HHsearch alignment for GI: 254780716 and conserved domain: pfam00389

>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain. This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Probab=97.29  E-value=0.0026  Score=43.94  Aligned_cols=84  Identities=14%  Similarity=0.145  Sum_probs=47.3

Q ss_pred             CHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCC
Q ss_conf             98999860577889999769906999999999720789989996798657899999999984799430675467600035
Q gi|254780716|r   58 NLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGAR  137 (475)
Q Consensus        58 s~~e~v~~l~~pr~Iil~vp~g~~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~  137 (475)
T Consensus        29 ~~eel~~~~~~~d~li~~~~~-~i~~e~l~~~-~~L---K~I~~~~-~G~D-~ID~-~~a~~~gI~V~n~p~~~~~aVAE  100 (313)
T pfam00389        29 LTEELLEAAKDADALIVRSTT-PVTAEVLEAA-PGL---KVIARRG-VGVD-NIDL-DAATERGILVTNVPGYSTESVAE  100 (313)
T ss_pred             CHHHHHHHHCCCCEEEECCCC-CCCHHHHHCC-CCC---EEEEECC-CCCC-HHHH-HHHHHCCCEEEECCCCCCHHHHH
T ss_conf             989999983898299985899-7689999449-998---4999888-4455-3059-99997999999899877289999


Q ss_pred             CCCEEEEECCHH
Q ss_conf             684378845489
Q gi|254780716|r  138 SGASLMVGGNEK  149 (475)
Q Consensus       138 ~G~slMvGG~~~  149 (475)
T Consensus       101 ~~i~l~L~l~R~  112 (313)
T pfam00389       101 LTVGLILALARR  112 (313)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999997123