~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kg  121 (475)
                       +.   +++.  ++.-...+..|.|-+||.--..|.-....|++.|
T Consensus        70 ~~~~a~~i~seiel~~~~~~~~I~ITGTNGKsTtt~li~~iL~~~g  115 (401)
T PRK03815         70 LIQKAKNLISEYDYFYSFMPFSIWISGTNGKTTTTQMLTHLLEDFG  115 (401)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             9998745414999998527874899847777899999999998669


No 464
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=91.65  E-value=0.26  Score=29.27  Aligned_cols=33  Identities=18%  Similarity=0.417  Sum_probs=30.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      .+|++||-|-=|..-|..|+++||+|.||++.+
T Consensus       311 kKVAVIGsGPAGLaaA~~Lar~G~~VTVfE~~~  343 (639)
T PRK12809        311 EKVAVIGAGPAGLGCADILARAGVQVDVFDRHP  343 (639)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             989998975899999999997599069993688


No 465
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=91.65  E-value=0.34  Score=28.32  Aligned_cols=36  Identities=25%  Similarity=0.367  Sum_probs=33.2

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             998805698157111688999997898599973998
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      |+..++-|||-|.=|..-|..|+++|++|.|+.++.
T Consensus         1 ~~~~dvvVIGaG~~GL~aAa~LA~~G~~V~VlE~~~   36 (487)
T COG1233           1 MPMYDVVVIGAGLNGLAAAALLARAGLKVTVLEKND   36 (487)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             997629998988789999999996899799996378


No 466
>PRK12831 putative oxidoreductase; Provisional
Probab=91.61  E-value=0.3  Score=28.77  Aligned_cols=33  Identities=18%  Similarity=0.483  Sum_probs=30.9

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      .+|++||-|-=|..-|..|++.||+|.+|++.+
T Consensus       141 kkVAVIGsGPAGLsaA~~La~~G~~VtVfE~~~  173 (464)
T PRK12831        141 KKVAVIGSGPAGLTCAGDLAKKGYDVTIFEALH  173 (464)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             989998976899999999997699179982788


No 467
>PRK05868 hypothetical protein; Validated
Probab=91.44  E-value=0.22  Score=29.74  Aligned_cols=35  Identities=14%  Similarity=0.270  Sum_probs=32.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |+|  |-|+|-|.=|..+|.-|.+.|++|.|+.|.++
T Consensus         1 ~~k--VlIvGaGiAGlalA~~L~r~G~~VtV~Er~p~   35 (372)
T PRK05868          1 MKT--VLVSGASVAGTAAAYWLGRHGYSVTMVERHPG   35 (372)
T ss_pred             CCE--EEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999--99989888999999999858998899957999


No 468
>PRK08303 short chain dehydrogenase; Provisional
Probab=91.37  E-value=1.2  Score=24.27  Aligned_cols=91  Identities=11%  Similarity=0.156  Sum_probs=52.5

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCC-CCEEEEECCCHHH
Q ss_conf             05698--15711168899999789859997399899999997122112784032898999860577-8899997699069
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCK-PRKILMMVTDGDP   81 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~-pr~Iil~vp~g~~   81 (475)
                      ++.+|  +-.-+|..+|+.|++.|.+|++.+|+.+....-.+.       ....+...+.+.+.-. .-.+-.-+.+.+.
T Consensus         9 KvAlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~-------~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~   81 (305)
T PRK08303          9 KVALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDR-------PETIEETAELVTAAGGRGIAVQVDHLVPEQ   81 (305)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCC-------HHHHHHHHHHHHHCCCEEEEEECCCCCHHH
T ss_conf             9899908875899999999998799899982761100000120-------679999999999759908999756899999


Q ss_pred             HHHHHHHHHHCCCCCCEEEEC
Q ss_conf             999999997207899899967
Q gi|254780716|r   82 VDQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        82 v~~vi~~l~~~l~~g~iiID~  102 (475)
                      ++++++.+.....+=||+|.-
T Consensus        82 v~~~v~~~~~~~G~lDILVNN  102 (305)
T PRK08303         82 VRALVERIDREQGRLDILVND  102 (305)
T ss_pred             HHHHHHHHHHHCCCCCEEEEC
T ss_conf             999999999952962089855


No 469
>PRK08278 short chain dehydrogenase; Provisional
Probab=91.37  E-value=1.2  Score=24.27  Aligned_cols=88  Identities=18%  Similarity=0.186  Sum_probs=52.3

Q ss_pred             EEEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCE--EEEECCCHH
Q ss_conf             05698--15711168899999789859997399899999997122112784032898999860577889--999769906
Q gi|254780716|r    5 DIGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRK--ILMMVTDGD   80 (475)
Q Consensus         5 ~IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~--Iil~vp~g~   80 (475)
                      ++.+|  |-+-+|..+|+.|++.|.+|.+.+|+.+..+++....          .+..+-+... ..+.  +-.-|.+.+
T Consensus         7 KvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~----------~~~a~e~~~~-g~~~~~~~~Dv~~~~   75 (273)
T PRK08278          7 KTLFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTI----------HTAAAEIEAA-GGQALPLVGDVRDED   75 (273)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHH----------HHHHHHHHHC-CCEEEEEECCCCCHH
T ss_conf             98999487659999999999987998999967722213345489----------9999999974-990899971179999


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             99999999972078998999679
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~s  103 (475)
                      .+++.++.+......=|++|...
T Consensus        76 ~v~~~v~~~~~~~G~iDiLVNNA   98 (273)
T PRK08278         76 QVAAAVAKTVERFGGIDICVNNA   98 (273)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99999999999859962999878


No 470
>PRK06185 hypothetical protein; Provisional
Probab=91.33  E-value=0.26  Score=29.21  Aligned_cols=37  Identities=27%  Similarity=0.425  Sum_probs=33.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             9988056981571116889999978985999739989
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |...+|-|||-|--|..+|.-|++.|++|.++++.++
T Consensus         4 ~~~tDV~IVGaGpaGL~lAl~Lar~Gi~V~VlEk~~~   40 (409)
T PRK06185          4 VETTDCCIVGGGPAGMMLGLLLARAGVDVTVLEKHAD   40 (409)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             8789989999188999999999977999999918999


No 471
>PRK05884 short chain dehydrogenase; Provisional
Probab=91.31  E-value=1.2  Score=24.23  Aligned_cols=36  Identities=14%  Similarity=0.264  Sum_probs=30.5

Q ss_pred             ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
Q ss_conf             157111688999997898599973998999999971
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK   45 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~   45 (475)
                      |-+-+|.++|+.|++.|++|.+.+|++++.+...++
T Consensus         8 gs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~e   43 (223)
T PRK05884          8 GDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKE   43 (223)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             887999999999998799999995987899999853


No 472
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=91.26  E-value=1.2  Score=24.20  Aligned_cols=161  Identities=8%  Similarity=0.122  Sum_probs=81.6

Q ss_pred             CCCCEEEEEEC-CHHHHHHHHHHHHC-CCEEE-EE-ECCH--HHHHHHHH---HCC--CCCCCCEECCCHHHHHHHCCCC
Q ss_conf             99880569815-71116889999978-98599-97-3998--99999997---122--1127840328989998605778
Q gi|254780716|r    1 MKQADIGIIGL-GSMGSNLSLNILDK-GFRLA-VY-NKDF--ELTDVFIK---KIS--GLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         1 M~k~~IGiIGL-G~MG~~mA~nL~~~-G~~V~-vy-dr~~--~~~~~l~~---~~~--~~~~~~~~~~s~~e~v~~l~~p   69 (475)
                      |+|-+||+||- |--|..|.+-|..+ .+++. ++ .++.  ++..++..   .+.  ...... .+.++++.  .++..
T Consensus         1 M~kikvaIvGatGy~G~ELirlL~~HP~~ei~~l~aS~~~aGk~~~~~~~~~~~~~~p~~~~~l-~~~~~~~~--~~~~~   77 (350)
T PRK08664          1 MDKLKVGVLGATGLVGQRFVQLLANHPWFEVTALAASERSAGKTYGEAVRWQLDGPIPEEVADL-EVVSTDPV--DVDDV   77 (350)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCCE-EEEECCHH--HHCCC
T ss_conf             9977799989842999999999970999668999965533788415520322346676444650-79868845--74389


Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCC----CCCC-----CCCCCC
Q ss_conf             8999976990699999999972078998999679865789999999998479943067546----7600-----035684
Q gi|254780716|r   70 RKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVS----GGVK-----GARSGA  140 (475)
Q Consensus        70 r~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVS----GG~~-----gA~~G~  140 (475)
                      ++||+++|+|.+-+ +...+   ++.|..|||.|.-+.-+.          .+.++-..+-    ++.+     ..+++.
T Consensus        78 DvvF~AlPhg~s~~-~~~~l---~~~g~~VIDlSadfRl~~----------~~p~~~pE~n~~~~~~~~~~~~~~~~~~~  143 (350)
T PRK08664         78 DIVFSALPSDVAAE-VEEEF---AKAGKPVFSNASAHRMDP----------DVPLVIPEVNPEHLELIEVQRKRRGWDGF  143 (350)
T ss_pred             CEEEECCCCHHHHH-HHHHH---HHCCCEEEECCHHHCCCC----------CCCEECHHHCHHHHHHHHHHHHHCCCCCC
T ss_conf             99999898269999-99999---877988997862203557----------88445420388877346887764134665


Q ss_pred             EEE-EECCHH-HHHHHHHHHHHHHCCCCCCCEEEEECCCCHHH
Q ss_conf             378-845489-99888999998750156786189856987467
Q gi|254780716|r  141 SLM-VGGNEK-AYNRVENILLSISAKYQNSPCCALLGPDGSGH  181 (475)
Q Consensus       141 slM-vGG~~~-~~~~~~piL~~iaak~~~~~cv~y~G~~GsGh  181 (475)
                      .+- +|+-.. +.-.+.|+++.   +..+-....+-|-+|+|.
T Consensus       144 lIanPGCy~Ta~~LaL~PL~~~---~~~~i~i~~~sgvSGAGk  183 (350)
T PRK08664        144 IVTNPNCSTIGLTLALKPLMDF---GIERVHVTTMQAISGAGY  183 (350)
T ss_pred             EEECCCCHHHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCC
T ss_conf             7877971888999988999985---997599994443453661


No 473
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=91.24  E-value=1.3  Score=24.19  Aligned_cols=95  Identities=13%  Similarity=0.190  Sum_probs=54.3

Q ss_pred             EEE-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHH
Q ss_conf             981-5711168899999789859997399899999997122112784032898999860577889999769906999999
Q gi|254780716|r    8 IIG-LGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLI   86 (475)
Q Consensus         8 iIG-LG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi   86 (475)
                      +.| -|-.|+++++.|.++|++|.+.+|..-              .+.-...+++++... +|++|+-+-... .++...
T Consensus         3 VtG~~GfiGs~l~~~L~~~g~~v~~~~r~~~--------------D~~d~~~l~~~~~~~-~pd~VihlAa~~-~~~~~~   66 (284)
T pfam04321         3 VTGANGQLGRELTRLLAERGVEVVALDRPEL--------------DLTDPEAVAALVREA-RPDVVVNAAAYT-AVDKAE   66 (284)
T ss_pred             EECCCCHHHHHHHHHHHHCCCEEEEECCCCC--------------CCCCHHHHHHHHHHC-CCCEEEECCCCC-CCHHHH
T ss_conf             9648998999999999868998999548625--------------788999999999864-997999724135-556777


Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCC
Q ss_conf             999720789989996798657899999999984799430675
Q gi|254780716|r   87 DKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIG  128 (475)
Q Consensus        87 ~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~p  128 (475)
                      ..-...          -..+..-+..+.+.+++.+++|+=+-
T Consensus        67 ~~~~~~----------~~~Nv~~t~~l~~~~~~~~~~~i~~S   98 (284)
T pfam04321        67 SEPELA----------YAVNALGPGNLAEACAARGAPLIHIS   98 (284)
T ss_pred             HCHHHH----------HHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             488889----------98759999999999874498579841


No 474
>PRK06813 homoserine dehydrogenase; Validated
Probab=91.14  E-value=1  Score=24.86  Aligned_cols=103  Identities=15%  Similarity=0.258  Sum_probs=53.3

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHC--------CCEE---EEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCC
Q ss_conf             9988056981571116889999978--------9859---9973998999999971221127840328989998605778
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDK--------GFRL---AVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKP   69 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~--------G~~V---~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~p   69 (475)
                      |. -+|+++|+|+.|+.+++-|.++        |.++   .+.|++....++   .      .+    ++.++...-.  
T Consensus         1 m~-i~I~l~G~G~VG~~~~~~l~~~~~~l~~~~g~~l~i~~i~~s~~~~~~~---~------g~----~~~~~l~~~~--   64 (341)
T PRK06813          1 MK-IKVVLSGYGTVGREFIKLLNEKYLYINETYGIDLVVSGVLGRNVAIHNE---D------GL----SIHHLLRYGG--   64 (341)
T ss_pred             CE-EEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCHHCCC---C------CC----CHHHHHHCCC--
T ss_conf             96-0299995388999999999999999999749977999999686011376---6------88----8789875035--


Q ss_pred             CEEEEECCCHHHHHHH----HHHHHHCCCCCCEEEECCCCCHHH---HHHHHHHHHHCCCCEECC
Q ss_conf             8999976990699999----999972078998999679865789---999999998479943067
Q gi|254780716|r   70 RKILMMVTDGDPVDQL----IDKLKPLLSPEDILLDGGNSHFCD---TQIRSLQLSEKGIYFIGI  127 (475)
Q Consensus        70 r~Iil~vp~g~~v~~v----i~~l~~~l~~g~iiID~sts~~~~---t~~~~~~l~~kgi~fid~  127 (475)
                              ....++..    .+.....--..+++||++-+.+.+   .......+-++|.+.+-+
T Consensus        65 --------~~~~~~~~~~~~~~~~~~~~~~~~i~vd~t~~~~~~~~~a~~~i~~al~~g~~VVTA  121 (341)
T PRK06813         65 --------GSAAIEKYIEHHPEERATDNISGTVLVESTVTNLKDGNPGKQYIKQAIEKQMDIVAI  121 (341)
T ss_pred             --------CCHHHHHHHHHCHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEC
T ss_conf             --------302355555423466630355676699911221357645899999999729968932


No 475
>PRK11749 putative oxidoreductase; Provisional
Probab=91.13  E-value=0.38  Score=28.01  Aligned_cols=34  Identities=18%  Similarity=0.483  Sum_probs=31.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      .+|++||-|--|..-|..|++.||+|.+|++.+.
T Consensus       141 kkVAIIGaGPAGLsAA~~Lar~G~~VtVfE~~~~  174 (460)
T PRK11749        141 KKVAVIGAGPAGLTAAHRLARKGYDVTIFEARDK  174 (460)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             9899989678999999999976984799704787


No 476
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=91.11  E-value=1.3  Score=24.10  Aligned_cols=73  Identities=12%  Similarity=0.160  Sum_probs=52.3

Q ss_pred             EEEE--ECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHH
Q ss_conf             5698--15711168899999789859997399899999997122112784032898999860577889999769906999
Q gi|254780716|r    6 IGII--GLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVD   83 (475)
Q Consensus         6 IGiI--GLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~   83 (475)
                      +.+|  |-+-+|.++|+.|++.|.+|.+.|+++++.+         ..++                ..+-.-|.+.+.++
T Consensus        11 valVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~~---------~~~~----------------~~~~~Dvt~~~~v~   65 (266)
T PRK06171         11 IIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDEK---------HKGY----------------QFWPTDISSAKEVN   65 (266)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCC---------CCCE----------------EEEECCCCCHHHHH
T ss_conf             7999477878999999999987999999978853505---------8976----------------99981699999999


Q ss_pred             HHHHHHHHCCCCCCEEEECC
Q ss_conf             99999972078998999679
Q gi|254780716|r   84 QLIDKLKPLLSPEDILLDGG  103 (475)
Q Consensus        84 ~vi~~l~~~l~~g~iiID~s  103 (475)
                      +.++.+......=|++|...
T Consensus        66 ~~v~~~~~~~G~iDiLVNNA   85 (266)
T PRK06171         66 HTVAEIIERFGRIDGLVNNA   85 (266)
T ss_pred             HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999839988999888


No 477
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=91.11  E-value=0.33  Score=28.47  Aligned_cols=34  Identities=26%  Similarity=0.462  Sum_probs=31.2

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      .+|++||-|-=|..-|..|++.||+|.+|++.+.
T Consensus       328 KkVAIIGsGPAGLsaA~~Lar~G~~VTVFE~~~~  361 (654)
T PRK12769        328 KRVAIIGAGPAGLACADVLTRNGVAVTVYDRHPE  361 (654)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             9899989778999999999976975799525777


No 478
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional
Probab=91.04  E-value=0.43  Score=27.59  Aligned_cols=165  Identities=22%  Similarity=0.282  Sum_probs=85.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHH-CCCEEEEEEC---CHHHHHHHHHHCCC---CCCCCEECCCHHHHHHHCCCCCEEE
Q ss_conf             998805698157111688999997-8985999739---98999999971221---1278403289899986057788999
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILD-KGFRLAVYNK---DFELTDVFIKKISG---LSQKVIVTKNLEQMVEAVCKPRKIL   73 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~-~G~~V~vydr---~~~~~~~l~~~~~~---~~~~~~~~~s~~e~v~~l~~pr~Ii   73 (475)
                      |+- .||+=|+|+.|+.+.|.+.. ..++|.+-|-   +.+...-+.+.-..   ....+....+  .+  .++..++-+
T Consensus         1 M~i-kigINGFGRIGR~v~R~~~~~~~i~vvaINd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~--~l--~i~~~~I~~   75 (337)
T PTZ00023          1 MVV-KIGINGFGRIGRLVHRASLARENVEVVAINDPFMTPDYIKYLLKYDSVHGSLPCEVSVTSD--HL--MIGSKKVHL   75 (337)
T ss_pred             CCE-EEEEECCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCEEEECC--EE--EECCEEEEE
T ss_conf             967-9999568778999999984189948999789999999999986536789989997898389--59--999978875


Q ss_pred             EECCCHHHHHHHHHHHHHCCCC-CCEEEECCCCCHHHHHHHHHHHHHCCCC--EECCCCCCCCCCCCCCCEEEEECCHHH
Q ss_conf             9769906999999999720789-9899967986578999999999847994--306754676000356843788454899
Q gi|254780716|r   74 MMVTDGDPVDQLIDKLKPLLSP-EDILLDGGNSHFCDTQIRSLQLSEKGIY--FIGIGVSGGVKGARSGASLMVGGNEKA  150 (475)
Q Consensus        74 l~vp~g~~v~~vi~~l~~~l~~-g~iiID~sts~~~~t~~~~~~l~~kgi~--fid~pVSGG~~gA~~G~slMvGG~~~~  150 (475)
                      +.-.++        .-+|.-+- -|+||||+-. |.+......-++ .|..  .+.+|..+      .-+++..|=+.+.
T Consensus        76 ~~~~dp--------~~ipW~~~gvDiViEcTG~-f~~~~~a~~Hl~-~GakkViiSAP~~d------~~~t~V~GVN~~~  139 (337)
T PTZ00023         76 FFEKDP--------SQIPWGKNDVDVVAECTGV-FTSTEKAKLHLK-GGAKLVIISAPPSD------STPIYVFGVNHTQ  139 (337)
T ss_pred             ECCCCH--------HHCCCCCCCCCEEEECCCC-CCCHHHHHHHHH-CCCCEEEECCCCCC------CCCEEEEECCHHH
T ss_conf             056996--------6699220398789962654-468899999987-69977997689988------8867998356343


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH--HHHHHHHHH
Q ss_conf             98889999987501567861898569874678988776--787888999
Q gi|254780716|r  151 YNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHN--GIEYANMQL  197 (475)
Q Consensus       151 ~~~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN--gIey~~mq~  197 (475)
                      |+.-..++..-+..+           ..-.-.+|.+|.  |||.|.|..
T Consensus       140 ~~~~~~IISnASCTT-----------NclAPl~kvL~~~fgI~~g~mTT  177 (337)
T PTZ00023        140 YDKSQRIVSNASCTT-----------NCLAPLAKVINDNFGIVEGLMTT  177 (337)
T ss_pred             CCCCCCEEECCCCCC-----------CCHHHHHHHHHHHCCEEEEEEEE
T ss_conf             487672896563100-----------30030798786534867878998


No 479
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]
Probab=90.96  E-value=0.42  Score=27.66  Aligned_cols=36  Identities=22%  Similarity=0.339  Sum_probs=32.4

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             998805698157111688999997898599973998
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      +++.+|.|||-|..|...|..|++.|.+|.++++..
T Consensus         2 ~~~~~vvIIGgGi~Gls~A~~La~~G~~V~vie~~~   37 (387)
T COG0665           2 SMKMDVVIIGGGIVGLSAAYYLAERGADVTVLEAGE   37 (387)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             976439998986999999999997699199991798


No 480
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=90.95  E-value=1.3  Score=23.99  Aligned_cols=81  Identities=16%  Similarity=0.264  Sum_probs=51.7

Q ss_pred             EEEEE-EC-C--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             05698-15-7--11168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    5 DIGII-GL-G--SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         5 ~IGiI-GL-G--~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
                      ++.+| |- |  -+|.++|+.|++.|.+|.+.+|+.. .++.+++                +.+.+....++-.-|.+.+
T Consensus         6 K~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~-~~~~~~~----------------l~~~~g~~~~~~~Dvs~~~   68 (274)
T PRK08415          6 KKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDA-LKKRVEP----------------IAQELGSPYVYELDVSKEE   68 (274)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH-HHHHHHH----------------HHHHCCCCEEEEECCCCHH
T ss_conf             8799989999837999999999986999999848878-9999999----------------9986299769990289999


Q ss_pred             HHHHHHHHHHHCCCCCCEEEEC
Q ss_conf             9999999997207899899967
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDG  102 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~  102 (475)
                      .++++++.+......=|++|..
T Consensus        69 ~v~~~~~~i~~~~G~iDilVnn   90 (274)
T PRK08415         69 HFKSLAESIKKDLGEIDFIVHS   90 (274)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEC
T ss_conf             9999999999985898888533


No 481
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated
Probab=90.94  E-value=0.42  Score=27.68  Aligned_cols=35  Identities=34%  Similarity=0.573  Sum_probs=31.6

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             99880569815711168899999789859997399
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKD   35 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~   35 (475)
                      |++.+|-|||-|.-|..+|.-|++.|++|.++++.
T Consensus         2 ~~~~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~   36 (405)
T PRK08850          2 MQSVDVAIIGGGMVGLALAAALKDSDLRIAVIEGQ   36 (405)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99876899991589999999998589978999379


No 482
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=90.94  E-value=0.4  Score=27.85  Aligned_cols=33  Identities=24%  Similarity=0.541  Sum_probs=30.7

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      .+|++||-|--|..-|..|++.||+|.||++.+
T Consensus       194 KkVAIIGaGPAGLsaAy~L~~~Gh~VTVfE~~~  226 (652)
T PRK12814        194 KKVAIIGAGPAGLTAAYYLLRKGHDVTIFDANE  226 (652)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             979996837899999999997799069981588


No 483
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional
Probab=90.93  E-value=0.33  Score=28.50  Aligned_cols=164  Identities=19%  Similarity=0.246  Sum_probs=85.2

Q ss_pred             EEEEEECCHHHHHHHHHHHHCC----CEEEEEEC--CHHHHHHHHHHCC---CCCCCCEECCCHHHHHHHCCCCCEEEEE
Q ss_conf             0569815711168899999789----85999739--9899999997122---1127840328989998605778899997
Q gi|254780716|r    5 DIGIIGLGSMGSNLSLNILDKG----FRLAVYNK--DFELTDVFIKKIS---GLSQKVIVTKNLEQMVEAVCKPRKILMM   75 (475)
Q Consensus         5 ~IGiIGLG~MG~~mA~nL~~~G----~~V~vydr--~~~~~~~l~~~~~---~~~~~~~~~~s~~e~v~~l~~pr~Iil~   75 (475)
                      +||+-|+|+.|+...|-+.+.+    ++|..-|-  +++...-+.+.-.   .....+..-   ++. -.++..++-++.
T Consensus         3 kIgINGFGRIGR~v~R~~~e~~~~~~i~vVaINd~~~~~~~ayLLkyDSvhG~~~~~v~~~---~~~-l~v~~~~I~~~~   78 (336)
T PRK13535          3 RVAINGFGRIGRNVLRALYESGRRAEITVVAINELADAEGMAHLLKYDTSHGRFAWEVRQE---RDQ-LFVGDDAIRLLH   78 (336)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHCCCCCCCCCCCCEEEE---CCE-EEECCEEEEEEE
T ss_conf             9999788889999999998668899869999788999899999864226788899978970---897-999998999995


Q ss_pred             CCCHHHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHHHHHHCCCC--EECCCCCCCCCCCCCCCEEEEECCHHHHH
Q ss_conf             6990699999999972078-99899967986578999999999847994--30675467600035684378845489998
Q gi|254780716|r   76 VTDGDPVDQLIDKLKPLLS-PEDILLDGGNSHFCDTQIRSLQLSEKGIY--FIGIGVSGGVKGARSGASLMVGGNEKAYN  152 (475)
Q Consensus        76 vp~g~~v~~vi~~l~~~l~-~g~iiID~sts~~~~t~~~~~~l~~kgi~--fid~pVSGG~~gA~~G~slMvGG~~~~~~  152 (475)
                      -.++.        -+|.-+ .-|+||||+-. |.+......-++ .|..  .+.+|..+..     .+++..|-+.+.|+
T Consensus        79 ~~dp~--------~ipW~~~~vD~ViE~TG~-f~~~~~a~~Hl~-~GakkViiSaP~~~~~-----d~tiV~GVN~~~~~  143 (336)
T PRK13535         79 ERDLA--------SLPWRELGVDVVLDCTGV-YGSREDGEAHIA-AGAKKVLFSHPGSNDL-----DATVVYGVNHDQLR  143 (336)
T ss_pred             CCCHH--------HCCCCCCCCCEEEEECCC-CCCHHHHHHHHH-CCCCEEEEECCCCCCC-----CCEEEECCCHHHCC
T ss_conf             58943--------398311587599970431-167899999987-5985689825887666-----86389615756748


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHH--HHHHHHHHHH
Q ss_conf             889999987501567861898569874678988776--7878889998
Q gi|254780716|r  153 RVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHN--GIEYANMQLI  198 (475)
Q Consensus       153 ~~~piL~~iaak~~~~~cv~y~G~~GsGh~vKMVhN--gIey~~mq~i  198 (475)
                      .-..++..-+..+.   |        -+-.+|.+|.  |||.|.|..|
T Consensus       144 ~~~~IiSnASCTTN---c--------lAPv~kvl~~~fGI~~g~mTTI  180 (336)
T PRK13535        144 AEHRIVSNASCTTN---C--------IIPVIKLLDDAFGIESGTVTTI  180 (336)
T ss_pred             CCCEEEECCCCCCC---E--------EEEHHHHHHHCCCEEEEEEEEE
T ss_conf             66538975753324---1--------4012553663367577578877


No 484
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=90.90  E-value=1.3  Score=23.96  Aligned_cols=33  Identities=18%  Similarity=0.415  Sum_probs=30.8

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             805698157111688999997898599973998
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDF   36 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~   36 (475)
                      .+|++||-|-=|..-|..|++.||+|.||++.+
T Consensus       551 KKVAVIGsGPAGLaAA~~Lar~Gh~VTVFEk~~  583 (1032)
T PRK09853        551 HPVAVIGAGPAGLAAGYFLARAGHPVTVFEREE  583 (1032)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             979998968899999999997799369981589


No 485
>pfam01494 FAD_binding_3 FAD binding domain. This domain is involved in FAD binding in a number of enzymes.
Probab=90.86  E-value=0.28  Score=28.97  Aligned_cols=34  Identities=26%  Similarity=0.437  Sum_probs=31.6

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             8056981571116889999978985999739989
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      .+|-|||-|.-|..+|.-|.++|++|.+|++.++
T Consensus         2 ~DV~IvGaG~aGl~lA~~L~~~Gi~v~V~Er~~~   35 (349)
T pfam01494         2 TDVLIVGGGPAGLMLALLLARAGVRVVLVERHAT   35 (349)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9789999288999999999877998999928999


No 486
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=90.81  E-value=1.3  Score=24.09  Aligned_cols=80  Identities=18%  Similarity=0.245  Sum_probs=48.1

Q ss_pred             ECCHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHH
Q ss_conf             1571116889999978985-999739989999999712211278403289899986057788999976990699999999
Q gi|254780716|r   10 GLGSMGSNLSLNILDKGFR-LAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDK   88 (475)
Q Consensus        10 GLG~MG~~mA~nL~~~G~~-V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~   88 (475)
                      |-+-+|..+|+.|+++|.. |....|+++..++..+..             +++...=.+...+-.-+.+.+.++++++.
T Consensus         8 as~GIG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~-------------~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~   74 (181)
T pfam08659         8 GLGGLGLELARWLAERGARHLVLLSRSGAPDPEAEALL-------------AELEARGAEVTVVACDVSDRDAVAALLAE   74 (181)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHH-------------HHHHHCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             78789999999999879978999868976629999999-------------99996599699997568999999988865


Q ss_pred             HHHCCCCCCEEEEC
Q ss_conf             97207899899967
Q gi|254780716|r   89 LKPLLSPEDILLDG  102 (475)
Q Consensus        89 l~~~l~~g~iiID~  102 (475)
                      +.....+=|++|..
T Consensus        75 ~~~~~g~id~lvnn   88 (181)
T pfam08659        75 IRADGPPLRGVIHA   88 (181)
T ss_pred             HHHHCCCEEEEEEE
T ss_conf             79873984899954


No 487
>PRK08163 salicylate hydroxylase; Provisional
Probab=90.81  E-value=0.34  Score=28.31  Aligned_cols=37  Identities=22%  Similarity=0.382  Sum_probs=33.3

Q ss_pred             CCC-CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             998-8056981571116889999978985999739989
Q gi|254780716|r    1 MKQ-ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE   37 (475)
Q Consensus         1 M~k-~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~   37 (475)
                      |++ ..|-|||-|.-|..+|.-|.++|++|.||++.++
T Consensus         1 M~~~~~V~IVGaGiaGL~lA~~L~r~Gi~v~V~Er~~~   38 (396)
T PRK08163          1 MTHVTPVLIVGGGIGGLAAALALARQGIKVKLLEQAAE   38 (396)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             98998499989788999999999978999999917998


No 488
>PRK05854 short chain dehydrogenase; Provisional
Probab=90.80  E-value=1.4  Score=23.90  Aligned_cols=76  Identities=13%  Similarity=0.127  Sum_probs=46.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             11168899999789859997399899999997122112784032898999860577889999769906999999999720
Q gi|254780716|r   13 SMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPL   92 (475)
Q Consensus        13 ~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~   92 (475)
                      =+|...|+.|++.|.+|++--|+.++.++.+++-.....+.              +..++-+-+.+-+.|++..+.+...
T Consensus        25 GIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~--------------~v~~~~lDLs~l~sVr~~a~~~~~~   90 (314)
T PRK05854         25 GLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDA--------------KLTIRALDLSSLASVAALGEQLLAE   90 (314)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCC--------------CEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             99999999999784989999799999999999999868998--------------5699964631689999999987530


Q ss_pred             CCCCCEEEEC
Q ss_conf             7899899967
Q gi|254780716|r   93 LSPEDILLDG  102 (475)
Q Consensus        93 l~~g~iiID~  102 (475)
                      ..+=|++|.-
T Consensus        91 ~~~lDiLInN  100 (314)
T PRK05854         91 GRPIHLLINN  100 (314)
T ss_pred             CCCCCEEEEC
T ss_conf             6875278726


No 489
>COG1810 Uncharacterized protein conserved in archaea [Function unknown]