HHsearch alignment for GI: 254780716 and conserved domain: pfam01118

>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. This Pfam entry contains the following members: N-acetyl-glutamine semialdehyde dehydrogenase (AgrC) Aspartate-semialdehyde dehydrogenase
Probab=94.86  E-value=0.083  Score=32.85  Aligned_cols=95  Identities=16%  Similarity=0.248  Sum_probs=55.8

Q ss_pred             EEEEEE-CCHHHHHHHHHHHHCC-CEE-EEEECCHHHHHHHHHHCCCC--CCCCEECCCHHHHHHHCCCCCEEEEECCCH
Q ss_conf             056981-5711168899999789-859-99739989999999712211--278403289899986057788999976990
Q gi|254780716|r    5 DIGIIG-LGSMGSNLSLNILDKG-FRL-AVYNKDFELTDVFIKKISGL--SQKVIVTKNLEQMVEAVCKPRKILMMVTDG   79 (475)
Q Consensus         5 ~IGiIG-LG~MG~~mA~nL~~~G-~~V-~vydr~~~~~~~l~~~~~~~--~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g   79 (475)
T Consensus         1 kvaIiGatGyvG~eLirlL~~hp~~~i~~l~~s~~saG~~~~~~~~~~~~~~~~-~~~~~~~--~~~~~~Dvvf~alp~~   77 (121)
T pfam01118         1 KVAIVGATGYVGQELLRLLAEHPPLELVALVASSRSAGKKVAFAGPWLTGGVDL-LLEDVDP--EDLKDVDIVFFALPAG   77 (121)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHCCCCCCCCCC-EEEECCH--HHHCCCCEEEECCCHH
T ss_conf             999989361999999999971887551378850565896014416542466664-4775897--7853898999838768


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             699999999972078998999679865
Q gi|254780716|r   80 DPVDQLIDKLKPLLSPEDILLDGGNSH  106 (475)
Q Consensus        80 ~~v~~vi~~l~~~l~~g~iiID~sts~  106 (475)
T Consensus        78 -~s~~~~~~~---~~~g~~VIDlS~df  100 (121)
T pfam01118        78 -VSKELAPKL---LEAGAVVIDLSSAF  100 (121)
T ss_pred             -HHHHHHHHH---HHCCCEEEECCHHH
T ss_conf             -999999998---71598998785675