HHsearch alignment for GI: 254780716 and conserved domain: pfam03446

>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=100.00  E-value=2.6e-36  Score=287.22  Aligned_cols=159  Identities=38%  Similarity=0.637  Sum_probs=150.0

Q ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEECCCHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             99880569815711168899999789859997399899999997122112784032898999860577889999769906
Q gi|254780716|r    1 MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD   80 (475)
Q Consensus         1 M~k~~IGiIGLG~MG~~mA~nL~~~G~~V~vydr~~~~~~~l~~~~~~~~~~~~~~~s~~e~v~~l~~pr~Iil~vp~g~   80 (475)
T Consensus         1 M~~--Ig~IGlG~MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g------~~~~~s~~e~~~~~d---vIi~~l~~~~   69 (163)
T pfam03446         1 MAK--IGFIGLGVMGSPMALNLLKAGYTVTVYNRTPEKVEELVAEG------AVAAASPAEAAASAD---VVITMVPAGA   69 (163)
T ss_pred             CCE--EEEEEEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC------CEECCCHHHHHHCCC---EEEEECCCHH
T ss_conf             988--99983679899999999977996999979788779999839------955399999986199---9999258714


Q ss_pred             HHHHHHH---HHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCC-EEEEECCHHHHHHHHH
Q ss_conf             9999999---99720789989996798657899999999984799430675467600035684-3788454899988899
Q gi|254780716|r   81 PVDQLID---KLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA-SLMVGGNEKAYNRVEN  156 (475)
Q Consensus        81 ~v~~vi~---~l~~~l~~g~iiID~sts~~~~t~~~~~~l~~kgi~fid~pVSGG~~gA~~G~-slMvGG~~~~~~~~~p  156 (475)
T Consensus        70 ~v~~V~~~~~gl~~~~~~g~iiid~sT~~p~~~~~~~~~~~~~g~~~lDaPVsGg~~~A~~G~L~~m~gG~~~~~~~~~p  149 (163)
T pfam03446        70 AVDAVIFGEDGLLPGLKPGDIIIDGSTISPDDTRRLAKELKEKGIRFLDAPVSGGEEGAEAGTLSIMVGGDEEAFERVKP  149 (163)
T ss_pred             HHHEEECCCCCHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCEEEEECCCHHHHHHHHH
T ss_conf             54022026313323135898898679899999999999875303443478776898999448879997589999999999


Q ss_pred             HHHHHHCCCCCCCEEEEECC
Q ss_conf             99987501567861898569
Q gi|254780716|r  157 ILLSISAKYQNSPCCALLGP  176 (475)
Q Consensus       157 iL~~iaak~~~~~cv~y~G~  176 (475)
T Consensus       150 ~l~~~~~~------~~~~GP  163 (163)
T pfam03446       150 ILEAMGAC------VTYIGP  163 (163)
T ss_pred             HHHHHCCC------CEEECC
T ss_conf             99997394------889592