HHsearch alignment for GI: 254780716 and conserved domain: pfam00899

>pfam00899 ThiF ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family.
Probab=97.16  E-value=0.0049  Score=41.95  Aligned_cols=124  Identities=18%  Similarity=0.224  Sum_probs=75.1

Q ss_pred             CEEEEEECCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHCC-CCC-CCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             805698157111688999997898-59997399899999997122-112-784032898999860577889999769906
Q gi|254780716|r    4 ADIGIIGLGSMGSNLSLNILDKGF-RLAVYNKDFELTDVFIKKIS-GLS-QKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         4 ~~IGiIGLG~MG~~mA~nL~~~G~-~V~vydr~~~~~~~l~~~~~-~~~-~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
T Consensus         2 skVlivG~GglG~~~~~~La~~Gvg~i~lvD~D~ve~sNL~Rq~l~~~~diG~~Ka~~~~~~l~~~n-p~~~i~~~~~~-   79 (134)
T pfam00899         2 SRVLVVGAGGLGSPAAEYLARAGVGKLTLVDFDTVELSNLNRQILFTESDIGKPKAEVAKERLRAIN-PDVEVEAYPER-   79 (134)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEECCHHHCCCEEHHHHHHHHHHHC-CCCEEEEEECC-
T ss_conf             8899989888999999999993897499998956763222722423364668810799999999778-99589999256-


Q ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCC
Q ss_conf             99999999972078998999679865789999999998479943067546760
Q gi|254780716|r   81 PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV  133 (475)
Q Consensus        81 ~v~~vi~~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~  133 (475)
T Consensus        80 i~~~---~~~~~~~~~DvVi~~~D-n~~~r~~ln~~c~~~~ip~i~~~~~g~~  128 (134)
T pfam00899        80 LTPE---NLEELLKGADLVVDALD-NFAARYLLNDACVKRGIPLISAGALGFD  128 (134)
T ss_pred             CCHH---HHHHCCCCCCEEEECCC-CHHHHHHHHHHHHHCCCCEEEEECCCCE
T ss_conf             7977---87642644889999989-9999999999999859989995546788