BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780716|ref|YP_003065129.1| 6-phosphogluconate
dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
         (475 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040393|gb|ACT57189.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 475

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/475 (100%), Positives = 475/475 (100%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE
Sbjct: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK
Sbjct: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG
Sbjct: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL
Sbjct: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK
Sbjct: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR
Sbjct: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV
Sbjct: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
Sbjct: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475


>gi|315121881|ref|YP_004062370.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495283|gb|ADR51882.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 473

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/469 (76%), Positives = 408/469 (86%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IGIIGLG+MGSNL+LN+L+KGFRLAVYN++ ELT+VF+KK  GLSQK I TKNL+
Sbjct: 1   MQKAEIGIIGLGAMGSNLALNMLEKGFRLAVYNQEIELTEVFVKKAHGLSQKFIATKNLQ 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           QMVEA+ +PRKILMM+TDG+PVDQLI+KLKPLLS EDILLDGGNSHF DTQ RSL L++K
Sbjct: 61  QMVEAISQPRKILMMITDGNPVDQLIEKLKPLLSSEDILLDGGNSHFADTQTRSLGLNQK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GIYFIGIGVSGG  GAR G SLMVGGNEKAY+ +E+ILLSISA YQN+PCCALLGPDG+G
Sbjct: 121 GIYFIGIGVSGGTNGARYGPSLMVGGNEKAYHSIEHILLSISANYQNNPCCALLGPDGTG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYANMQLIADIYGILRD LNK  +E SHLFSKW+TGKL+SYL KITAEIL
Sbjct: 181 HFVKTIHNGIEYANMQLIADIYGILRDGLNKTSVETSHLFSKWNTGKLNSYLTKITAEIL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           SS D ITG+ +IDVICD ASQKGTGIRSIIEGHKL SS+TITE AIFARNLSL+ DE KK
Sbjct: 241 SSIDPITGLSMIDVICDTASQKGTGIRSIIEGHKLFSSLTITEIAIFARNLSLHNDECKK 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           MQ  F   S F LK  D+ +KDLENALY S ILSFTQGF +I KSS+KY+W+L L+ IAR
Sbjct: 301 MQLVFKNPSSFCLKYSDTLIKDLENALYVSKILSFTQGFLLIHKSSKKYNWNLQLSKIAR 360

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRSQ+LNDIV+SL E+P+  NLL IPSIS+KVK TI SLRR+V+ CT+ GYPV
Sbjct: 361 IWRAGCIIRSQLLNDIVESLIENPNDANLLMIPSISQKVKSTISSLRRVVIDCTKQGYPV 420

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           P+LSAALSYFD + H  GTA+LIQAQRDFFGSHGFDRKD I + HGPWQ
Sbjct: 421 PALSAALSYFDAYTHGNGTAHLIQAQRDFFGSHGFDRKDGILKNHGPWQ 469


>gi|222086194|ref|YP_002544726.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Agrobacterium
           radiobacter K84]
 gi|221723642|gb|ACM26798.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Agrobacterium
           radiobacter K84]
          Length = 489

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 238/469 (50%), Positives = 330/469 (70%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  ++TD F      L  K+I  K +E
Sbjct: 15  VEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPQVTDEFYANAGALKDKIIPCKTIE 74

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR I++M+  G+PVDQ +  L+P L   DI++D GN++F DT  R  +L + 
Sbjct: 75  EFVESIRPPRPIIIMIKAGEPVDQQMAALQPYLDKGDIMIDAGNANFRDTIARFDRLKDT 134

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E++Y RVE +L SI+A Y N PC A LG DG+G
Sbjct: 135 GLTFIGMGVSGGEEGARHGPSIMVGGTEESYKRVEKVLTSIAATYNNDPCVAWLGNDGAG 194

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L K+  EIS +F  W+ G+L+SYLI+IT ++L
Sbjct: 195 HFVKTIHNGIEYADMQMIAEIYGILRDGLGKSAAEISGIFGDWNKGRLNSYLIEITEKVL 254

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           ++ D  TG  + DVI DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 255 AAKDPATGSAMPDVILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSAIKSQREA 314

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F  P   FP+      +KDLE AL+A+ I ++ QGF V+ ++S++++WSL +  IA
Sbjct: 315 AEKIFGTPDYKFPIAFGPDLLKDLELALFAAKIGAYAQGFAVMAEASKEFNWSLPMPVIA 374

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWRAGCIIRSQ L++I  + T+ P + NL+  P+ +E VK++IPSLRRIV   T +G P
Sbjct: 375 KIWRAGCIIRSQFLDEITSAFTKTPDAANLIVTPAFAEMVKESIPSLRRIVSAATASGLP 434

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 435 VPALASALTYFDAYRQARGTANLIQAQRDFFGAHGFDRVDGKDIHHGPW 483


>gi|15965685|ref|NP_386038.1| 6-phosphogluconate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|307308615|ref|ZP_07588314.1| 6-phosphogluconate dehydrogenase, decarboxylating [Sinorhizobium
           meliloti BL225C]
 gi|307318749|ref|ZP_07598181.1| 6-phosphogluconate dehydrogenase, decarboxylating [Sinorhizobium
           meliloti AK83]
 gi|15074954|emb|CAC46511.1| Probable 6-phosphogluconate dehydrogenase (decarboxylating) protein
           [Sinorhizobium meliloti 1021]
 gi|306895470|gb|EFN26224.1| 6-phosphogluconate dehydrogenase, decarboxylating [Sinorhizobium
           meliloti AK83]
 gi|306900820|gb|EFN31430.1| 6-phosphogluconate dehydrogenase, decarboxylating [Sinorhizobium
           meliloti BL225C]
          Length = 476

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 326/470 (69%), Gaps = 2/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+IG+IGLG MGSNL+LNI +KG R+AV+N+  + T  F  +   L  +++  + +E
Sbjct: 1   MSQAEIGLIGLGVMGSNLALNIAEKGNRIAVFNRTVDATRKFYAEAGALKDQIVPCETIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GDPVDQ ++ LKP L+  DI++D GN++F DT  R   L + 
Sbjct: 61  EFVAAIRPPRPIIIMIKAGDPVDQQMEALKPHLAKGDIMIDAGNANFRDTMRRFDALKDS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E++Y RVE +L SI+AKY + PC A LG +G+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEESYRRVEKVLTSIAAKYDSDPCVAWLGENGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L     EI  +F  W+ G+L+SYLI+IT ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLKMTAQEIGEVFGAWNKGRLNSYLIEITEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D +TG PI+D+I DKA QKGTG  S+IE   +    T  E A+ AR++S  ++E + 
Sbjct: 241 KAADPLTGKPIVDMILDKAGQKGTGKWSVIEAQNMGVPATAIEAAVAARSISSAKEEREA 300

Query: 301 MQSFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            +      P     +   D F+KDLENAL A+ I ++ QGF V+  +S+++ W+L + TI
Sbjct: 301 AEKVLGLPPVGEIKVADRDGFIKDLENALLAAKIGAYAQGFAVMAAASKEFGWNLPMPTI 360

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+IWRAGCIIRSQ L++I  + T+ P + NL+  P+ +  VK++  +LRR+V T    G 
Sbjct: 361 AKIWRAGCIIRSQFLDEITTAFTKAPDAANLIVTPAFAAMVKESDGALRRVVSTAVLGGL 420

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+L++AL YFD++   RGTAN+IQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 PVPALASALGYFDSYRRGRGTANVIQAQRDFFGAHGFDRVDGADSHHGPW 470


>gi|241205065|ref|YP_002976161.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858955|gb|ACS56622.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 476

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 334/469 (71%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E
Sbjct: 1   MEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+  PR I++M+  G+PVDQ ++ L+P LS  DI++D GN++F DT  R  +L   
Sbjct: 61  EFVDAIRPPRPIIIMIKAGEPVDQQMELLRPHLSKGDIMIDAGNANFRDTVARFDRLKNT 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + FIG+GVSGG +GAR G S+MVGG E+++ RVE +L SI+A+Y + PC A LG DG+G
Sbjct: 121 DLTFIGMGVSGGEEGARHGPSIMVGGTEESWKRVEKVLTSIAARYNDEPCVAWLGNDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L K+  EIS +F +W+ G+L+SYLI+I+ ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGKSASEISGIFGEWNKGRLNSYLIEISEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 241 AATDPVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREA 300

Query: 301 MQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIA
Sbjct: 301 AEKIFGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L++I  + T+ P + NL+  P+ S+ VK+++P+LRR+V      G P
Sbjct: 361 RIWRAGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSDMVKESVPALRRVVGAAIAAGLP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 VPALTSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGRDFHHGPW 469


>gi|86358080|ref|YP_469972.1| 6-phosphogluconate dehydrogenase [Rhizobium etli CFN 42]
 gi|86282182|gb|ABC91245.1| 6-phosphogluconate dehydrogenase (decarboxylating) protein
           [Rhizobium etli CFN 42]
          Length = 483

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 333/469 (71%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E
Sbjct: 8   VEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIE 67

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+  PR I++M+  G+ VDQ ++ L+P LS  DI++D GN++F DT  R  +L   
Sbjct: 68  EFVDAIRPPRPIIIMIKAGEAVDQQMEALRPHLSKGDIMIDAGNANFRDTVARFDRLKNT 127

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + FIG+GVSGG +GAR G S+MVGG E+++ RVE +L SI+A+Y + PC A LG DG+G
Sbjct: 128 DLTFIGMGVSGGEEGARHGPSIMVGGTEESWKRVEKVLTSIAARYNDEPCVAWLGNDGAG 187

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L K+  EIS +F +W+ G+L+SYLI+I+ ++L
Sbjct: 188 HFVKTIHNGIEYADMQMIAEIYGILRDGLGKSASEISGIFGEWNKGRLNSYLIEISEKVL 247

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 248 AATDPVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREA 307

Query: 301 MQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIA
Sbjct: 308 AEKIFGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIA 367

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L++I  + T+ P + NL+  P+ SE VK++IP+LRR+V      G P
Sbjct: 368 RIWRAGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSEMVKESIPALRRVVAAAISAGLP 427

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 428 VPALTSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGKDFHHGPW 476


>gi|190892158|ref|YP_001978700.1| 6-phosphogluconate dehydrogenase (decarboxylating) protein
           [Rhizobium etli CIAT 652]
 gi|190697437|gb|ACE91522.1| 6-phosphogluconate dehydrogenase (decarboxylating) protein
           [Rhizobium etli CIAT 652]
          Length = 483

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 333/469 (71%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E
Sbjct: 8   VEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIE 67

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+  PR I++M+  GD VDQ ++ L+P LS  DI++D GN++F DT  R  +L + 
Sbjct: 68  EFVDAIRPPRPIIIMIKAGDAVDQQMEALRPHLSKGDIMIDAGNANFRDTVARFDRLKDT 127

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + FIG+GVSGG +GAR G S+MVGG E+++ RVE +L SI+A+Y + PC A LG DG+G
Sbjct: 128 DLTFIGMGVSGGEEGARHGPSIMVGGTEESWKRVEKVLTSIAARYNDEPCVAWLGNDGAG 187

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L K+  +IS +F +W+ G+L+SYLI+I+ ++L
Sbjct: 188 HFVKTIHNGIEYADMQMIAEIYGILRDGLGKSASDISGVFGEWNKGRLNSYLIEISEKVL 247

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 248 AATDPVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREA 307

Query: 301 MQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIA
Sbjct: 308 AEKIFGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIA 367

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L++I  + T+ P + NL+  P+ SE VK++IP+LRR+V      G P
Sbjct: 368 RIWRAGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSEMVKESIPALRRVVAAAISAGLP 427

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 428 VPVLTSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGKDFHHGPW 476


>gi|227822335|ref|YP_002826306.1| 6-phosphogluconate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227341335|gb|ACP25553.1| putative phosphogluconate dehydrogenase [Sinorhizobium fredii
           NGR234]
          Length = 476

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 323/470 (68%), Gaps = 2/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+IG+IGLG MGSNL+LNI +KG ++AV+N+  + T  F  +   L ++++  + +E
Sbjct: 1   MSQAEIGLIGLGVMGSNLALNIAEKGNKIAVFNRTVDATRKFYAEAGALKEQIVPCETIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GDPVDQ +  LK  LS  DI++D GN++F DT  R   L + 
Sbjct: 61  EFVAAIRPPRPIIIMIKAGDPVDQQMQALKSHLSAGDIMIDAGNANFRDTMRRFDTLKDS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E++Y RVE +L SI+AKY N PC A LG +G+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEESYRRVEKVLTSIAAKYDNDPCVAWLGENGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L     EI  +F  W+ G+L+SYLI+IT ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLKMTAQEIGEVFGAWNKGRLNSYLIEITEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D +TG PI+D+I DKA QKGTG  S+IE   +    T  E A+ AR++S  ++E + 
Sbjct: 241 KAADPLTGKPIVDLILDKAGQKGTGKWSVIEAQNMGVPATAIEAAVAARSISSMKEEREA 300

Query: 301 MQSFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            +      P   F +    +F+KDLE+AL A+ I ++ QGF V+  +S ++ W+L +  I
Sbjct: 301 AEKILGLPPVGEFKVADRRAFIKDLESALLAAKIGAYAQGFAVMSAASREFGWNLPMPVI 360

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWRAGCIIRSQ L++I  + T+ P + NL+  P+ +  VK+T  +LRR+V      G 
Sbjct: 361 ARIWRAGCIIRSQFLDEITTAFTKAPDAANLIVTPAFASMVKETDAALRRVVSAAVLGGL 420

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+L++AL YFD++   RGTAN+IQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 PVPALASALGYFDSYRRGRGTANVIQAQRDFFGAHGFDRVDGADSHHGPW 470


>gi|150396935|ref|YP_001327402.1| 6-phosphogluconate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150028450|gb|ABR60567.1| 6-phosphogluconate dehydrogenase, decarboxylating [Sinorhizobium
           medicae WSM419]
          Length = 476

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/470 (48%), Positives = 326/470 (69%), Gaps = 2/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+IG+IGLG MGSNL+LNI +KG ++AV+N+  + T  F  +   L  +++  + ++
Sbjct: 1   MSQAEIGLIGLGVMGSNLALNIAEKGNKIAVFNRTVDATRRFYAEAGALKDQIVPCETIQ 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GDPVDQ ++ LKP L+  DI++D GN++F DT  R   L + 
Sbjct: 61  EFVAAIRPPRPIIIMIKAGDPVDQQMEALKPHLAKGDIMIDAGNANFRDTMRRFDALKDS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E++Y RVE +L SI+AKY + PC A LG +G+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEESYRRVEKVLTSIAAKYDSDPCVAWLGENGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +  EI  +F  W+ G+L+SYLI+IT ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLKMSAQEIGEVFGAWNKGRLNSYLIEITEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D +TG PI+D+I DKA QKGTG  S+IE   +    T  E A+ AR++S  + E + 
Sbjct: 241 KAADPLTGNPIVDMILDKAGQKGTGKWSVIEAQNMGVPATAIEAAVAARSISSAKGEREA 300

Query: 301 MQSFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            +      P     +   D+F+KDLENAL A+ + ++ QGF V+  +S ++ W+L + TI
Sbjct: 301 AEKILGLPPVGEIRVTDRDAFIKDLENALLAAKVGAYAQGFAVMSAASNEFGWNLPMPTI 360

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+IWRAGCIIRSQ L++I  + T+ P + NL+  P+ +  VK+T  +LRR+V T    G 
Sbjct: 361 AKIWRAGCIIRSQFLDEITTAFTKAPDAANLIVTPAFAAMVKETDGALRRVVSTAVLGGL 420

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+L++AL YFD++   RGTAN+IQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 PVPALASALGYFDSYRRGRGTANVIQAQRDFFGAHGFDRIDGADSHHGPW 470


>gi|116252554|ref|YP_768392.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257202|emb|CAK08297.1| putative phosphogluconate dehydrogenase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 483

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 334/469 (71%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E
Sbjct: 8   VEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIE 67

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+  PR I++M+  G+PVDQ ++ L+P LS  DI++D GN++F DT  R  +L   
Sbjct: 68  EFVDAIRPPRPIVIMIKAGEPVDQQMELLRPHLSKGDIMIDAGNANFRDTVARFDRLKNT 127

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + FIG+GVSGG +GAR G S+MVGG E+++ RVE +L SI+A+Y + PC A LG DG+G
Sbjct: 128 DLTFIGMGVSGGEEGARHGPSIMVGGTEESWKRVEKVLTSIAARYNDEPCVAWLGNDGAG 187

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L K+  EIS +F +W+ G+L+SYLI+I+ ++L
Sbjct: 188 HFVKTIHNGIEYADMQMIAEIYGILRDGLGKSASEISGIFGEWNKGRLNSYLIEISEKVL 247

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 248 AATDPVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREA 307

Query: 301 MQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIA
Sbjct: 308 AEKIFGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIA 367

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L++I  + T+ P + NL+  P+ S+ VK++IP+LRR+V      G P
Sbjct: 368 RIWRAGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSDMVKESIPALRRVVGAAIAAGLP 427

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 428 VPALTSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGKDFHHGPW 476


>gi|209549700|ref|YP_002281617.1| 6-phosphogluconate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535456|gb|ACI55391.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 476

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 332/469 (70%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E
Sbjct: 1   MEKAEIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+  PR I++M+  GD VDQ ++ L+P LS  DI++D GN++F DT  R  +L + 
Sbjct: 61  EFVDAIRPPRPIIIMIKAGDAVDQQMEALRPHLSKGDIMIDAGNANFRDTVARFDRLKDT 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + FIG+GVSGG +GAR G S+MVGG E ++ RVE +L SI+A+Y + PC A LG DG+G
Sbjct: 121 DLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTSIAARYNDEPCVAWLGNDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +  +IS +F +W+ G+L+SYLI+I+ ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGMSASDISGIFGEWNKGRLNSYLIEISEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + + 
Sbjct: 241 AATDPVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREA 300

Query: 301 MQSFFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIA
Sbjct: 301 AEKIFGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L++I  + T+ P + NL+  P+ S+ VK++IP+LRR+V      G P
Sbjct: 361 RIWRAGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSDMVKESIPALRRVVAAAISAGLP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 VPALTSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGKDFHHGPW 469


>gi|15888851|ref|NP_354532.1| 6-phosphogluconate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15156614|gb|AAK87317.1| 6-phosphogluconate dehydrogenase, decarboxylating [Agrobacterium
           tumefaciens str. C58]
          Length = 476

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/469 (49%), Positives = 331/469 (70%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M+QA+IG+IGLG MGSNL+LNI +KG ++AV+N+  E+T  F      L  ++I  + +E
Sbjct: 1   MEQAEIGLIGLGVMGSNLALNIAEKGNKIAVFNRTPEVTRKFYADAGELQGQIIPCETIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GDPVDQ ++ LKP L+  DI++D GN++F DT  R   L + 
Sbjct: 61  EFVAAIRPPRPIIIMIKAGDPVDQQMEILKPHLANGDIMIDAGNANFRDTIRRFDNLKDS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E ++ RVE +L SISAKY + PC A LG DG+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTSISAKYNDDPCVAWLGNDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  + +EI+ +F++W+ G+L+SYLI+IT ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLKMSAVEIADVFAEWNKGRLNSYLIEITEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D ITG P++D+I DKA QKGTG  S+IE   +  + T  E A+ AR LS  +DE + 
Sbjct: 241 RAADPITGKPMVDLILDKAGQKGTGKWSVIEAQNMGVAATAIEAAVAARILSSQKDEREA 300

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F  P+         +F+ DLE+AL A+ + ++ QGF ++  +S++++W+L + TIA
Sbjct: 301 AEKIFGLPTLAAAPADKKAFIADLESALLAAKVGAYAQGFAIMSAASKEFNWNLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRS+ L++I  + T+DP   NL+  P+ S  VK T   LRR+V     +G P
Sbjct: 361 RIWRAGCIIRSEFLDEITSAFTKDPHVANLIVTPAFSAIVKDTDAPLRRVVSYAVLSGLP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V +L++AL YFD +   RG+ANLIQAQRDFFG+HGF+R D + +PHGPW
Sbjct: 421 VSALASALGYFDAYRRGRGSANLIQAQRDFFGAHGFERTDGVDKPHGPW 469


>gi|325292927|ref|YP_004278791.1| 6-phosphogluconate dehydrogenase [Agrobacterium sp. H13-3]
 gi|325060780|gb|ADY64471.1| 6-phosphogluconate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 476

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 330/469 (70%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M+QA+IG+IGLG MGSNL+LNI +KG ++AV+N+  E T  F  +   L  ++I  + +E
Sbjct: 1   MEQAEIGLIGLGVMGSNLALNIAEKGNKIAVFNRTPEATKKFYAEAGDLQGQLIPCETIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GDPVDQ ++ LKP LS  DI++D GN++F DT  R   L + 
Sbjct: 61  EFVAAIRPPRPIIIMIKAGDPVDQQMEILKPHLSNGDIMIDAGNANFRDTIRRFDNLKDS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E ++ RVE +L SISAKY + PC A LG DG+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTSISAKYNDDPCVAWLGNDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +  EI+ +F +W+ G+L+SYLI+IT ++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLKMSASEIADVFGEWNKGRLNSYLIEITEKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D ITG P++D+I DKA QKGTG  S+IE   +  + T  E A+ AR LS  +DE + 
Sbjct: 241 RAADPITGKPMVDLILDKAGQKGTGKWSVIEAQNMGVAATAIEAAVAARILSSQKDEREA 300

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F  P+         +F+ DLE+AL A+ + ++ QGF V+  +S++++W+L + TIA
Sbjct: 301 AEKIFGLPTVAAAPADKKAFIADLESALLAAKVGAYAQGFAVMSAASKEFNWNLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRS+ L++I  + T+DP   NL+  P+ S  VK T  +LRR+V     +G P
Sbjct: 361 RIWRAGCIIRSEFLDEITSAFTKDPHVANLIVTPAFSGIVKDTDAALRRVVSYAVLSGLP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V +L++AL YFD +   RG+ANLIQAQRDFFG+HGF+R D + +PHGPW
Sbjct: 421 VSALASALGYFDAYRRARGSANLIQAQRDFFGAHGFERTDGVDKPHGPW 469


>gi|218680858|ref|ZP_03528755.1| 6-phosphogluconate dehydrogenase [Rhizobium etli CIAT 894]
          Length = 472

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/465 (49%), Positives = 329/465 (70%), Gaps = 1/465 (0%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE 64
           +IG+IGL  MGSNL+LNI +KG ++AV+N+  E TD F +    L +++I  K +E+ V+
Sbjct: 1   EIGLIGLAVMGSNLALNIAEKGNKIAVFNRTPEKTDEFYESAGDLKKQIIPCKTIEEFVD 60

Query: 65  AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF 124
           A+  PR I++M+  GD VDQ ++ L+P LS  DI++D GN++F DT  R  +L    + F
Sbjct: 61  AIRPPRPIIIMIKAGDAVDQQMEALRPHLSKGDIMIDAGNANFRDTVARFDRLKNTDLTF 120

Query: 125 IGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVK 184
           IG+GVSGG +GAR G S+MVGG E+++ RVE +L SI+A+Y + PC A LG DG+GHFVK
Sbjct: 121 IGMGVSGGEEGARHGPSIMVGGTEESWKRVEKVLTSIAARYNDEPCVAWLGNDGAGHFVK 180

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
            IHNGIEYA+MQ+IA+IYGILRD L K+  +IS +F +W+ G+L+SYLI+I+ ++L+++D
Sbjct: 181 TIHNGIEYADMQMIAEIYGILRDGLGKSASDISGIFGEWNKGRLNSYLIEISEKVLAAND 240

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
            ++G P++D+I DKA QKGTG  S IE   +    T  E A+ AR+LS  + + +  +  
Sbjct: 241 PVSGGPMVDMILDKAGQKGTGKWSAIEAQNMGIPATAIEAAVAARSLSSMKSQREAAEKI 300

Query: 305 FNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
           F   +  FP+       KDLE AL+A+ I ++ QGF V+ ++S +++WSL + TIARIWR
Sbjct: 301 FGTQAVSFPIAYGPELNKDLELALFAAKIGAYAQGFAVMAEASREFNWSLPMPTIARIWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIRSQ L++I  + T+ P + NL+  P+ S+ VK++IP+LRR+V      G PVP+L
Sbjct: 361 AGCIIRSQFLDEITSAFTKAPDAANLIVTPAFSDMVKESIPALRRVVAAAISAGLPVPAL 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           ++AL+YFD +   RGTANLIQAQRDFFG+HGFDR D     HGPW
Sbjct: 421 TSALTYFDAYRQGRGTANLIQAQRDFFGAHGFDRLDGKDFHHGPW 465


>gi|163760531|ref|ZP_02167612.1| 6-phosphogluconate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162282146|gb|EDQ32436.1| 6-phosphogluconate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 492

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/468 (50%), Positives = 310/468 (66%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QADIG+IGLG MG+NL+LNI DKG+ +AVYN+    T+ F      LS ++  T  LE
Sbjct: 23  MAQADIGLIGLGVMGANLALNIADKGYHVAVYNRTQSRTEAFAAAAGPLSDRITATATLE 82

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V A+  PR +++MV  GDPVD+ I  LKPLL   DI++D GN++F DT  R   L   
Sbjct: 83  DFVAAIKPPRPVIIMVQAGDPVDEQIAALKPLLQDSDIIIDAGNANFRDTMRRFENLKGN 142

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  F+G+GVSGG +GAR G S+MVGG E  + R+E +L +ISAKY+  PC A LG +G+G
Sbjct: 143 GPGFVGMGVSGGAEGARHGPSIMVGGAEADWRRIEPVLTAISAKYKGEPCAAWLGDNGAG 202

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA++YG++RD LN + + I+ +FS W +G L SYLI ITAE+L
Sbjct: 203 HFVKTIHNGIEYADMQMIAEVYGVMRDHLNMDAVSIASVFSVWASGPLDSYLIDITAEVL 262

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D  +G P++DVI D A QKGTG  S+IE   +    T  E A+ AR+LS  R E   
Sbjct: 263 KTHDLASGKPLVDVIVDAAGQKGTGRWSVIESQMMGVPATAIEAAVAARSLSAMRGERAA 322

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            +  F   +    +   + + DLE AL A  I ++ QGF V+  +S+++ W+L +ATIAR
Sbjct: 323 AEHRFGLPAIVDRREGQAVIDDLEQALLAGKIAAYAQGFAVMAAASKEFDWNLPMATIAR 382

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRS+ L++I  + +E P   NL   P+ S  ++ T   LRR+V     NG P 
Sbjct: 383 IWRAGCIIRSRFLDEIAAAFSETPDVDNLAMTPAFSAMLEATDRPLRRVVSDAVINGLPA 442

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+LS A+SYFDT+   RGTANLIQAQRDFFGSHGF+R D   E HGPW
Sbjct: 443 PALSNAVSYFDTYRRARGTANLIQAQRDFFGSHGFERFDADGEQHGPW 490


>gi|13472886|ref|NP_104453.1| 6-phosphogluconate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14023633|dbj|BAB50239.1| 6-phosphogluconate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 475

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/469 (49%), Positives = 332/469 (70%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IG+IGLG+MGSNL+LNI + G R+AV+N+    TD F++    L   V+   +LE
Sbjct: 1   MEKAEIGLIGLGTMGSNLALNIAEHGHRIAVFNRTRARTDAFVENAGALKDMVVPCYSLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++  A+  PR I++MV  G PVD+ I+ L+ +LS  DI++D GN++F DT  R  +LS  
Sbjct: 61  ELAAAIRPPRPIIIMVLAGKPVDEQIEALRGVLSGNDIVIDAGNANFRDTMRRFSELSGS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E ++ RVE +L +ISAK+++ PC A LG DG+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTAISAKFKDEPCAAWLGTDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L   P +I  +FS W+ G+L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGMGPKDIGTVFSNWNKGRLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-K 299
           ++ D  TG P++D+I D+A QKGTG  S+IE  +L    T  E A+ AR LS  +DE   
Sbjct: 241 AADDPKTGKPVVDIILDRAGQKGTGKWSVIEAQQLGIPATAIEAAVAARVLSSIKDERLA 300

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +++ N          D+ +KDLE AL+A  I ++ QGF V+  +S++++W+L + TIA
Sbjct: 301 AEKAYGNIGVSKISGDKDALLKDLELALFAGKIAAYAQGFAVMSGASKEFNWNLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+ + ++ +   +STNLL  P+    +++  PSLRRIV   +E G P
Sbjct: 361 RIWRAGCIIRSQMLDTMAEAFSSGGASTNLLMAPAFISLMQEAHPSLRRIVAKASEAGAP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+LS+AL+YFD++   RGT+NLIQAQRDFFG+HGF+R D+    HGPW
Sbjct: 421 VPALSSALAYFDSYRQGRGTSNLIQAQRDFFGAHGFERIDEQGAFHGPW 469


>gi|222148756|ref|YP_002549713.1| 6-phosphogluconate dehydrogenase [Agrobacterium vitis S4]
 gi|221735742|gb|ACM36705.1| phosphogluconate dehydrogenase decarboxylating [Agrobacterium vitis
           S4]
          Length = 478

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 320/469 (68%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M+QA+IG+IGLG MGSNL+LNI +KG R+AV+N+    T  FI +   L+  +I    +E
Sbjct: 3   MQQAEIGLIGLGVMGSNLALNIAEKGNRIAVFNRTPARTHEFIGEAGDLAGNIIGCDTIE 62

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+  PR I++M+  GD VDQ ++ LKP LS  DI++D GN++F DT  R   L + 
Sbjct: 63  EFVAAIRPPRPIIIMIKAGDAVDQQMELLKPHLSANDIMIDAGNANFRDTIRRFDNLKDS 122

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E+++ RVE +L SISAK+   PC A LG DG+G
Sbjct: 123 GLTFIGMGVSGGEEGARHGPSIMVGGLEESWKRVEKVLTSISAKFNGDPCVAWLGNDGAG 182

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +  EI  +F +W+ G+L+SYLI+I+ ++L
Sbjct: 183 HFVKTIHNGIEYADMQMIAEIYGILRDGLGMSASEIGDVFGQWNKGRLNSYLIEISEKVL 242

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D ITG P++DVI D A QKGTG  S+IE   L  + T  E A+  R LS  + E   
Sbjct: 243 KAKDPITGNPMVDVIVDAAGQKGTGKWSVIEAQNLGIAATGIEAAVAGRVLSSQKQERVA 302

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  F  P          +F+ DLE+AL A+ I ++ QGF V+  +S+++ WSL + TIA
Sbjct: 303 AEGIFGLPKPVEKPHDGMAFLADLESALLAAKIAAYAQGFAVMAAASKEFGWSLPMPTIA 362

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWR GCIIRSQ L++I  + T+DP   NL+  P+ S+ VK +  +LRR+V     +G P
Sbjct: 363 KIWREGCIIRSQFLDEITSAFTKDPDVANLIVTPAFSKMVKDSDAALRRVVSYAALSGLP 422

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+LS+ALSYFD++   RGTANLIQAQRDFFG+HGF R D    PHGPW
Sbjct: 423 VPALSSALSYFDSYRRGRGTANLIQAQRDFFGAHGFARVDGKDYPHGPW 471


>gi|319781421|ref|YP_004140897.1| 6-phosphogluconate dehydrogenase decarboxylating [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167309|gb|ADV10847.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 475

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/469 (49%), Positives = 328/469 (69%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IG+IGLG+MGSNL+LNI + G R+AV+N+    TD F++    L   V+   +LE
Sbjct: 1   MEKAEIGLIGLGTMGSNLALNIAEHGHRIAVFNRTRARTDAFVENAGALRDMVVPCYSLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++  A+  PR I++MV  G PVD+ I  L+ +LS  DI++D GN++F DT  R  +LS  
Sbjct: 61  ELAAAIRPPRPIIIMVLAGKPVDEQIAALRGVLSANDIVIDAGNANFRDTMRRFSELSGS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E ++ RVE +L +ISAK+++ PC A LG DG+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTAISAKFKDEPCAAWLGTDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L   P EI  +F+ W+ G+L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGMGPKEIGTVFADWNKGRLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           ++ D  TG P++D+I D+A QKGTG  S+IE  +L    T  E A+ AR LS  +DE   
Sbjct: 241 AADDPKTGKPVVDIILDRAGQKGTGKWSVIEAQQLGIPATAIEAAVAARVLSSIKDERLA 300

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  +       +    D+ +KDLE AL+A  I ++ QGF V+  +S +++W+L + TIA
Sbjct: 301 AEKAYGNIGVTKISGDKDALLKDLELALFAGKIAAYAQGFAVMSGASNEFNWNLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+ + ++ ++  +STNLL  P+    ++   PSLRRIV   +E G P
Sbjct: 361 RIWRAGCIIRSQMLDTMAEAFSKGGASTNLLMAPAFISLMQGAHPSLRRIVARASEAGSP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+LS+AL+YFD++   RGT+NLIQAQRDFFG+HGF+R D     HGPW
Sbjct: 421 VPALSSALAYFDSYRQGRGTSNLIQAQRDFFGAHGFERIDDKGAFHGPW 469


>gi|260460436|ref|ZP_05808687.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mesorhizobium
           opportunistum WSM2075]
 gi|259033541|gb|EEW34801.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mesorhizobium
           opportunistum WSM2075]
          Length = 475

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/469 (48%), Positives = 328/469 (69%), Gaps = 1/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A+IG+IGLG+MGSNL+LNI + G R+AV+N+    TD F++    L   V+   +LE
Sbjct: 1   MEKAEIGLIGLGTMGSNLALNIAEHGHRIAVFNRTKARTDAFVENAGALRDMVVPCYSLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++  A+  PR I++MV  G PVD+ I+ L+ +LS  DI++D GN++F DT  R  +LS  
Sbjct: 61  ELAAAIRPPRPIIIMVLAGKPVDEQIEALRGVLSANDIVIDAGNANFRDTMRRFSELSGS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GAR G S+MVGG E ++ RVE +L +ISAK+++ PC A LG DG+G
Sbjct: 121 GLTFIGMGVSGGEEGARHGPSIMVGGTEDSWKRVEKVLTAISAKFKDEPCAAWLGTDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L   P +I  +F  W+ G+L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGMGPKDIGTVFETWNKGRLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           ++ D  TG P++D+I D+A QKGTG  S+IE  +L    T  E A+ AR LS  +DE + 
Sbjct: 241 AADDPKTGKPVVDIILDRAGQKGTGKWSVIEAQQLGIPATAIEAAVAARVLSSIKDERQA 300

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            Q  +       +    D+ +KDLE AL+A  I ++ QGF V+  +S++++W+L + TIA
Sbjct: 301 AQKAYGNIGVTKISGDKDALLKDLELALFAGKISAYAQGFAVMSGASKEFNWNLPMPTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWRAGCIIRSQ+L+ + ++     +STNLL  P+    +++  PSLRR V   +E G P
Sbjct: 361 KIWRAGCIIRSQMLDTMAEAFGSGGASTNLLMAPAFITMMQEAHPSLRRAVARASEAGSP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL+YFD++   RGT+NLIQAQRDFFG+HGF+R  +    HGPW
Sbjct: 421 VPALASALAYFDSYRQGRGTSNLIQAQRDFFGAHGFERIGEQGAFHGPW 469


>gi|110636270|ref|YP_676478.1| 6-phosphogluconate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110287254|gb|ABG65313.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Chelativorans
           sp. BNC1]
          Length = 472

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/471 (48%), Positives = 321/471 (68%), Gaps = 1/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG+IGLG+MG+NL+LNI +KGFR+AV+N+  E T  F ++   L+  ++    L+
Sbjct: 1   MEKADIGLIGLGTMGANLALNIAEKGFRIAVFNRTTERTHEFAQEAGSLAGNIVPCDTLQ 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +VE +  PR I++MV  G  VD+ I  L PL++ +DI++D GN++F DT+ R L+L++ 
Sbjct: 61  ALVEGIKPPRPIILMVPAGSVVDEQIAALDPLVARDDIIIDAGNANFRDTRRRMLELAKT 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG+GVSGG  GAR G S+MVGG +++Y R+E +L +I+A+Y+   C A LGPDG+G
Sbjct: 121 GPRFIGMGVSGGEDGARHGPSIMVGGPDESYRRIEPVLEAIAARYEGEACQAWLGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD       EI+ +F++W+ G+L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGHGLQAGEIAPIFAQWNDGRLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            +SD  TG PI+DVI D+A QKGTG  S IE   L    T  E A+ AR+LS  + E + 
Sbjct: 241 EASDPDTGKPIVDVILDRAGQKGTGRWSAIEAQSLGIPATAIEAAVAARSLSALKAERET 300

Query: 301 MQSFFNP-SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            +  +   ++          +  LE AL+A  I+++ QGF V+  +S ++ W+L L TIA
Sbjct: 301 AEKRYGSLAAAMAGSPGADELATLEAALFAGKIVAYAQGFSVMAAASREFGWNLPLGTIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ L  I ++    P + NLL   + S+ ++   P LRR+V    E G P
Sbjct: 361 RIWRAGCIIRSQFLGAIAEAFDGAPETDNLLMTEAFSQHMEAAHPRLRRVVAKSAEAGLP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPSLSAAL++FDTF   RGTANLIQAQRDFFG+HGF+R D     H  W++
Sbjct: 421 VPSLSAALAHFDTFRRGRGTANLIQAQRDFFGAHGFERVDSEGSHHASWKR 471


>gi|161620199|ref|YP_001594085.1| 6-phosphogluconate dehydrogenase [Brucella canis ATCC 23365]
 gi|254702542|ref|ZP_05164370.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|260568553|ref|ZP_05839022.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261753115|ref|ZP_05996824.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|161337010|gb|ABX63314.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella canis
           ATCC 23365]
 gi|260155218|gb|EEW90299.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261742868|gb|EEY30794.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 3 str. 686]
          Length = 469

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 310/469 (66%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGGV+GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGVEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|254695254|ref|ZP_05157082.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261215618|ref|ZP_05929899.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917225|gb|EEX84086.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 469

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/469 (47%), Positives = 310/469 (66%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG+ + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGLWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|23499876|ref|NP_699316.1| 6-phosphogluconate dehydrogenase [Brucella suis 1330]
 gi|62317067|ref|YP_222920.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|83269060|ref|YP_418351.1| 6-phosphogluconate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|148558279|ref|YP_001257177.1| 6-phosphogluconate dehydrogenase [Brucella ovis ATCC 25840]
 gi|163844307|ref|YP_001621962.1| 6-phosphogluconate dehydrogenase [Brucella suis ATCC 23445]
 gi|189022332|ref|YP_001932073.1| 6-phosphogluconate dehydrogenase [Brucella abortus S19]
 gi|225628586|ref|ZP_03786620.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella ceti
           str. Cudo]
 gi|225685973|ref|YP_002733945.1| 6-phosphogluconate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|237816627|ref|ZP_04595619.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella abortus
           str. 2308 A]
 gi|254698354|ref|ZP_05160182.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254706333|ref|ZP_05168161.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254711377|ref|ZP_05173188.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|254720645|ref|ZP_05182456.1| 6-phosphogluconate dehydrogenase [Brucella sp. 83/13]
 gi|254731798|ref|ZP_05190376.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 4 str. 292]
 gi|256014903|ref|YP_003104912.1| 6-phosphogluconate dehydrogenase [Brucella microti CCM 4915]
 gi|256029993|ref|ZP_05443607.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis M292/94/1]
 gi|256059645|ref|ZP_05449842.1| 6-phosphogluconate dehydrogenase [Brucella neotomae 5K33]
 gi|256111980|ref|ZP_05452931.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158157|ref|ZP_05456073.1| 6-phosphogluconate dehydrogenase [Brucella ceti M490/95/1]
 gi|256252892|ref|ZP_05458428.1| 6-phosphogluconate dehydrogenase [Brucella ceti B1/94]
 gi|256256633|ref|ZP_05462169.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 9 str. C68]
 gi|256262903|ref|ZP_05465435.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260166956|ref|ZP_05753767.1| 6-phosphogluconate dehydrogenase [Brucella sp. F5/99]
 gi|260544303|ref|ZP_05820124.1| 6-phosphogluconate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260759562|ref|ZP_05871910.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 4 str. 292]
 gi|260762807|ref|ZP_05875139.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882878|ref|ZP_05894492.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 9 str. C68]
 gi|261219980|ref|ZP_05934261.1| 6-phosphogluconate dehydrogenase [Brucella ceti B1/94]
 gi|261313778|ref|ZP_05952975.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261318982|ref|ZP_05958179.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261323616|ref|ZP_05962813.1| 6-phosphogluconate dehydrogenase [Brucella neotomae 5K33]
 gi|261756341|ref|ZP_06000050.1| 6-phosphogluconate dehydrogenase [Brucella sp. F5/99]
 gi|265985690|ref|ZP_06098425.1| 6-phosphogluconate dehydrogenase [Brucella sp. 83/13]
 gi|265987014|ref|ZP_06099571.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis M292/94/1]
 gi|265993429|ref|ZP_06105986.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996675|ref|ZP_06109232.1| 6-phosphogluconate dehydrogenase [Brucella ceti M490/95/1]
 gi|294853134|ref|ZP_06793806.1| 6-phosphogluconate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306837371|ref|ZP_07470250.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp. NF
           2653]
 gi|306841115|ref|ZP_07473833.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp.
           BO2]
 gi|306845487|ref|ZP_07478060.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp.
           BO1]
 gi|23463450|gb|AAN33321.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella suis
           1330]
 gi|62197260|gb|AAX75559.1| Gnd, 6-phosphogluconate dehydrogenase, decarboxylating [Brucella
           abortus bv. 1 str. 9-941]
 gi|82939334|emb|CAJ12275.1| NAD binding site:FAD-dependent pyridine nucleotide-disulphide
           oxidoreductase:Aromatic-ring
           hydroxylase:6-phosphogluconate deh [Brucella melitensis
           biovar Abortus 2308]
 gi|148369564|gb|ABQ62436.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella ovis
           ATCC 25840]
 gi|163675030|gb|ABY39140.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella suis
           ATCC 23445]
 gi|189020906|gb|ACD73627.1| 6-phosphogluconate dehydrogenase [Brucella abortus S19]
 gi|225616432|gb|EEH13480.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella ceti
           str. Cudo]
 gi|225642078|gb|ACO01991.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella
           melitensis ATCC 23457]
 gi|237787440|gb|EEP61656.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella abortus
           str. 2308 A]
 gi|255997563|gb|ACU49250.1| 6-phosphogluconate dehydrogenase [Brucella microti CCM 4915]
 gi|260097574|gb|EEW81448.1| 6-phosphogluconate dehydrogenase [Brucella abortus NCTC 8038]
 gi|260669880|gb|EEX56820.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 4 str. 292]
 gi|260673228|gb|EEX60049.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260872406|gb|EEX79475.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 9 str. C68]
 gi|260918564|gb|EEX85217.1| 6-phosphogluconate dehydrogenase [Brucella ceti B1/94]
 gi|261298205|gb|EEY01702.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261299596|gb|EEY03093.1| 6-phosphogluconate dehydrogenase [Brucella neotomae 5K33]
 gi|261302804|gb|EEY06301.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261736325|gb|EEY24321.1| 6-phosphogluconate dehydrogenase [Brucella sp. F5/99]
 gi|262550972|gb|EEZ07133.1| 6-phosphogluconate dehydrogenase [Brucella ceti M490/95/1]
 gi|262764299|gb|EEZ10331.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092740|gb|EEZ16949.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659211|gb|EEZ29472.1| 6-phosphogluconate dehydrogenase [Brucella pinnipedialis M292/94/1]
 gi|264664282|gb|EEZ34543.1| 6-phosphogluconate dehydrogenase [Brucella sp. 83/13]
 gi|294818789|gb|EFG35789.1| 6-phosphogluconate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|306274138|gb|EFM55957.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp.
           BO1]
 gi|306288836|gb|EFM60150.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp.
           BO2]
 gi|306407563|gb|EFM63763.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella sp. NF
           2653]
 gi|326410296|gb|ADZ67360.1| 6-phosphogluconate dehydrogenase [Brucella melitensis M28]
 gi|326553590|gb|ADZ88229.1| 6-phosphogluconate dehydrogenase [Brucella melitensis M5-90]
          Length = 469

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/469 (47%), Positives = 309/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|254699422|ref|ZP_05161250.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261749872|ref|ZP_05993581.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261739625|gb|EEY27551.1| 6-phosphogluconate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 469

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/469 (47%), Positives = 309/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLTAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|17989469|ref|NP_542102.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|260564266|ref|ZP_05834751.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17985349|gb|AAL54366.1| 6-phosphogluconate dehydrogenase, decarboxylating [Brucella
           melitensis bv. 1 str. 16M]
 gi|260151909|gb|EEW87002.1| 6-phosphogluconate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 469

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/469 (47%), Positives = 309/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 ADKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|254691448|ref|ZP_05154702.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 6 str. 870]
 gi|260757068|ref|ZP_05869416.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 6 str. 870]
 gi|260677176|gb|EEX63997.1| 6-phosphogluconate dehydrogenase [Brucella abortus bv. 6 str. 870]
          Length = 469

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/469 (47%), Positives = 309/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P++ +ALSYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPAIGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|254711977|ref|ZP_05173788.1| 6-phosphogluconate dehydrogenase [Brucella ceti M644/93/1]
 gi|254715047|ref|ZP_05176858.1| 6-phosphogluconate dehydrogenase [Brucella ceti M13/05/1]
 gi|261216751|ref|ZP_05931032.1| 6-phosphogluconate dehydrogenase [Brucella ceti M13/05/1]
 gi|261319618|ref|ZP_05958815.1| 6-phosphogluconate dehydrogenase [Brucella ceti M644/93/1]
 gi|260921840|gb|EEX88408.1| 6-phosphogluconate dehydrogenase [Brucella ceti M13/05/1]
 gi|261292308|gb|EEX95804.1| 6-phosphogluconate dehydrogenase [Brucella ceti M644/93/1]
          Length = 469

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/469 (47%), Positives = 308/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   FI+K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+++AKYQ  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            S+D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  + E ++
Sbjct: 241 KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               +   +    +     F+ DLE  L A  I ++ QGF V+  +S ++ W++ LAT A
Sbjct: 301 AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI ++  E   S NLL  P+   +++ ++ SLR+IV        P
Sbjct: 361 RIWRAGCIIRSQLLDDIAQAF-EGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +A SYFD++    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSAFSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPW 468


>gi|85703318|ref|ZP_01034422.1| 6-phosphogluconate dehydrogenase [Roseovarius sp. 217]
 gi|85672246|gb|EAQ27103.1| 6-phosphogluconate dehydrogenase [Roseovarius sp. 217]
          Length = 466

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/468 (44%), Positives = 312/468 (66%), Gaps = 4/468 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA IGI GLG+MGS L+LN+ + GF +AV N++ +    F+++ S  S ++   + L 
Sbjct: 1   MAQAQIGIYGLGTMGSALALNMAEHGFDVAVTNRETDWIAPFVEEASAFSARLYPKERLT 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V A+  PR IL M+  G P+D +++++ PLLSP D ++DGGN+ F DT+ R+ QL+E+
Sbjct: 61  DFVAALRTPRVILFMIPSGAPMDAMLEEITPLLSPGDTVIDGGNADFHDTRRRAAQLTER 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            ++F+G+GVSGG  GAR G S+M+GG+  ++ ++E IL SI+A Y  +PC A LGPDG+G
Sbjct: 121 DLHFVGLGVSGGEAGARHGPSMMLGGSRHSWAQLEPILTSIAATYDGTPCVAHLGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ+IA+IY +LR+     P EI  LF+ WD G L SYL++ITA++L
Sbjct: 181 HFVKTVHNGIEYADMQVIAEIYSLLRNGSAMPPAEIGALFADWDRGLLKSYLVEITAQLL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           + +D  TG P++DVI D A QKGTG  ++IE  ++  S ++ E A+ AR  S  +D  ++
Sbjct: 241 TYTDPETGHPMVDVIKDAAGQKGTGRWTVIEALRMGQSASMIEAAVGARGWSSEKDTRQR 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            ++    +    +  FD   + L  A  A+ IL++ QGF ++  +SE+Y WSL  ATIAR
Sbjct: 301 AETLLGGA----VGAFDGTPEVLAEAFLAARILAYAQGFRILSAASEEYHWSLDAATIAR 356

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRS +L+DI  +         L+  P +++ + + IPSLR++V +    G+PV
Sbjct: 357 IWRAGCIIRSALLDDIAAAFDLGLPQDELILSPQMAQTLSRCIPSLRQVVCSAVHGGHPV 416

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+LSA L+++D+     G+AN+IQAQRD FG HGF+R  +    HGPW
Sbjct: 417 PALSAGLAWYDSMRLGHGSANIIQAQRDMFGHHGFERLGRTGLHHGPW 464


>gi|119385121|ref|YP_916177.1| 6-phosphogluconate dehydrogenase [Paracoccus denitrificans PD1222]
 gi|119374888|gb|ABL70481.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paracoccus
           denitrificans PD1222]
          Length = 466

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 308/469 (65%), Gaps = 8/469 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +A IG+IGLG+MG+ L+LNI +KGF +AV+N+  E+T  F  +   L+ +V+ T++L 
Sbjct: 1   MTKAKIGLIGLGTMGAALALNIAEKGFPIAVWNRTTEVTRRFHAQAGALADRVVPTESLA 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V A+  PR I++MV  G  VD  I  L PLL PED+++D GN++F DT  R+   +  
Sbjct: 61  ELVAAIAPPRAIVLMVPAGPAVDDQIAALAPLLGPEDLVIDAGNANFHDTDRRAA--AGL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
            + F+G+GVSGG +GAR G ++M GG    ++R+  ++ +I+A+ ++ +PC A +G  G+
Sbjct: 119 PMRFLGMGVSGGEEGARHGPAIMGGGARADWDRIAPVMEAIAARAEDGTPCAAWMGEAGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVK +HNGIEYA+MQ+IA++YG++RD L      I   F+ W+ G L SYL++I+A +
Sbjct: 179 GHFVKTVHNGIEYADMQMIAEVYGLMRDGLGMPAAAIGETFAAWNRGTLKSYLVEISAAV 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            ++SD +TG P++DVI D A QKGTG  + IE   L++ + + E A+ ARN+S   DE +
Sbjct: 239 AAASDPLTGAPMLDVILDAAGQKGTGRWTAIEAQHLAAPIPVIEAAVAARNVSARLDERR 298

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             ++ F        +  +  + +LE AL A  IL + QGF +I  S   + W L L  IA
Sbjct: 299 AGEARFGAGP----QALELALPELEAALIAGKILCYAQGFAMIEASGRAFGWRLDLPGIA 354

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           R+WRAGCIIRS +LND+  +L EDPS  NL+  P  +E+++  IP+LRR+V     +G+ 
Sbjct: 355 RVWRAGCIIRSAMLNDMASALAEDPSR-NLVLAPFFAERLQAAIPALRRVVAQGVLHGHA 413

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L A L +FD     RGTAN+IQAQRDFFG+HGFDR D     HGPW
Sbjct: 414 LPALGAGLGWFDLMRTGRGTANMIQAQRDFFGAHGFDRLDGQDNHHGPW 462


>gi|149204775|ref|ZP_01881738.1| 6-phosphogluconate dehydrogenase [Roseovarius sp. TM1035]
 gi|149141744|gb|EDM29797.1| 6-phosphogluconate dehydrogenase [Roseovarius sp. TM1035]
          Length = 464

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/465 (44%), Positives = 307/465 (66%), Gaps = 4/465 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IGI GLG+MGS L+LNI + GF +AV N++ +    F+ +   L+ ++   + LE  V
Sbjct: 2   AQIGIYGLGTMGSALALNIAEHGFDVAVTNREVDWIAPFMTEAGDLAVRLHPHEQLEAFV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR IL M+  G P+D ++ ++ PLLSP D ++DGGN+ F DT+ R+ QL+E+ ++
Sbjct: 62  AALNTPRVILFMIPSGPPMDAMLAQITPLLSPGDTVIDGGNADFHDTRRRAAQLAERDLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG  GAR G S+M+GG++ ++ ++E IL +I+A+Y   PC A LGPDG+GHFV
Sbjct: 122 FVGLGVSGGEAGARQGPSMMLGGSDHSWAQLEPILTAIAARYDGIPCVARLGPDGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+MQ+IA+IY +LR+     P EI  LF+ WD G L SYL++ITA +L+ +
Sbjct: 182 KTVHNGIEYADMQVIAEIYSLLRNGAALPPAEIGALFAAWDLGPLKSYLVEITARLLTYT 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D A QKGTG  ++IE  +L  S ++ E A+ AR  S  +   ++ ++
Sbjct: 242 DPETGHPMVDVIKDAAGQKGTGRWTVIEALRLGQSASMIEAAVGARGWSSEKPTRQRAEA 301

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
               +    +  FD   + L  A  A+ +L++ QGF ++  +S+ + W L LATIARIWR
Sbjct: 302 ILGGA----VGAFDDTPEVLAEAFLAARLLTYAQGFRILAAASDAHGWGLDLATIARIWR 357

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIRS +L+DI  +   D     L+  P I++   + +P+LR++V +    G+PVP+L
Sbjct: 358 AGCIIRSALLDDIADAFDRDLPQGELILAPEIAQTFARCLPALRQVVCSAVHGGHPVPAL 417

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           SA L+++D+     G+AN+IQAQRD FG HGF+R  +    HGPW
Sbjct: 418 SAGLAWYDSMRLGHGSANIIQAQRDMFGRHGFERLGRAGLHHGPW 462


>gi|118588259|ref|ZP_01545668.1| 6-phosphogluconate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118438965|gb|EAV45597.1| 6-phosphogluconate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 479

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/466 (45%), Positives = 315/466 (67%), Gaps = 3/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A+IG+IGLG+MG NL+LNI + GF++AV+N+  E TD F+ K   L+ K++ TK LE+ V
Sbjct: 13  AEIGLIGLGTMGGNLALNIAEHGFQIAVFNRTTEKTDQFMTKAGELAPKLVPTKTLEEFV 72

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR +++MV  GD VD  I+ L+PLL   D+++D GN+++ DT  R+   +EKG  
Sbjct: 73  ASIKTPRAVILMVPAGDAVDAQIEALRPLLDAGDLIIDAGNANYHDTNRRAADAAEKGPR 132

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+GIGVSGG +GAR G S+M GG + A+++V +IL +ISAK++ +PC A LG  G+GH V
Sbjct: 133 FMGIGVSGGEEGARFGPSIMGGGAKDAWDQVGHILEAISAKHEETPCAAYLGEAGAGHLV 192

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+MQ+IA++YG++RD    +  EI  +F KW+ G L SYLI+I+ ++  ++
Sbjct: 193 KTVHNGIEYADMQMIAEVYGVMRDGFGMSASEIGDVFEKWNGGILQSYLIEISGKVAKTA 252

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I DKA QKGTG  + IE   L +  +  E A+  RN+S   +E K+ ++
Sbjct: 253 DPDTGKPMLDIILDKAGQKGTGRWTAIEALMLGTPASAIEAAVAVRNMSARYEERKEGEA 312

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
            F  ++   +      +  LE AL A  I+ + QGF +I +++++Y W++ L  IA+IWR
Sbjct: 313 EFG-AAPTGMDREAVAIDALEAALVAGKIICYAQGFGLILEAAKQYGWAMPLPEIAKIWR 371

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIRS +LND+  +L+ D +  NL+  P  S K+K+T   LR++V     +G PVP+L
Sbjct: 372 NGCIIRSSMLNDMSSALS-DNAERNLMLAPFFSAKLKETEAMLRQVVAQSAMHGLPVPAL 430

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI-SEPHGPW 468
           SAALSYFD     R TAN++Q QRDFFG+HGF+R DK  S  HGPW
Sbjct: 431 SAALSYFDIMRTGRSTANMLQGQRDFFGAHGFERTDKDGSGYHGPW 476


>gi|153011548|ref|YP_001372762.1| 6-phosphogluconate dehydrogenase [Ochrobactrum anthropi ATCC 49188]
 gi|151563436|gb|ABS16933.1| 6-phosphogluconate dehydrogenase, decarboxylating [Ochrobactrum
           anthropi ATCC 49188]
          Length = 470

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 305/469 (65%), Gaps = 2/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   F++K   L  K+I     E
Sbjct: 1   MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFMEKAGPLRDKIIPCPTFE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 61  DLAANIRKPRPIIFLIKAGAPVDAETTRLKAYLEKGDIMIDAGNSDYRDTVRRLKALGPN 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+ +AKY+  PCCAL+GPDG+G
Sbjct: 121 DPTFVGMGVSGGAEGARHGPSMMVGGTEEAYERIAPILLAAAAKYKGEPCCALVGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 181 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  +   + 
Sbjct: 241 KATDPETGKAMVDMILDEAGQKGTGRWAAIEAQMLGVPATAIEAAVAARSLSSLKATREL 300

Query: 301 MQSFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               + P S    +     F+ DLE  L A  I ++ QGF V+  +S+++ W++ LA  A
Sbjct: 301 AAKAYKPGSRSLDISDQAKFLADLEQGLLAGKIAAYAQGFAVMEAASQEHGWNIPLAETA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIRSQ+L+DI  +  ED  S NLL  P+  E++ K    LR+IV      G P
Sbjct: 361 RIWRAGCIIRSQLLDDIAHAF-EDSESRNLLLAPAFVERMSKASKGLRQIVAKAALAGLP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L +ALSYFD+F    GTANLIQ QRDFFGSHGF R DK  + HGPW
Sbjct: 420 LPALGSALSYFDSFTQALGTANLIQGQRDFFGSHGFKRIDKDGDFHGPW 468


>gi|239834464|ref|ZP_04682792.1| 6-phosphogluconate dehydrogenase, decarboxylating [Ochrobactrum
           intermedium LMG 3301]
 gi|239822527|gb|EEQ94096.1| 6-phosphogluconate dehydrogenase, decarboxylating [Ochrobactrum
           intermedium LMG 3301]
          Length = 509

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/470 (48%), Positives = 307/470 (65%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ADIG++GLG MGSNL+LNI +KG+ +AVY++D  +   F++K   L  K+I     E
Sbjct: 40  MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFLEKAGPLRDKIIACPTFE 99

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +   + KPR I+ ++  G PVD    +LK  L   DI++D GNS + DT  R   L   
Sbjct: 100 DLAANIRKPRPIIFLIKAGAPVDAETTRLKAYLEKGDIMIDAGNSDYRDTVRRLKALGPN 159

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVGG E+AY R+  ILL+ +AKY++ PCCAL+GPDG+G
Sbjct: 160 DPTFVGMGVSGGAEGARHGPSMMVGGTEEAYERIAPILLAAAAKYKDEPCCALVGPDGAG 219

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK IHNGIEYA+MQ+IA+IYGILRD L  +   I  +F KW+ G L+SYLI+ITA++L
Sbjct: 220 HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNQGPLNSYLIEITAKVL 279

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            ++D  TG  ++D+I D+A QKGTG  + IE   L    T  E A+ AR+LS  +     
Sbjct: 280 KATDPETGKAMVDMILDEAGQKGTGRWAAIEAQMLGVPATAIEAAVAARSLSSLKAARAL 339

Query: 301 MQSFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
               +NP     L+  D   F+ DLE  L A  I ++ QGF V+  +S+++ W++ LA  
Sbjct: 340 AAKAYNPGQR-SLEISDQAKFLADLEQGLLAGKIAAYAQGFAVMEAASQEHGWNIPLAET 398

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWRAGCIIRSQ+L+DI  +  ED  S NLL  P+  E++ K    LR+IV      G 
Sbjct: 399 ARIWRAGCIIRSQLLDDIAHAF-EDSESRNLLLAPAFVERMSKASNGLRQIVAKAALAGL 457

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+P+L +ALSYFD+F    GTANL+Q QRDFFGSHGF R DK  + HGPW
Sbjct: 458 PLPALGSALSYFDSFTQALGTANLLQGQRDFFGSHGFKRIDKDGDFHGPW 507


>gi|254503746|ref|ZP_05115897.1| 6-phosphogluconate dehydrogenase, decarboxylating [Labrenzia
           alexandrii DFL-11]
 gi|222439817|gb|EEE46496.1| 6-phosphogluconate dehydrogenase, decarboxylating [Labrenzia
           alexandrii DFL-11]
          Length = 474

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/466 (45%), Positives = 315/466 (67%), Gaps = 3/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A+IG+IGLG+MG NL+LNI D GF++AV+N+  E TD F++K   L++K++  K+LE  V
Sbjct: 8   AEIGLIGLGTMGGNLALNIADNGFQIAVFNRTPEKTDQFMEKAGPLAEKLLPNKSLEDFV 67

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR I++MV  GD VD  I  L+PLL  +D+++D GN+++ DT  R+ +  +KG  
Sbjct: 68  ASISSPRAIILMVPAGDAVDAQIAALRPLLEADDLIIDAGNANYHDTNRRAQEAGKKGPR 127

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+GIGVSGG +GAR G S+M GG++ A++RV +IL +ISAKY++ PC A LG DG+GH V
Sbjct: 128 FMGIGVSGGEEGARFGPSIMGGGDKSAWDRVGHILEAISAKYEDEPCAAFLGADGAGHLV 187

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+MQ+IA++YG++RD    +  ++  +F +W+ G L SYLI+I+ ++  ++
Sbjct: 188 KTVHNGIEYADMQMIAEVYGVMRDGFGMSAADVGEVFDRWNGGILQSYLIEISGKVAKTA 247

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D A QKGTG  + IE   L +  +  E A+ ARN+S    E +K + 
Sbjct: 248 DPETGKPMLDIILDTAGQKGTGRWTAIEALMLGTPASAIEAAVAARNMSARLGEREKGEQ 307

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
            F  +     K     +  LE AL A  I+ + QGF +I +++++Y W + L  IARIWR
Sbjct: 308 VFGAAPQRMDKDLIG-IDALEAALVAGKIICYAQGFGLILEAAKQYGWDMPLPEIARIWR 366

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIRS +LND+  +L++D +S NL+  P  ++K+K+T   LR++V     +G PVP+L
Sbjct: 367 NGCIIRSAMLNDMSSALSDD-ASRNLMLAPFFTKKLKETEVKLRQVVAQAALHGLPVPAL 425

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP-HGPW 468
           SAALSYFD     R TAN++Q QRDFFG+HGF+R D      HGPW
Sbjct: 426 SAALSYFDIMRTQRSTANMLQGQRDFFGAHGFERTDTDGGGYHGPW 471


>gi|307944644|ref|ZP_07659984.1| 6-phosphogluconate dehydrogenase, decarboxylating [Roseibium sp.
           TrichSKD4]
 gi|307772393|gb|EFO31614.1| 6-phosphogluconate dehydrogenase, decarboxylating [Roseibium sp.
           TrichSKD4]
          Length = 481

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/467 (46%), Positives = 312/467 (66%), Gaps = 4/467 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+IGLG+MG NL LNI +KGF +AV+N+  E T+ F ++   L++ ++   +L+  V
Sbjct: 13  AQIGLIGLGTMGRNLMLNIAEKGFPIAVFNRTSERTEAFHEEAGELAKNIVPALDLKSFV 72

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL-SEKGI 122
           EA+  PR I++MV  G+ VD  I  LKPLLS +D+++D GN+++ DT  R+ +     G 
Sbjct: 73  EAIKPPRAIILMVPAGEAVDAQIAALKPLLSRDDLIIDAGNANYHDTNRRAEEAEGGDGP 132

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+GIGVSGG +GAR+G S+M GG + A+++V +IL +ISAKY+   C A LG  G+GH 
Sbjct: 133 RFMGIGVSGGEEGARNGPSIMGGGAQDAWDQVGHILEAISAKYEGEACAAFLGTAGAGHL 192

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VK +HNGIEYA+MQ+IA++YG++RD L  +  EI  +F+K + G L SYLI+I+A++  +
Sbjct: 193 VKTVHNGIEYADMQMIAEVYGVMRDGLGSSAAEIGDVFAKLNEGILQSYLIEISAKVAGT 252

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D+ TG P++D+I D A QKGTG  + IE   L +  +  E A+ +RN+S   DE K+ Q
Sbjct: 253 NDSETGKPMLDIILDTAGQKGTGRWTAIEALMLGTPASTIEAAVASRNMSARLDERKQGQ 312

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             F  +    L       + +E AL A  I+ + QGF +I +++++Y WS+ L  IARIW
Sbjct: 313 EVFGAAPQ-KLGGHPVTPEMIEAALVAGKIICYAQGFGLILEAAKQYGWSMPLPEIARIW 371

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIRS +LND+  +L EDP+  NL+  P  +EK+K+T  +LR +V     NG PVP+
Sbjct: 372 RNGCIIRSAMLNDMATALGEDPNR-NLMFAPFFAEKLKETHQALRELVSIAVLNGLPVPA 430

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI-SEPHGPW 468
           LSAALSYFD     R TAN++Q  RDFFG+HGF+R DK  S  HGPW
Sbjct: 431 LSAALSYFDVMRTGRSTANMLQGLRDFFGAHGFERTDKDGSGFHGPW 477


>gi|90420484|ref|ZP_01228391.1| 6-phosphogluconate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335212|gb|EAS48965.1| 6-phosphogluconate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 474

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 300/474 (63%), Gaps = 7/474 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + ADIG+ GLG+MG+NL+LNI +KGFR+AV+N+  E          G+   V+    L++
Sbjct: 4   RPADIGVYGLGTMGANLALNIAEKGFRVAVFNRTVEKGFALRDDNPGIGDNVVPASTLKE 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR +L MV  G  VD  I ++ PLLSP D+++D GN+ F DT  RS  +   G
Sbjct: 64  FVASLKSPRLVLFMVPAGKIVDAEIAEVAPLLSPGDVMIDAGNADFNDTVRRSRDVEGTG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           + F+G+GVSGG  GAR G S+MVGG +  Y ++E IL  I+AKY+ +PC A LGPDG+GH
Sbjct: 124 LNFVGMGVSGGELGARHGPSIMVGGAKDTYPQLEPILTKIAAKYEGAPCVAWLGPDGAGH 183

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVK IHNGIEYA+MQ+IA+IYGI+RD +      ++ +F +W+ G LSSYLI+ITA  L+
Sbjct: 184 FVKTIHNGIEYADMQMIAEIYGIMRDGMGMQADAMAAIFGEWNKGGLSSYLIEITAVNLA 243

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++D+I D+A QKGTG  ++IE  KL    T  E A+ AR +S  R E  + 
Sbjct: 244 EKDPETGKPLVDLIVDEAGQKGTGRWAVIEAQKLGVGATTIEAAVSARGVSSRRSERAEA 303

Query: 302 QSFF----NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
             F+      ++ F  +   + + +LE AL  + I+++ QG+  +  +SE++ W+L L T
Sbjct: 304 SRFYAGIATEAADFSAEA--AGIAELEQALETAKIIAYAQGYATMASASEEFGWNLPLGT 361

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA IWRAGCIIRSQ L+DI  +  E     NLL  P+   +V+    +LR++V   +  G
Sbjct: 362 IAEIWRAGCIIRSQFLDDIAGAY-ETGGVVNLLQSPAFIGRVEAGQTALRKVVAKASMAG 420

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
            PVP+LSAAL+YFD +   RGT NL QAQRD FG+H F R D+    H  W  V
Sbjct: 421 IPVPALSAALAYFDDYRRARGTTNLTQAQRDLFGAHTFHRLDRDGVFHHRWPAV 474


>gi|83952798|ref|ZP_00961528.1| 6-phosphogluconate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83835933|gb|EAP75232.1| 6-phosphogluconate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 471

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 309/471 (65%), Gaps = 10/471 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +A IG+ GLG+MGS L+LN+ + G R+AV N++ +    F+ +   L++ ++    LE
Sbjct: 5   MAKAQIGVYGLGTMGSALALNMAEAGIRVAVTNREADWIARFVTEAGALAENIVPQDGLE 64

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++  PR IL M+  G P+D +I+ + PLLSP D ++DGGN++F DT+ RS  L+ +
Sbjct: 65  AFVASLVTPRVILFMIPSGAPMDAMIEAIAPLLSPGDTIIDGGNANFHDTRRRSAALATQ 124

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            ++F+G+GVSGG +GAR G S+MVGG++ ++ +++ +L +I+A+Y   PC A LGPDG+G
Sbjct: 125 DLHFVGMGVSGGEEGARHGPSMMVGGSDHSWAQLKPLLEAIAARYGEDPCVAHLGPDGAG 184

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ IA+IY +      K P EI  +F++WD G L SYL++IT ++L
Sbjct: 185 HFVKTVHNGIEYADMQAIAEIYTLEHHGAAKIPEEIGAMFTRWDAGPLKSYLLEITGKLL 244

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDE 297
           + +D  TG P++DVI D A QKGTG  ++IE  ++  S ++ E A+ AR  S     R E
Sbjct: 245 TYTDPETGHPMVDVIWDAAGQKGTGRWTVIEALRMGQSASMIEAAVGARGWSSEKYTRVE 304

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           ++K+       +   ++C +  + D   A  A+ ILS+ QGF ++  +SE+Y W L +A 
Sbjct: 305 AEKILG----GARGAMECSEEVLAD---AFMAARILSYAQGFRILKAASEEYDWQLDMAR 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA IWRAGCIIRS IL+DI ++   D     L+  P  ++ + + IPSLR++V     +G
Sbjct: 358 IAEIWRAGCIIRSAILDDISEAFQGDIPHGELILAPRFAQTLAQCIPSLRQVVSQAVHSG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + VP+L+A LS++DT     G+AN+IQAQRDFFG HGF++     + HGPW
Sbjct: 418 HAVPALAAGLSWYDTMRQGWGSANIIQAQRDFFGYHGFEKFGVEGQFHGPW 468


>gi|126727008|ref|ZP_01742846.1| 6-phosphogluconate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126703680|gb|EBA02775.1| 6-phosphogluconate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 469

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 206/467 (44%), Positives = 304/467 (65%), Gaps = 5/467 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG+MG+ LSLNI DKGF ++V N+     D  + +   L+ ++  T +L   VE+
Sbjct: 5   IGLIGLGTMGAALSLNIADKGFTISVTNRSPGRVDDLMAEAGDLASRITPTYDLAAFVES 64

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPR I++M+  GD +D+ +  L+PLL  +D+++D GN++F DT  R+      G  F+
Sbjct: 65  LAKPRAIILMLPAGDVIDRQMADLRPLLDADDLIIDAGNANFHDTNRRAAAAVAAGERFL 124

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIGVSGG +GAR G S+M GG++ A+ RV  IL +ISAKYQ   C   +G  G+GHFVK 
Sbjct: 125 GIGVSGGEEGARHGPSIMGGGDQVAWARVAPILGAISAKYQGQDCATWMGAGGAGHFVKA 184

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQ+IA++YGILRD + +   EI   F +W+ G L SYLI+I+ E+  ++D 
Sbjct: 185 VHNGIEYADMQMIAEVYGILRDGMGQGAAEIGAAFGEWNKGTLQSYLIEISGEVGLATDP 244

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
             G P++D+I DKA QKGTG  ++IE   L + + + E A+ ARN+S   D+ K  ++ F
Sbjct: 245 EGGAPMLDIILDKAGQKGTGRWTVIEAQHLGAPIPVIEAAVTARNVSAMLDQRKTGENVF 304

Query: 306 NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAG 365
             +   P K       DLE A+ A  I+ + QGF ++ ++S  + W L +  IA +WR G
Sbjct: 305 GAA---PEKLTAVNFDDLEGAMIAGKIMCYAQGFDLLTEASGSFEWDLPMPDIAEVWREG 361

Query: 366 CIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSA 425
           CIIRS +LND+  +L E+ +S NL+  P  ++ +++  P+LR++V     +G PVP+L+A
Sbjct: 362 CIIRSAMLNDMATALGEN-ASLNLMFSPFFADLLRQHSPALRKVVAAAMSHGLPVPALAA 420

Query: 426 ALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKIS-EPHGPWQKV 471
           ALSY+D     RGTAN+IQ QRDFFG+HGF+R DK   + HGPW + 
Sbjct: 421 ALSYYDMMRTARGTANMIQGQRDFFGAHGFERTDKDGRDYHGPWARA 467


>gi|89055743|ref|YP_511194.1| 6-phosphogluconate dehydrogenase [Jannaschia sp. CCS1]
 gi|88865292|gb|ABD56169.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Jannaschia sp.
           CCS1]
          Length = 463

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 304/469 (64%), Gaps = 10/469 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QADIG+IGLG+MGS L+LNI +KGF +AV+N+    T  F+ +   L+ ++  T+ LE
Sbjct: 1   MAQADIGLIGLGTMGSALALNIAEKGFSVAVWNRTTSKTHAFVAEAGDLATRITATETLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +  A+  PR I++MV  G PVD  I+ L P L  +D+++D GN++F DT +R ++  E+
Sbjct: 61  DLAAALKGPRAIVLMVPAGQPVDDQIEALDPYLDADDLIIDAGNANFRDT-MRRMEALER 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+GIGVSGG  GAR G ++M GG+   + RVE IL +I+A Y+++PC  L+G +G+G
Sbjct: 120 --PFLGIGVSGGEDGARHGPAIMGGGDPDHWARVEPILTAIAANYEDTPCADLMGENGAG 177

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQLIA+ YG++RD L     ++  +F++W+TG+LSS+LI+ +A++ 
Sbjct: 178 HFVKAVHNGIEYADMQLIAETYGVMRDGLAMEAPQVGDVFAEWNTGRLSSFLIETSAKVA 237

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S+ D  T  P+++VI D A QKGTG  + IE   L + + + E A+ ARN+S  RD    
Sbjct: 238 SAHDAATDGPLLEVIVDAAGQKGTGRWTAIEAQHLGTPIPVIEAAVAARNMSALRDLRAD 297

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +   F  +     +  D  +  LE AL    IL + QGF ++  +++ + WSL    IAR
Sbjct: 298 LAETFGGT-----QKIDIPIDILERALTCGKILCYAQGFDMLRAAADAFDWSLKPEVIAR 352

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
            WRAGCIIRS +L+D+ ++    P +T L+  P  S+ + +TI +LR  V+     G PV
Sbjct: 353 NWRAGCIIRSSMLDDMAEAFEAAPGAT-LMAAPYFSDILSETISALRDTVIAANRAGLPV 411

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK-ISEPHGPW 468
           P++SAALSYFDT    RGTAN+IQ QRD+FG HGF R D    + HGPW
Sbjct: 412 PAMSAALSYFDTMRQARGTANMIQGQRDYFGLHGFVRLDTGDKDQHGPW 460


>gi|304394066|ref|ZP_07375989.1| 6-phosphogluconate dehydrogenase, decarboxylating [Ahrensia sp.
           R2A130]
 gi|303293506|gb|EFL87883.1| 6-phosphogluconate dehydrogenase, decarboxylating [Ahrensia sp.
           R2A130]
          Length = 470

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/462 (45%), Positives = 308/462 (66%), Gaps = 2/462 (0%)

Query: 7   GIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAV 66
           G+IGLG+MG+NL+LNI+D G+ LAV+N+  ++T  F+   + L+ K+  T+ LE  V+A+
Sbjct: 9   GLIGLGTMGANLALNIVDNGYDLAVFNRTTQVTKDFVTDAADLASKLTGTETLEDFVDAM 68

Query: 67  CKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIG 126
            +PR I++MV  G  VD+ I+ L+PLL  +D+++D GN+++ DT  R+     K  +F+G
Sbjct: 69  AEPRNIILMVPAGPVVDKQIEALRPLLGDDDLIIDAGNANYHDTNRRAEDAQNKPGHFLG 128

Query: 127 IGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMI 186
           IGVSGG +GAR G S+M GG++ A++RVE +L +ISAK+++ PC   +G  G+GHFVKM+
Sbjct: 129 IGVSGGSEGARHGPSIMGGGDKAAWDRVEEMLQAISAKHEDIPCATYMGAGGAGHFVKMV 188

Query: 187 HNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTI 246
           HNGIEYA+MQ+IA+IYG LRD L  +   I  +F KW+ G+LSSYLI+I+A +  + D  
Sbjct: 189 HNGIEYADMQMIAEIYGFLRDGLQMDAKAIGDVFEKWNEGQLSSYLIEISAAVAKADDAK 248

Query: 247 TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFN 306
           TG P++D+I D A QKGTG  + IE   + S +T  + A+ ARNLS   DE K+ +  F+
Sbjct: 249 TGKPVLDIIVDSAGQKGTGRWTAIEALMIGSPVTAIDAAVAARNLSSRMDERKRGEELFD 308

Query: 307 PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGC 366
            +    +   D  ++ LE AL A  I  + QGF ++  +S +Y W L +A IA++WR GC
Sbjct: 309 AAPQ-AIAAGDLPMEMLEQALLAGKIACYAQGFAMLQTASTEYEWGLPMAEIAKVWREGC 367

Query: 367 IIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAA 426
           IIRS +L+D+  +L +    TNL+     +  +K +   LR++V   + +G  VP+LSAA
Sbjct: 368 IIRSSMLDDMATAL-DGNEDTNLMFTEPFTGLMKDSHNDLRKVVSQGSLSGNAVPALSAA 426

Query: 427 LSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           LSYFD     RGTAN++Q QRDFFG+H F R D+  + HGPW
Sbjct: 427 LSYFDIMRTSRGTANMVQGQRDFFGAHSFKRFDEDGDHHGPW 468


>gi|163747263|ref|ZP_02154618.1| 6-phosphogluconate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161379538|gb|EDQ03952.1| 6-phosphogluconate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 482

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/471 (44%), Positives = 314/471 (66%), Gaps = 9/471 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG+MGS L+LN+ D GF +AV N++ E    F+ +   LS+++I  + LE+ V
Sbjct: 17  ADIGVYGLGTMGSALALNLADSGFTVAVSNREAEWIAPFLDEAGPLSERLIGAEQLEEFV 76

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR IL M+  G PVD +I+ +KPLL   D L+DGGN+ F DT+ RS  L   G++
Sbjct: 77  AAIARPRSILFMIPSGAPVDAMIEAIKPLLDKGDTLIDGGNADFHDTRRRSAALEGTGLH 136

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG  GAR+G S+MVGG++ ++ + + +  +I+A++  SPC A LGPDG+GHFV
Sbjct: 137 FVGMGVSGGEAGARNGPSMMVGGSDHSWEQFKPMAEAIAAQFDGSPCVAHLGPDGAGHFV 196

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+MQ+IA++YG+LRD+  +  +EI +LF++W  G LSSYLI+++A  L S 
Sbjct: 197 KTVHNGIEYADMQMIAEVYGLLRDAGGQGAVEIGNLFAEWQKGPLSSYLIEVSAAALLSV 256

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           DT T  P++DVI D+A QKGTG  ++IE  K+  S    E A+ AR  S      K ++ 
Sbjct: 257 DTQTDTPMVDVIRDQAGQKGTGRWTLIEALKMGQSANTIEAAVGARGWS----SEKAVRE 312

Query: 304 FFNPSSHFPLKCFDSFV---KDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
              P    P    D+ +   +DLE AL A  I+   QGF ++  +SE++ WSL +A I+ 
Sbjct: 313 MAEPL--LPEGVQDAPLPEAEDLEMALLAGRIIGHAQGFRILSAASEEFEWSLDMARISE 370

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRS +L++   +   +    +L+  P++ ++++ +IP+LRR+V      G  +
Sbjct: 371 IWRAGCIIRSALLDEFADAFRGELPGGHLILAPAMRKRLEDSIPALRRVVAAGALLGVAL 430

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
           P+LSAAL+++D+    RGTAN+IQAQRDFFG+HGF+R +   + HG W  +
Sbjct: 431 PALSAALAWYDSMRRARGTANMIQAQRDFFGAHGFERTEGEGKFHGTWNPL 481


>gi|254471055|ref|ZP_05084458.1| 6-phosphogluconate dehydrogenase, decarboxylating [Pseudovibrio sp.
           JE062]
 gi|211960197|gb|EEA95394.1| 6-phosphogluconate dehydrogenase, decarboxylating [Pseudovibrio sp.
           JE062]
          Length = 475

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 300/471 (63%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QADIG++GLG MG+NL+LNI D G+++AV+N+  E T  F++K   L    I   + E
Sbjct: 1   MTQADIGLVGLGVMGANLALNIADNGYKVAVFNRTAEGTQAFMEKAGHLKDMFIPCYSTE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V  +  PR I++MV  G PVDQ I  LK  L   DIL+D GNS F D+  R  +L++ 
Sbjct: 61  ELVANIKAPRPIILMVPAGAPVDQQISVLKDHLKDGDILIDAGNSDFHDSNRRYKELADT 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
              F+G+GVSGG +GAR G S+MVG +E AY R+E IL +ISAK+ + PC AL+GP+G+G
Sbjct: 121 PFTFVGMGVSGGAEGARFGPSIMVGASETAYARIEPILKAISAKHNDEPCVALMGPEGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ+IA+++ ++  +L  +  E + +FSKW+ G L+SYLI+ITA ++
Sbjct: 181 HFVKTLHNGIEYADMQMIAEVHEVMTSTLGLSIQEQAEIFSKWNEGPLASYLIEITANVM 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  +G PI+DVI D A QKGTG  S +E H L    T  + A+ AR LS  R+  ++
Sbjct: 241 GVVDEESGKPILDVILDTAGQKGTGRWSAVEAHMLGVPATGIDAAVAARCLSSARELRQE 300

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           +   + P S   L   +    +   E AL A  I ++ +GF V+    ++  W L +  I
Sbjct: 301 IADIY-PQSDAILTWEEKQEGIAACERALIAGKISAYAEGFAVLAAGGKENGWDLPMGDI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIRS+ L++I ++  E+P   +L   P+I E++K  +P LR ++  C  NG 
Sbjct: 360 ARIWRQGCIIRSRFLDEIAQAYDENPELKSLYLAPAIIERMKDAVPGLRDVLSLCVTNGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI-SEPHGPW 468
           P P+LSAAL+ FD     R  A +IQ QRDFFG HGF+R DK  S  HGPW
Sbjct: 420 PTPALSAALASFDMIRQKRTAAYVIQGQRDFFGQHGFERTDKEGSGFHGPW 470


>gi|295399070|ref|ZP_06809052.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312110326|ref|YP_003988642.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           Y4.1MC1]
 gi|294978536|gb|EFG54132.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311215427|gb|ADP74031.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           Y4.1MC1]
          Length = 470

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/471 (44%), Positives = 300/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+K+  G  + ++ T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLKEAEG--KNIVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DIL+DGGN++F DTQ R+ +L+E 
Sbjct: 59  EFVNALEKPRKILLMVKAGAPTDATIEQLKPYLEKGDILIDGGNTYFKDTQRRNKELAEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVNGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  N  E+  +F++W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGLNAQELHEVFAEWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 239 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFISAMKDERVK 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +  +  P +   D F++ +  ALY S I S+ QGF  +  +S++Y+W+L    IA
Sbjct: 299 ASKLLSGPAVKPFEGDRDRFIEAVRRALYMSKICSYAQGFAQMKAASDEYNWNLQYGNIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP   NLL  P   E V+    +LR I+      G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDRDPQLPNLLLDPYFKEIVENYQEALREIIAVAVMRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP+ S+AL+Y+D++  +   ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPAFSSALAYYDSYRMETLPANLIQAQRDYFGAHTYERVDKEGVFHTEWLK 469


>gi|255263219|ref|ZP_05342561.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thalassiobium
           sp. R2A62]
 gi|255105554|gb|EET48228.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thalassiobium
           sp. R2A62]
          Length = 467

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/465 (43%), Positives = 290/465 (62%), Gaps = 4/465 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GLG+MGS L+LN+ D GF +AV N++ +  D FIK+  GLS  +   K LE  +
Sbjct: 5   AQIGVYGLGTMGSALALNMADNGFDVAVTNRETDWIDDFIKEGDGLSGTLTGHKTLEDFI 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             +  PR IL M+  G P+D +I+ + PLLS  D ++DGGN+ F  T+ RS  L+EK ++
Sbjct: 65  AGIQAPRTILFMIPSGAPMDAMIETVMPLLSKGDTIIDGGNADFHLTRRRSALLAEKDLH 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG  GAR G S+MVGG   +++R++ I  +I+AK++  PC   LGPDG+GHFV
Sbjct: 125 FVGMGVSGGENGARHGPSMMVGGTADSWSRLKPIASAIAAKFEGDPCVDHLGPDGAGHFV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+M++IA+ Y +LR     +  +I  L ++WD G L SYL++IT + L  +
Sbjct: 185 KTVHNGIEYADMEMIAEAYKLLRYGAGWSAADIGKLMTEWDAGALKSYLVEITGKTLQET 244

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++IE  K+  S +  E A+ AR  S  +        
Sbjct: 245 DPKTGKPVVDIILDRAGQKGTGRWTVIEAIKMGQSASAIEGAVAARAWSAEKATRVAGAK 304

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
                     +  D    DL +AL A+ IL + QGF ++  ++ ++ W L  A IA IWR
Sbjct: 305 IIGDDR----EQLDLSATDLHDALMAARILGYAQGFRILTAAAAEFDWPLDYARIAEIWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIRS +L+DI  +  +      L   PS+ EK+  TIP+LRR+ +     GY VP+L
Sbjct: 361 AGCIIRSALLDDISDAFRQGTPEGQLYLAPSMVEKLNDTIPALRRVCIAAIGGGYSVPAL 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             AL+++DT    RGTA++IQ QRD+FG HGF+R D     HGPW
Sbjct: 421 FGALAFYDTMRQSRGTADVIQMQRDYFGHHGFERVDAEGAHHGPW 465


>gi|324998681|ref|ZP_08119793.1| 6-phosphogluconate dehydrogenase, decarboxylating [Pseudonocardia
           sp. P1]
          Length = 478

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/473 (42%), Positives = 296/473 (62%), Gaps = 1/473 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           +++ IG+ GL  MG+NL+ N+  +GF +AV+N+    T  F+K   G        ++L++
Sbjct: 3   EKSRIGVTGLAVMGANLARNMARRGFGVAVHNRTTSKTTEFMKDY-GHEGSFTGAESLQE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+A+  PRKI++MV  G PVD +ID+L PLL   DI++D GNSHF DT  R+   +E+G
Sbjct: 62  FVDALETPRKIVVMVKAGKPVDAVIDELAPLLDSGDIIIDAGNSHFPDTDRRAAYCAERG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           + F+GIGVSGG +GA +G S+M GG  +AY  V  IL +I+A+   +PCC  +GP G+GH
Sbjct: 122 LRFMGIGVSGGEEGALNGPSIMPGGPVEAYGEVSEILTAIAAEVDGTPCCTHVGPGGAGH 181

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEYA++QLIA+ Y +L      +  EI  +  +W+TG L S+LI+IT  +L+
Sbjct: 182 YVKMVHNGIEYADIQLIAEAYDLLSHVGGLSAPEIGKIVEQWNTGDLESFLIEITGIVLA 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
            +D  TG P++DVI D+A QKGTG  + I+   L   +T    A+FAR LS  RDE K  
Sbjct: 242 KTDEKTGTPLVDVITDQAEQKGTGRWTAIDALDLGVPLTGITEAVFARTLSALRDERKAA 301

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
            +     +       D  V+D+  ALYAS ++++ QGF  +  +S+   W L L  +ARI
Sbjct: 302 STTLAGPAQQRTANVDQLVEDVRQALYASKVVAYAQGFAQMRAASQANGWDLDLGAMARI 361

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+Q LN I ++    P   NLL +P  +E V     + RR+VVT TENG  +P
Sbjct: 362 WRGGCIIRAQFLNRITEAYETHPDLDNLLMVPYFTEAVGAAQDAWRRVVVTATENGVAIP 421

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           + S++LSY+D +  +RG ANLIQ  RD+FG+H ++R D   + H  W +   E
Sbjct: 422 AFSSSLSYYDGYRRERGPANLIQGLRDYFGAHTYERIDADGKFHTRWSQDGAE 474


>gi|83943966|ref|ZP_00956423.1| 6-phosphogluconate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83845213|gb|EAP83093.1| 6-phosphogluconate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 475

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/478 (41%), Positives = 302/478 (63%), Gaps = 17/478 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +K ADIG+ GLG+MGS LSLN+ ++GFR+AV N++ +    F+++   L+ ++     LE
Sbjct: 5   LKTADIGVYGLGTMGSALSLNLAEQGFRVAVSNREADWIAPFLEEAGPLAGQLSGHATLE 64

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V+++ +PR IL M+  G P+D +ID + PLL   D ++DGGN+ F DT+ R+      
Sbjct: 65  DFVDSIAQPRSILFMIPSGAPMDAMIDAVMPLLDEGDTIIDGGNADFHDTRRRAAAFDGT 124

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G +F+G+GVSGG +GAR G S+MVGG + ++ ++  +L +I+AK+Q +PC   LGPDG+G
Sbjct: 125 GRHFVGMGVSGGEEGARHGPSMMVGGTDHSWTQLRPMLSAIAAKFQGAPCVDHLGPDGAG 184

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ+IA++YG+LRD+  +   +I  LF  W  G LSSYLI+++A  L
Sbjct: 185 HFVKTVHNGIEYADMQMIAEVYGLLRDAGGQTAPQIGALFESWQKGPLSSYLIEVSAAAL 244

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D  +G P++D+I DKA QKGTG  ++IE  KL  S++  E A+ AR  S      K 
Sbjct: 245 QTVDAESGAPMVDLILDKAGQKGTGRWTLIEALKLGQSVSTIEAAVGARGWS----SEKA 300

Query: 301 MQSFFNP-------SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSL 353
           ++    P           P +       ++++AL A+ IL   QGF V+  +S+++ W L
Sbjct: 301 LRVAAAPLLPDAVTGGTLPTE------DEMKSALLAARILGHAQGFRVLSAASDEFGWQL 354

Query: 354 SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTC 413
            +A IA IWRAGCIIRS +L+D+  +         L+  P+I + +   +  LR+ V   
Sbjct: 355 DMARIAEIWRAGCIIRSALLDDLADAFHAGLPEGALILAPAIRDMLGDHLAGLRKTVAAG 414

Query: 414 TENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
              G P+P+LSA+L+++D+    RG+ANLIQAQRDFFG+HGF+R D     HG W  +
Sbjct: 415 VSLGVPMPALSASLAWYDSIRTARGSANLIQAQRDFFGAHGFERGDIAGAHHGTWNAI 472


>gi|239827629|ref|YP_002950253.1| 6-phosphogluconate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807922|gb|ACS24987.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           WCH70]
          Length = 471

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/471 (44%), Positives = 299/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+K+  G  + ++ T ++E
Sbjct: 2   MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLKEAKG--KNIVGTYSIE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DIL+DGGN++F DTQ R+ +L+E 
Sbjct: 60  EFVNALEKPRKILLMVKAGAPTDATIEQLKPYLEKGDILIDGGNTYFKDTQRRNKELAEL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 120 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  N  E+  +F++W+ G+L+SYLI+ITA+I 
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGLNAQELHEVFAEWNKGELNSYLIEITADIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 240 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFISAMKDERVK 299

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +  +  P +   + F++ +  ALY S I S+ QGF  +  +S++Y+W+L    IA
Sbjct: 300 ASKLLSGPAVKPFEGDRARFIEAVRRALYMSKICSYAQGFAQMKAASDEYNWNLQYGNIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I  +   DP   NLL  P   E V+    +LR I+      G P
Sbjct: 360 MIFRGGCIIRAQFLQKIKDAYDRDPQLPNLLLDPYFKEIVENYQEALREIIAIAVMRGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP+ S+AL+Y+D++  +   ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 420 VPAFSSALAYYDSYRMETLPANLIQAQRDYFGAHTYERVDKEGVFHTEWLK 470


>gi|254487902|ref|ZP_05101107.1| 6-phosphogluconate dehydrogenase, decarboxylating [Roseobacter sp.
           GAI101]
 gi|214044771|gb|EEB85409.1| 6-phosphogluconate dehydrogenase, decarboxylating [Roseobacter sp.
           GAI101]
          Length = 475

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/473 (44%), Positives = 300/473 (63%), Gaps = 13/473 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG+MGS L+LN+ D GF++AV NK+ +    F+++   L+  +   + L + V
Sbjct: 8   ADIGVYGLGTMGSALALNLADHGFKVAVSNKETDWIAPFLQEAGPLAPHLTGAQTLTEFV 67

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR IL M+  G P+D +ID + PLL   D ++DGGN+ F DT+ RS      G +
Sbjct: 68  AAIARPRSILFMIPSGAPMDAMIDAILPLLDDGDTIIDGGNADFNDTRRRSAAFKGTGRH 127

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG +GAR G S+MVGG   +++++  ++ +I+AK+   PC A LGPDG+GHFV
Sbjct: 128 FVGMGVSGGAEGARHGPSMMVGGTAHSWDQLRPMVQAIAAKFDGDPCVAHLGPDGAGHFV 187

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEYA+MQ+IA++YG+LRD+  ++  +I  LF +W  G LSSYLI+++A  L + 
Sbjct: 188 KTVHNGIEYADMQMIAEVYGLLRDAGGQSAPDIGALFERWQDGPLSSYLIEVSAAALQTI 247

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++IE  KL  S +  E A+ AR  S      K  + 
Sbjct: 248 DPETGQPLVDMILDQAGQKGTGRWTLIEALKLGQSASTIEAAVGARGWS----SEKGTRV 303

Query: 304 FFNPSSHFPLKCFDSFV-----KDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              P     L    + V      DLE AL A+ IL  TQGF ++  +S ++ W L +A I
Sbjct: 304 AAEPQ----LPAMAAHVDLPEPADLERALLAARILGHTQGFRILSAASAEFDWQLDMARI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           + IWRAGCIIRS +L+D   +   D     L+  P+IS+ ++ +I SLRR+V      G 
Sbjct: 360 SEIWRAGCIIRSALLDDFAAAFRGDLPLNELVLAPAISDMLEDSIASLRRVVAAAVMAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
            VP+L AAL+++DT    RGTA+LIQAQRDFFG+HGF R D     HG W +V
Sbjct: 420 AVPALGAALAWYDTIRRGRGTADLIQAQRDFFGAHGFARVDAEGRHHGDWNRV 472


>gi|83954539|ref|ZP_00963250.1| 6-phosphogluconate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83840823|gb|EAP79994.1| 6-phosphogluconate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 475

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/478 (41%), Positives = 300/478 (62%), Gaps = 17/478 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           +K ADIG+ GLG+MGS L+LN+ ++GFR+AV N++ +    F+++   L+  +     LE
Sbjct: 5   LKTADIGVYGLGTMGSALALNLAEQGFRVAVSNREADWIAPFLEEAGPLAGHLSGHATLE 64

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V+++ +PR IL M+  G P+D +ID + PLL   D ++DGGN+ F DT+ R+      
Sbjct: 65  DFVDSIAQPRSILFMIPSGAPMDAMIDAVMPLLDEGDTIIDGGNADFHDTRRRAAAFDGT 124

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G +F+G+GVSGG +GAR G S+MVGG + ++ ++  +L +I+AK+Q +PC   LGPDG+G
Sbjct: 125 GRHFVGMGVSGGEEGARHGPSMMVGGTDHSWTQLRPMLSAIAAKFQGAPCVDHLGPDGAG 184

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ+IA++YG+LRD+  +   +I  LF  W  G LSSYLI+++A  L
Sbjct: 185 HFVKTVHNGIEYADMQMIAEVYGLLRDAGGQTAPQIGALFESWQKGPLSSYLIEVSAAAL 244

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D  +G P++D+I DKA QKGTG  ++IE  KL  S +  E A+ AR  S      K 
Sbjct: 245 QTVDAESGTPMVDLILDKAGQKGTGRWTLIEALKLGQSASTIEAAVGARGWS----SEKA 300

Query: 301 MQSFFNP-------SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSL 353
           ++    P           P +       ++++AL A+ IL   QGF V+  +S+++ W L
Sbjct: 301 LRVAAAPLLPDAVTGGTLPTE------DEMKSALLAARILGHAQGFRVLSAASDEFGWQL 354

Query: 354 SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTC 413
            +A IA IWRAGCIIRS +L+D+  +         L+  P+I + +   +  LR+ V   
Sbjct: 355 DMARIAEIWRAGCIIRSALLDDLADAFHAGLPEGALILAPAIRDMLGDHLAGLRKTVAAG 414

Query: 414 TENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
              G P+P+LSA+L+++D+    RG+ANLIQAQRDFFG+HGF+R D     HG W  +
Sbjct: 415 VSLGVPMPALSASLAWYDSIRTARGSANLIQAQRDFFGAHGFERGDIAGAHHGTWNAI 472


>gi|307718128|ref|YP_003873660.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta
           thermophila DSM 6192]
 gi|306531853|gb|ADN01387.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta
           thermophila DSM 6192]
          Length = 487

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 297/465 (63%), Gaps = 7/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +ADIG+IGL  MG NL+LNI DKG+R+AV+N+  E  D F+   +G  + V     LE
Sbjct: 1   MTKADIGLIGLAVMGQNLALNINDKGYRIAVFNRTVEKVDDFLAGPAGGRETVYGAHTLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V  + +PRKI++MV  G  VD+ I KL PLL P D+++DGGNSHF D+  R+ +L+EK
Sbjct: 61  EFVSLLSRPRKIILMVKAGAVVDEFIRKLLPLLEPGDLIIDGGNSHFSDSTRRTRELAEK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGS 179
           GI FIG G+SGG +GAR G S+M GGN +A+  V+ I  +ISAK  +  PCC  +GP+G+
Sbjct: 121 GILFIGTGISGGEEGARHGPSMMPGGNPEAWPLVKEIFQAISAKTPDGQPCCDWVGPEGA 180

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA++Y I++  L  +   +S +F +W+ GKL SYLI+IT +I
Sbjct: 181 GHFVKMVHNGIEYGDMQLIAEVYHIMKSLLGLSHERMSGIFDRWNRGKLGSYLIEITRDI 240

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D   G P+++ I D A QKGTG  + IE       +T+   A+FAR+LS ++DE  
Sbjct: 241 LAFKDE-DGGPLVEKILDAAGQKGTGKWTGIEALDHGVPVTLIVEAVFARSLSSFKDERV 299

Query: 300 KMQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                       P K  +      V DLE AL A+ ++S+ QGF ++ ++S  Y W L  
Sbjct: 300 HAAEVLG-EPLVPWKGTEEERARLVDDLEKALLAAKMVSYAQGFMLMREASHTYGWDLDF 358

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             IA +WRAGCIIRS  L+ I ++   +P  +NLL  P   E + +   S RR+V T   
Sbjct: 359 GKIATLWRAGCIIRSVFLDTIREAYRNEPGLSNLLLAPYFKETILEAEASWRRVVSTAVT 418

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           +G P P+LS+ALS+ D +   R  ANLIQAQRD+FG+H ++R D+
Sbjct: 419 HGIPTPALSSALSFLDGYRTSRLPANLIQAQRDYFGAHTYERVDR 463


>gi|315185296|gb|EFU19073.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Spirochaeta
           thermophila DSM 6578]
          Length = 487

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/465 (44%), Positives = 296/465 (63%), Gaps = 7/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +ADIG+IGL  MG NL+LNI D+G+ +AV+N+  E  D F+   +G  + V     LE
Sbjct: 1   MAKADIGLIGLAVMGQNLALNINDRGYSIAVFNRTVEKVDDFLAGPAGGRETVYGAHTLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V  + +PRKI++MV  G  VD+ I KL PLL P D+++DGGNSHF D+  R+ +L+EK
Sbjct: 61  EFVSLLLRPRKIILMVKAGAVVDEFIRKLLPLLEPGDLIIDGGNSHFSDSTRRTRELAEK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGS 179
           GI FIG G+SGG +GAR G S+M GGN +A+  V+ I  +ISAK  +  PCC  +GP+G+
Sbjct: 121 GILFIGTGISGGEEGARHGPSMMPGGNPEAWPLVKEIFQAISAKTPDGQPCCDWVGPEGA 180

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA++Y I++  L  +   +S +F +W+ GKL SYLI+IT +I
Sbjct: 181 GHFVKMVHNGIEYGDMQLIAEVYHIMKSLLGLSHDRMSEIFDRWNRGKLGSYLIEITRDI 240

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D   G P+++ I D A QKGTG  + IE       +T+   A+FAR+LS ++DE  
Sbjct: 241 LAYKDE-DGSPLVEKILDAAGQKGTGKWTGIEALDHGVPVTLIVEAVFARSLSAFKDERV 299

Query: 300 KMQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                       P K  +      V DLE AL A+ ++S+ QGF ++ ++S  Y W L  
Sbjct: 300 HAAELLG-EPLVPWKGTEEERSRLVDDLEKALLAAKMVSYAQGFMLMREASRTYGWDLDF 358

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             IA +WRAGCIIRS  L+ I ++   +P  +NLL  P   E + +   S RR+V T   
Sbjct: 359 GKIATLWRAGCIIRSVFLDTIREAYRNEPGLSNLLLAPYFKETILEAEASWRRVVSTAVT 418

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           +G P P+LS+ALS+ D +   R  ANLIQAQRD+FG+H ++R D+
Sbjct: 419 HGIPTPALSSALSFLDGYRTSRLPANLIQAQRDYFGAHTYERVDR 463


>gi|138895930|ref|YP_001126383.1| 6-phosphogluconate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196248821|ref|ZP_03147521.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           G11MC16]
 gi|134267443|gb|ABO67638.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196211697|gb|EDY06456.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           G11MC16]
          Length = 470

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 300/469 (63%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGYSVAVYNRSREKTDEFLEEAKG--KNIVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DIL+DGGN++F DTQ R+ +L++ 
Sbjct: 59  EFVNALEKPRKILLMVKAGAPTDATIEQLKPYLEKGDILIDGGNTYFKDTQRRNEELAKL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 239 TKIDDETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFISAMKDERVK 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +  +  P +   D F++ +  ALY S I S+ QGF  +  +S++Y+W+L    IA
Sbjct: 299 ASKLLSGPAVKPFEGDRDHFIEAVRRALYMSKICSYAQGFAQMKAASDEYNWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+  NLL  P     V+    SLR IV T    G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDRDPALPNLLLDPYFKNIVESYQDSLREIVATAAMRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++AL+Y+D++ ++   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPAFASALAYYDSYRNEVLPANLIQAQRDYFGAHTYERVDKEGIFHTEW 467


>gi|56420879|ref|YP_148197.1| 6-phosphogluconate dehydrogenase [Geobacillus kaustophilus HTA426]
 gi|56380721|dbj|BAD76629.1| 6-phosphogluconate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 469

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/471 (44%), Positives = 300/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLQEAKG--KNIVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DI++DGGN++F DTQ R+ +L+E 
Sbjct: 59  EFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR LS  +DE  K
Sbjct: 239 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVK 298

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P +   + F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA
Sbjct: 299 ASKVLAGPAVKPFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+ +NLL  P   + V++   +LR IV T    G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDPYFKDIVERYQDALREIVATAAMRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  ++AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPGFASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 469


>gi|297529491|ref|YP_003670766.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           C56-T3]
 gi|297252743|gb|ADI26189.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           C56-T3]
          Length = 469

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/471 (44%), Positives = 299/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLQEAKG--KNIVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DIL+DGGN++F DTQ R+ +L+E 
Sbjct: 59  EFVNALEKPRKILLMVKAGAPTDATIEQLKPHLGKGDILIDGGNTYFKDTQRRNKELAEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G ++M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPAIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR LS  +DE  K
Sbjct: 239 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVK 298

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P +   + F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA
Sbjct: 299 ASKVLAGPAVKPFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+  NLL  P   + V++   +LR IV T    G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDRDPALPNLLLDPYFKDIVERYQDALREIVATAAMRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  ++AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPGFASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 469


>gi|260426735|ref|ZP_05780714.1| 6-phosphogluconate dehydrogenase, decarboxylating [Citreicella sp.
           SE45]
 gi|260421227|gb|EEX14478.1| 6-phosphogluconate dehydrogenase, decarboxylating [Citreicella sp.
           SE45]
          Length = 466

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 291/468 (62%), Gaps = 4/468 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M    IGI GLG+MGS L+LN+ +KG  +AV N+  E    F ++   L+  V    +L 
Sbjct: 1   MAAPRIGIYGLGTMGSALALNMAEKGVPIAVSNRSDEPIGAFAQRAEPLAGDVTTAPDLL 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +V A+ +PR +L M+    P+D L+D++ PLL   D ++D GN+ F DT+ R+ +L+E 
Sbjct: 61  ALVAALPRPRLLLAMIPSTGPLDALLDEVIPLLDAGDTVIDAGNADFHDTRRRAARLAEH 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G++F+G+GVSGG  GAR G S+M GG+E+++  ++ +L  I+A++   PC   +GPDG+G
Sbjct: 121 GMHFVGLGVSGGEDGARHGPSMMFGGSEESWAGLQPLLEPIAARFGEDPCVGRMGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQ+IA++Y +LR     +P +++  F  W+ G L SYL +ITA++L
Sbjct: 181 HFVKTVHNGIEYADMQMIAEVYDLLRHGTGLSPEQVADRFEAWNDGPLGSYLYEITAKVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D +    ++D I D A QKGTG  + IE  +L  S T+ E A+ AR  S  +D    
Sbjct: 241 RAQDPLGDGVMVDAILDVAGQKGTGRWTAIEAVRLGQSATMIEGAVAARAWSSEKDLRGA 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +   F           D  +  LE AL ++ +L + QGF ++  +SE+++W L  A +A 
Sbjct: 301 LGDAFGDGRE--TLALDPEL--LETALLSARVLEYAQGFRILAAASEEFAWELDFARVAE 356

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WRAGCIIR+++L+DI ++  E P    L+  P      +  IP+LRR+V      G+P+
Sbjct: 357 VWRAGCIIRAKLLDDISEAFREGPPLDQLVLAPRFGAIFEAGIPALRRVVAASVAAGFPL 416

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P L++AL+++DT     GTANLIQAQRDFFG HGFDR D    PHGPW
Sbjct: 417 PVLASALAFWDTMRRPEGTANLIQAQRDFFGRHGFDRVDGEDRPHGPW 464


>gi|258511053|ref|YP_003184487.1| 6-phosphogluconate dehydrogenase, decarboxylating [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257477779|gb|ACV58098.1| 6-phosphogluconate dehydrogenase, decarboxylating [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 477

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/470 (43%), Positives = 300/470 (63%), Gaps = 5/470 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +A +G++GL  MG NL+LNI  +GF +AVYN+    T    ++     + +I   +LE
Sbjct: 1   MAEAQVGVMGLAVMGKNLALNIESRGFTVAVYNRTASRTQELAEEAK--DKNIIPAYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++ +PR++++MV  G PVD+ I +L PLL P D+++DGGNS+F DT+ R  +L +K
Sbjct: 59  DFVASLERPRRVILMVQAGRPVDEAISQLVPLLEPGDVIVDGGNSYFEDTRRRHKELEQK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG G+SGG +GA  G ++M GG+  AY  VE IL +I+AK  + PCC  +GPDG+G
Sbjct: 119 GILFIGTGISGGEEGALKGPAIMPGGSRDAYALVEPILTAIAAKVGDEPCCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L + L  +  ++  +FS+W+ G+L SYLI+ITA+IL
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYHLLSEVLGLSADDLHRVFSEWNKGELDSYLIEITADIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   +T+   ++FAR LS  ++E + 
Sbjct: 239 SKRDPETGRPMVDVILDTAGQKGTGKWTSQSALDLGVPLTMITESVFARFLSAMKEE-RV 297

Query: 301 MQSFFNPSSHFPLKCF--DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
             S   P    P +    D+F++D+  ALYAS I S+ QGF  + ++S++Y W+L L  I
Sbjct: 298 AASRVLPGPERPRESLDRDAFIEDVRRALYASKICSYAQGFAQLRQASQEYGWNLDLGAI 357

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A I+R GCIIR++ L++I ++   +P   NLL  P     +     S RR+V T    G 
Sbjct: 358 AMIFRGGCIIRARFLHNIKEAYDRNPDLPNLLLDPYFRASIASYQDSWRRVVATAVTYGV 417

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ S+AL+Y+D++  +R  ANL+QAQRD+FG+H F R D+    H  W
Sbjct: 418 PVPAFSSALAYYDSYRAERLPANLLQAQRDYFGAHTFRRVDRDGVFHFHW 467


>gi|261417813|ref|YP_003251495.1| 6-phosphogluconate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|319767376|ref|YP_004132877.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           Y412MC52]
 gi|261374270|gb|ACX77013.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           Y412MC61]
 gi|317112242|gb|ADU94734.1| 6-phosphogluconate dehydrogenase, decarboxylating [Geobacillus sp.
           Y412MC52]
          Length = 469

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/471 (43%), Positives = 299/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESKGYSVAVYNRSREKTDEFLQEAKG--KNIVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DI++DGGN++F DTQ R+ +L+E 
Sbjct: 59  EFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G ++M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPAIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDANELHEVFADWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 239 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFISAMKDERVK 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P +     F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA
Sbjct: 299 ASKVLAGPAVKPFEGDRGHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+ +NLL  P   + V++   +LR IV T    G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDPYFKDIVERYQDALREIVATAAMRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  ++AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPGFASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 469


>gi|323529513|ref|YP_004231665.1| 6-phosphogluconate dehydrogenase [Burkholderia sp. CCGE1001]
 gi|323386515|gb|ADX58605.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           CCGE1001]
          Length = 469

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/469 (43%), Positives = 296/469 (63%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G  ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGHAVSVYNRSREKTDELIAEYP--DRKLVPAFTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ KPR+IL+MV  G P D  I  LKPLL   DIL+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVESLEKPRRILLMVKAGAPTDATIAALKPLLDKGDILIDGGNTHFTDTIRRNQELAKAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+G
Sbjct: 120 LHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I 
Sbjct: 180 HFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITSKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  +D+   
Sbjct: 240 SKKDEETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKDQRVA 299

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     PL    D+F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TIA
Sbjct: 300 ASKVLDGPKAKPLGAERDAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDFGTIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  + T+D +  NLL  P   +       +LR +VV     G P
Sbjct: 360 KIFRAGCIIRARFLQKITDAYTKDKAIANLLLDPYFRDIASNYQAALREVVVAAINAGVP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 VPAFASAVAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHADW 468


>gi|269925949|ref|YP_003322572.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269789609|gb|ACZ41750.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 490

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/480 (42%), Positives = 306/480 (63%), Gaps = 18/480 (3%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI------KKISGLSQKVIVTKN 58
           + G+IGL  MG+NL+LNI D GF +AVYN+ +E T  F+      + ISG S        
Sbjct: 4   NYGLIGLAVMGANLALNIADHGFPIAVYNRTYERTKEFLEGPAKDRPISGAS-------T 56

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +++ V+ + +PR+I+++V  G PVD ++ +LKP L   D+++DGGNS F DT  R  +  
Sbjct: 57  IQEFVQLIERPRRIIILVKAGPPVDAMLSQLKPYLEEGDVVVDGGNSFFQDTIRRDAEFQ 116

Query: 119 EKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDG 178
             GIYF+G+G+SGG +GAR G SLM GG  +AY  +E  L  I+A+ ++ PC   +GP G
Sbjct: 117 GTGIYFVGMGISGGEEGARHGPSLMPGGPRQAYTLLEPALTKIAAQVEDGPCVTYVGPHG 176

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y ILR +L  +  EI+ +F+KW+ GKL+S+LI+IT++
Sbjct: 177 AGHYVKMVHNGIEYGDMQLIAEAYDILRHALGLSAQEIAEIFAKWNEGKLNSFLIEITSK 236

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +LS +D  TG P++D+I D+A QKGTG  +     +L   +   + A+++RN+S  R+E 
Sbjct: 237 VLSYNDPDTGKPLVDLILDEAEQKGTGRWTTQNASELGIPVPTIDAAVWSRNISAMREER 296

Query: 299 KKMQSFFN-PSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
            K       P+++   K +D    +  LE ALYAS + S+ QGF ++ K+SE Y + L+L
Sbjct: 297 IKASKVLRGPAANS--KSYDKQRLIDALEGALYASKVSSYAQGFALMRKASEVYGFELNL 354

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
           A +ARIW+ GCIIR+Q+LN I ++   DP+ +NLL  P  +E V       R ++    E
Sbjct: 355 AELARIWKGGCIIRAQLLNTIQQAFKNDPNLSNLLLDPDFAEAVSSMNDDWRYVISVARE 414

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
            G P P++S++L Y+D +  +R  ANLIQ  RDFFG+H + R DK    H  W +V+  +
Sbjct: 415 LGIPCPAMSSSLDYYDAYRSERLPANLIQGLRDFFGAHTYKRIDKPGVFHTEWAEVTASA 474


>gi|218290798|ref|ZP_03494875.1| 6-phosphogluconate dehydrogenase, decarboxylating [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239233|gb|EED06433.1| 6-phosphogluconate dehydrogenase, decarboxylating [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 522

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/470 (42%), Positives = 298/470 (63%), Gaps = 5/470 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           + +A +G++GL  MG NL+LNI  +GF +AVYN+    T    ++     + +I   +LE
Sbjct: 46  VAEAQVGVMGLAVMGKNLALNIESRGFTVAVYNRTASRTQELAEEAK--DKNIIPAYSLE 103

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++ +PR++++MV  G PVD  I +L PLL P D+++DGGNS+F DT+ R  +L +K
Sbjct: 104 DFVASLERPRRVILMVQAGRPVDDTISQLVPLLEPGDVIVDGGNSYFEDTRRRHKELEQK 163

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG G+SGG +GA  G ++M GG+  AY  VE IL +I+AK  + PCC  +GPDG+G
Sbjct: 164 GILFIGTGISGGEEGALKGPAIMPGGSRDAYALVEPILTAIAAKVGDDPCCTYIGPDGAG 223

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L + L  +  E+ H+FS+W+ G+L SYLI+ITA+I 
Sbjct: 224 HYVKMVHNGIEYGDMQLICEAYHLLSEVLGLSADELHHVFSEWNKGELDSYLIEITADIF 283

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   +T+   ++FAR LS  ++E + 
Sbjct: 284 SKRDPETGRPMVDVILDTAGQKGTGKWTSQSALDLGVPLTMITESVFARFLSAMKEE-RV 342

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
             S   P    P +  D  + ++D+  ALYAS I S+ QGF  + ++S++Y W+L L  I
Sbjct: 343 AASRVLPGPERPRESLDREALIEDVRRALYASKICSYAQGFSQLRQASQEYGWNLDLGAI 402

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A I+R GCIIR++ L++I ++   +P   NLL  P     +     S RR+V T    G 
Sbjct: 403 AMIFRGGCIIRARFLHNIKEAYDRNPDLPNLLLDPYFRASIASYQDSWRRVVATAATYGV 462

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++AL+Y+D++  +R  ANL+QAQRD+FG+H F R D+    H  W
Sbjct: 463 PVPAFASALAYYDSYRAERLPANLLQAQRDYFGAHTFRRVDRDGVFHFHW 512


>gi|307726273|ref|YP_003909486.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           CCGE1003]
 gi|307586798|gb|ADN60195.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           CCGE1003]
          Length = 469

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/469 (43%), Positives = 295/469 (62%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G  ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGHAVSVYNRSREKTDELIAEYP--DRKLVPAFTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ KPR+IL+MV  G+  D  I  LKPLL   DIL+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVESLEKPRRILLMVKAGEATDATIASLKPLLEKGDILIDGGNTHFTDTIRRNQELAKAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+G
Sbjct: 120 LHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLIA+ Y +L+     +  E+  ++++W+ G+L SYLI+IT++I 
Sbjct: 180 HFVKMVHNGIEYGDMQLIAESYAVLKQVAGLSNEELGKVYTEWNQGELDSYLIEITSKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  +D+   
Sbjct: 240 SKKDEETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKDQRVA 299

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  PL    D+F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TIA
Sbjct: 300 ASKVLEGPTAKPLGAGRDAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDFGTIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  + T+D +  NLL  P   +       +LR +VV     G P
Sbjct: 360 KIFRAGCIIRARFLQKITDAYTKDEAIANLLLDPYFRDIASNYQTALREVVVAAINAGVP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 VPAFASAVAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKAGSFHANW 468


>gi|226438119|pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate With
           Bound 6-Phosphogluconate
 gi|226438120|pdb|2W8Z|B Chain B, Geobacillus Stearothermophilus 6-Phosphogluconate With
           Bound 6-Phosphogluconate
          Length = 470

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 299/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 2   MAKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQEAKG--KNIVGTYSIE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DI++DGGN++F DTQ R+ +L+E 
Sbjct: 60  EFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAEL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 120 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR LS  +DE  K
Sbjct: 240 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVK 299

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P +   + F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA
Sbjct: 300 ASKVLAGPAVKPFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+ +NLL      + V++   +LR IV T    G P
Sbjct: 360 MIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  ++AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 420 VPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 470


>gi|254439393|ref|ZP_05052887.1| 6-phosphogluconate dehydrogenase, decarboxylating [Octadecabacter
           antarcticus 307]
 gi|198254839|gb|EDY79153.1| 6-phosphogluconate dehydrogenase, decarboxylating [Octadecabacter
           antarcticus 307]
          Length = 469

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 290/469 (61%), Gaps = 6/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKK--ISGLSQKVIVTKNL 59
           + A +G+ GLG+MGS L+LNILD GF L V N+  +    F+K+    GL+ K+  + +L
Sbjct: 3   ETATLGLYGLGTMGSALALNILDNGFGLHVSNRSSDAVLEFVKEAGTEGLADKLTGSDSL 62

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
             MV+A+  PR I++MV  G PVD  ID L PLL+  D ++D GNS F DT  R+  +  
Sbjct: 63  TAMVDAMPAPRAIILMVPSGKPVDATIDMLIPLLAKGDTIIDAGNSDFRDTIRRTEGIEA 122

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGS 179
           +G+ FIG+GVSGG  GAR G S+MVGG   A++    ++ +I+AK+  + C   LGP G+
Sbjct: 123 QGLTFIGMGVSGGEDGARHGPSIMVGGTPAAWDATREVIEAIAAKFDGAACADHLGPGGA 182

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVK +HNGIEYA+MQLIA+IYG++R   N++P +I  +F  W+ G L SYL++IT  +
Sbjct: 183 GHFVKTVHNGIEYADMQLIAEIYGLMRYGCNQSPSDIGAVFETWNKGALESYLVEITGNV 242

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L + D+ T  P +DVI D A QKGTG  + IE  ++  S  + E A+ AR  S     ++
Sbjct: 243 LQAVDSETQKPAVDVILDAAGQKGTGRWTAIEAIRMGQSANVIEAAVAARAWS-SEGAAR 301

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            + +    +    L   D    D E+AL    I+S+ QGF ++  +SE++ WS+  A  A
Sbjct: 302 TVGAGIYDAPRGELALGDG---DFESALLVGRIVSYAQGFRILAAASEEFEWSIDPARTA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WRAGCIIRS +L+DI  +   D     L+     +  +K  +P+LRR+V   T  G+ 
Sbjct: 359 EVWRAGCIIRSAMLDDIASAFRSDLPEGQLIFADHFAAIIKDALPALRRVVSAATAAGHA 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+L++AL + DT    RGTA+LIQAQRDFFG HGF R D   + HGPW
Sbjct: 419 VPALASALGFLDTMGCARGTADLIQAQRDFFGRHGFVRLDGRRDQHGPW 467


>gi|226438121|pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate With
           Bound 6-Phosphogluconate
 gi|226438122|pdb|2W90|B Chain B, Geobacillus Stearothermophilus 6-Phosphogluconate With
           Bound 6-Phosphogluconate
          Length = 471

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 299/471 (63%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KG+ +AVYN+  E TD F+++  G  + ++ T ++E
Sbjct: 3   MAKHQIGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQEAKG--KNIVGTYSIE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPRKIL+MV  G P D  I++LKP L   DI++DGGN++F DTQ R+ +L+E 
Sbjct: 61  EFVNALEKPRKILLMVKAGAPTDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAEL 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+G
Sbjct: 121 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  E+  +F+ W+ G+L+SYLI+ITA+I 
Sbjct: 181 HYVKMVHNGIEYGDMQLIAEAYFLLKHVLGMDAAELHEVFADWNKGELNSYLIEITADIF 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR LS  +DE  K
Sbjct: 241 TKIDEETGKPLVDVILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFLSAMKDERVK 300

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P +   + F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA
Sbjct: 301 ASKVLAGPAVKPFEGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLRYGDIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   DP+ +NLL      + V++   +LR IV T    G P
Sbjct: 361 MIFRGGCIIRAQFLQKIKEAYDRDPALSNLLLDSYFKDIVERYQDALREIVATAAMRGIP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  ++AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 421 VPGSASALAYYDSYRTAVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWLK 471


>gi|116670995|ref|YP_831928.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Arthrobacter
           sp. FB24]
 gi|116611104|gb|ABK03828.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Arthrobacter
           sp. FB24]
          Length = 478

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 300/471 (63%), Gaps = 2/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG+NL+ N+   GF +A++N+  E TD  ++K  G     + T+ L+++V
Sbjct: 3   AHIGVTGLAVMGANLARNLARNGFTVALHNRSVEKTDALLEK-HGHDGDFVRTETLQELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ KPR++L+MV  G PVD +I++L+PLL   DI++D GNSH+ DT+ R   L++K ++
Sbjct: 62  DSLEKPRRVLIMVKAGKPVDSVIEQLEPLLEAGDIIIDAGNSHYEDTRRREAALAKKDLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+GIGVSGG +GA +G S+M GG++++Y+ +  +L  I+A     PCCA +G DG+GHFV
Sbjct: 122 FVGIGVSGGEEGALNGPSIMPGGSKESYDALGPLLEKIAAHVDGKPCCAWIGTDGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + + +LR      P E + +F++W+ G+L+S+LI+I+AE+L   
Sbjct: 182 KMVHNGIEYADMQVIGEAFDLLRSGAGIEPAEQAKIFAEWNKGELASFLIEISAEVLGHV 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           DT TG P +DV+ D A QKGTG  ++I   +L S  +    ++FAR LS   ++ K  Q 
Sbjct: 242 DTRTGKPFVDVVVDAAGQKGTGRWTVISALELGSPTSGIAESVFARALSSQAEQRKLAQE 301

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
                    +   ++FV+D+  ALYAS ++S+ QG  ++  ++++Y W L L  IA +WR
Sbjct: 302 LL-AGEEIAVDVPETFVEDVRQALYASKLVSYAQGLDMLTSAAKEYGWDLKLDEIASLWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+++L +I  +   D    NLL  P+ ++ +   +P+ RR+V T  + G PVP  
Sbjct: 361 GGCIIRAELLKEITNAYAADEKPANLLFAPAFTKAIADVLPAWRRVVATAVQLGIPVPVF 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S++L+Y+D     R  A +IQ QRD FG+H + R D     H  W +  +E
Sbjct: 421 SSSLAYYDGLRRKRLPAAVIQGQRDLFGAHTYGRVDAEGTFHTLWGEDKSE 471


>gi|149181625|ref|ZP_01860118.1| 6-phosphogluconate dehydrogenase [Bacillus sp. SG-1]
 gi|148850603|gb|EDL64760.1| 6-phosphogluconate dehydrogenase [Bacillus sp. SG-1]
          Length = 470

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 295/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+ NI  +G+ ++VYN+  E TD  +++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLAWNIESRGYSVSVYNRSREKTDEMLQESEG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G P D  I++LKP L   DIL+DGGN+ F DT+ R+ +LSE 
Sbjct: 59  EFVQSLESPRKILLMVKAGGPTDATIEQLKPHLDKGDILIDGGNTFFEDTRRRNHELSES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA +G S+M GG ++AY  V  I   I+AK     C   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALTGPSIMPGGQKEAYELVAPIFKDIAAKVNGDACTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L++ L  N  E+   F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAESYFLLKNVLGFNAEELHETFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L  S+ I   ++FAR +S  +DE  K
Sbjct: 239 TKKDDETGKPMVDVILDKAGQKGTGKWTSQSALDLGVSLPIITESVFARFISSIKDERVK 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P     ++ V+ +  ALY S I S+ QGF  +  +SE+Y W LS   IA
Sbjct: 299 ASKILSGPEAKPFDGDKEALVESIRKALYMSKICSYAQGFAQMRAASEEYGWDLSYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++  ++P  +NLL      E V+    +LR ++ T  +NG P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDKEPGLSNLLLDDYFKEIVESYQYALRDVISTAVQNGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP  SAALSY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPGFSAALSYYDSYRTETLPANLIQAQRDYFGAHTYERTDKEGVFHTEW 467


>gi|170692681|ref|ZP_02883843.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           graminis C4D1M]
 gi|170142337|gb|EDT10503.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           graminis C4D1M]
          Length = 469

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/470 (42%), Positives = 294/470 (62%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +G  ++VYN+  E TD  I +     +K++    LE
Sbjct: 1   MGKQAIGVVGLAVMGRNLALNIESRGHAVSVYNRSREKTDELIAEYP--DKKLVPAFTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G+P D  I  LKPLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVESLEKPRRILLMVKAGEPTDATIASLKPLLEKGDILIDGGNTHFTDTIRRNQELAKA 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+
Sbjct: 119 GLHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y +L+     +  E+  ++++W+ G+L SYLI+IT++I
Sbjct: 179 GHFVKMVHNGIEYGDMQLIAESYAVLKQVAGLSNEELGKVYTEWNQGELDSYLIEITSKI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +  
Sbjct: 239 FSKKDEETGKGLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKSQRV 298

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +     PL    ++F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TI
Sbjct: 299 AASKVLDGPKAKPLGAEREAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDFGTI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  + T+D +  NLL  P   +       +LR +VV     G 
Sbjct: 359 AKIFRAGCIIRARFLQKITDAYTKDKAIANLLLDPYFRDIASNYQTALREVVVAAINAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 PVPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERVDKPGSFHANW 468


>gi|296161298|ref|ZP_06844106.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           Ch1-1]
 gi|295888456|gb|EFG68266.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           Ch1-1]
          Length = 469

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/470 (42%), Positives = 295/470 (62%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +G  ++V+N+  E TD  I +     +K++    LE
Sbjct: 1   MSKQAIGVVGLAVMGRNLALNIESRGHAVSVFNRSREKTDELIAEYP--DRKLVPAFTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G+  D  I++LKPLL   DIL+DGGN+HF DT  R+  L++ 
Sbjct: 59  EFVESLEKPRRILLMVKAGEGTDATINQLKPLLDKGDILIDGGNTHFTDTIRRNQDLAKS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+
Sbjct: 119 GLHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 179 GHFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITAKI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +  
Sbjct: 239 FSKKDEETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKTQRV 298

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                       PL    ++F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TI
Sbjct: 299 AASKVLEGPQAKPLGAEREAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDYGTI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  + T+D +  NLL  P   +  K    +LR +V+     G 
Sbjct: 359 AKIFRAGCIIRARFLQKITDAYTKDKAIANLLLDPYFRDIAKNYQSALREVVIAAVNAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 PVPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHANW 468


>gi|89070298|ref|ZP_01157617.1| 6-phosphogluconate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044137|gb|EAR50298.1| 6-phosphogluconate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 466

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/468 (41%), Positives = 297/468 (63%), Gaps = 4/468 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M  A +G+ GLG+MGS L+LNILD G+ L V N+  ++ D F+ +   L++K+   ++L 
Sbjct: 1   MTNATLGLYGLGTMGSALALNILDNGYPLHVSNRTDKVVDDFVAEAGPLAEKLTPARSLV 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            M +A+  PR I++MV  G PVD+ I +L P L   D+++D GN+ F DT  R+ +L  +
Sbjct: 61  AMAQAMEAPRAIILMVPAGRPVDESIAELVPHLEHGDVIVDAGNADFNDTMRRTRELEAQ 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GAR G S+MVGG E  +  +  ++ +I+AK++  PC A LGPDG+G
Sbjct: 121 GLAFLGMGVSGGEEGARRGPSIMVGGTEAVWEGLREVIEAIAAKFEGDPCAARLGPDGAG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVK +HNGIEYA+MQLIA+ YG++R      P  I  +F+ W+ G+L SYL++ITAE+L
Sbjct: 181 HFVKTVHNGIEYADMQLIAETYGLMRYGRGMAPARIGEVFAGWNKGRLQSYLVEITAEVL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +++D  TG P +D I D+A QKGTG  ++IE  ++  S +  E A+ AR+ S  +   + 
Sbjct: 241 AATDRETGAPALDDILDRAGQKGTGRWTVIEALRMGQSASAIEAAVAARSWSAEKPTREA 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                     F     +    +LE AL A  I+++ QGF ++  +S+++ WSL  A +A 
Sbjct: 301 GAVLLG----FTRGAVELTDAELEAALLAGRIVAYAQGFRILRAASDEFGWSLDFARVAE 356

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRS +L+DI  +   D     L+  P+ ++ ++++ P+LR++V      G+  
Sbjct: 357 IWRAGCIIRSSLLDDISGAFRGDLPEGQLIFAPAFAQMLQQSAPALRKVVAAAALAGHAA 416

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+ S AL++ DT    RGT +LIQ QRDFFG HGF+R D  +  HGPW
Sbjct: 417 PAFSGALAFLDTMSTARGTTDLIQGQRDFFGRHGFERLDGRAGQHGPW 464


>gi|121534340|ref|ZP_01666164.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermosinus
           carboxydivorans Nor1]
 gi|121307110|gb|EAX48028.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermosinus
           carboxydivorans Nor1]
          Length = 472

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/468 (43%), Positives = 289/468 (61%), Gaps = 3/468 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQ DIG+IGL  MG NL LN+  KGF +AVYN+     D F+    G    +    ++ +
Sbjct: 3   KQYDIGLIGLAVMGENLVLNMAGKGFAVAVYNRTVSKVDDFVVG-RGKGFAIGGAHSVAE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +   + +PRK+++MV  G PVD +I +L P L P DI++DGGNS+F DT+ R  +L+ KG
Sbjct: 62  LAAMLSRPRKVMLMVKAGKPVDDMIGELLPYLEPGDIIIDGGNSYFEDTRRRWRELAAKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I FIG+GVSGG +GA  G SLM GG+  AY  V  I   I+A+  + PCCA +GPDG+GH
Sbjct: 122 IRFIGMGVSGGEEGALKGPSLMPGGDRDAYEEVAPIFTRIAAQVADGPCCAYVGPDGAGH 181

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEY +MQLI++ Y I++++L  +  E+  +F+KW+ G L SYLI+IT +I +
Sbjct: 182 YVKMVHNGIEYGDMQLISEAYYIMKNALGLSADELHRVFAKWNEGDLDSYLIEITRDIFT 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLS-SSMTITETAIFARNLSLYRDESKK 300
             D  TG+P+++VI DKA QKGTG  +      L   + TITE A+FAR +S Y++E   
Sbjct: 242 KYDEATGLPLVEVILDKAGQKGTGKWTSQSALDLGVPTPTITE-AVFARCMSAYKEERVA 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                           D F++ + +ALYAS I S+ QGF ++  +S +Y W L L  +A 
Sbjct: 301 AAKVLTGPDGRYTGGRDEFIQAIHDALYASKICSYAQGFALLKAASAEYQWDLDLGEVAL 360

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIR++ L+ I ++   DP   NLL  P     +     + R +V TC E G P 
Sbjct: 361 LWRGGCIIRARFLDRIKEAYRRDPELPNLLIDPFFRSVLGNAQANWRLVVKTCKELGIPT 420

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+ SA+L Y+D++      ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 421 PAFSASLDYYDSYRRAVLPANLIQAQRDYFGAHTYERTDKPGIFHTEW 468


>gi|321313570|ref|YP_004205857.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis BSn5]
 gi|320019844|gb|ADV94830.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis BSn5]
          Length = 468

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 288/466 (61%), Gaps = 3/466 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG  +AVYN   +LTD  ++K+ G  Q +     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLVQKLDG--QSLSPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +I  LKPLL   D+++DGGNSH+ DT+ R  +L EKGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIQSLKPLLEEGDVIMDGGNSHYEDTERRYDELKEKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+G+SGG  GA +G S+M GG+   Y +   IL  I+A+  + PCC  +GP G+GHF KM
Sbjct: 123 GVGISGGEVGALTGPSIMPGGDRDVYEKAAPILTKIAAQVGDDPCCVYIGPKGAGHFTKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR++L     EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        TI   ++FAR LS  ++E    Q   
Sbjct: 243 KTGQPLIDVILDKTGQKGTGKWTSMQAIDNGIPSTIITESLFARYLSSLKEERMAAQDVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P S       D++++ +  ALY   + ++ QGF     SSE Y W+L L  IA I+R 
Sbjct: 303 AGPESEEKHLDKDTWIEYVRQALYMGKVCAYAQGFAQYKMSSELYGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+  LN I ++ +E P+  NLL  P  ++K+      LR++V      G   P L+
Sbjct: 363 GCIIRADFLNVISEAFSEQPNLANLLIAPYFTDKLHAYQTGLRKVVCEGISTGISFPCLT 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            ALSY+D +   R  ANL+QAQRD+FG+H ++R D     H  W +
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMDGVFHTNWSE 468


>gi|91777918|ref|YP_553126.1| 6-phosphogluconate dehydrogenase [Burkholderia xenovorans LB400]
 gi|91690578|gb|ABE33776.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           xenovorans LB400]
          Length = 469

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 296/470 (62%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +G  ++V+N+  E TD  I +     +K++    LE
Sbjct: 1   MSKQAIGVVGLAVMGRNLALNIESRGHAVSVFNRSREKTDELIAEYP--DRKLVPAFTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G+  D  I++LKPLL   DIL+DGGN+HF DT  R+  L++ 
Sbjct: 59  EFVESLEKPRRILLMVKAGEGTDATINQLKPLLDKGDILIDGGNTHFTDTIRRNQDLAKS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+
Sbjct: 119 GLHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I
Sbjct: 179 GHFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITSKI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +  
Sbjct: 239 FSKKDEETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKTQRV 298

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                    +  PL    ++F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TI
Sbjct: 299 AASKVLEGPAARPLGAEREAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDYGTI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  + T+D +  NLL  P   +  K    +LR +V+     G 
Sbjct: 359 AKIFRAGCIIRARFLQKITDAYTKDKAIANLLLDPYFRDIAKNYQSALREVVIAAINAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 PVPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHANW 468


>gi|308069724|ref|YP_003871329.1| 6-phosphogluconate dehydrogenase, decarboxylating II (GNTZII)
           [Paenibacillus polymyxa E681]
 gi|305859003|gb|ADM70791.1| 6-phosphogluconate dehydrogenase, decarboxylating II (GNTZII)
           [Paenibacillus polymyxa E681]
          Length = 468

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/471 (44%), Positives = 295/471 (62%), Gaps = 7/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++V+N+  E T   IK+  G  +K+  T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGFTVSVFNRSPEKTHDLIKEAEG--KKLTGTFSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G   D  I++L P L   DI++DGGN++F DTQ RS +L EK
Sbjct: 59  EFVNSLESPRKILIMVQAGKATDATIEQLVPHLDKGDIIIDGGNAYFPDTQRRSKELEEK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG GVSGG +GA +G ++M GG E AY  VE IL +ISAK +  PCC  +GPDG+G
Sbjct: 119 GLRFIGTGVSGGEEGALNGPAIMPGGQESAYKLVEPILTAISAKVEGDPCCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+  LN N  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIGEAYHLLKSVLNVNAEELHEIFTEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE--- 297
           S  D  TG P++DVI D A QKGTG  +      L   +++   ++F+R LS  +DE   
Sbjct: 239 SQYDAETGKPMVDVILDAAGQKGTGKWTSQSALDLGVPLSMITESVFSRFLSAMKDERIA 298

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           + K+ S  N  S    K    F++ +  AL+AS I+S+ QGF  +  +S++Y W L    
Sbjct: 299 ASKVLSGPNAESFSGDK--KEFIESVRKALFASKIVSYAQGFAQMRAASDEYDWDLKYGK 356

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA I+R GCIIRSQ L +I  +   DP+  NLL        V+    + R+++      G
Sbjct: 357 IAMIFRGGCIIRSQFLQNIKDAYDRDPALKNLLLDSYFKNVVETYQDAWRQVISVAVSQG 416

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP  S+AL+Y+D++  +R  ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 417 IPVPGFSSALAYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHQW 467


>gi|16081060|ref|NP_391888.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221311980|ref|ZP_03593827.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221316305|ref|ZP_03598110.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221321218|ref|ZP_03602512.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221325501|ref|ZP_03606795.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|112840|sp|P12013|6PGD_BACSU RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|563930|dbj|BAA21576.1| probable 6-phosphogluconate dehydrogenase [Bacillus subtilis]
 gi|600499|gb|AAA56927.1| putative [Bacillus subtilis]
 gi|2636555|emb|CAB16045.1| NAD+-6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 468

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 288/466 (61%), Gaps = 3/466 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG  +AVYN   +LTD  I+K+ G  Q +     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLIQKLDG--QSLSPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +I  LKPLL   D+++DGGNSH+ DT+ R  +L EKGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIQSLKPLLEEGDVIMDGGNSHYEDTERRYDELKEKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+G+SGG  GA +G S+M GG+   Y +   IL  I+A+  + PCC  +GP G+GHF KM
Sbjct: 123 GVGISGGEVGALTGPSIMPGGDRDVYEKAAPILTKIAAQVGDDPCCVYIGPKGAGHFTKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR++L     EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        TI   ++FAR LS  ++E    Q   
Sbjct: 243 KTGQPLIDVILDKTGQKGTGKWTSMQAIDNGIPSTIITESLFARYLSSLKEERMAAQDVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P +       D++++ +  ALY   + ++ QGF     SSE Y W+L L  IA I+R 
Sbjct: 303 AGPEAEEKHLDKDTWIEYVRQALYMGKVCAYAQGFAQYKMSSELYGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+  LN I ++ +E P+  NLL  P  ++K+      LR++V      G   P L+
Sbjct: 363 GCIIRADFLNVISEAFSEQPNLANLLIAPYFTDKLHAYQTGLRKVVCEGISTGISFPCLT 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            ALSY+D +   R  ANL+QAQRD+FG+H ++R D     H  W +
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMDGVFHTNWSE 468


>gi|167583918|ref|ZP_02376306.1| 6-phosphogluconate dehydrogenase [Burkholderia ubonensis Bu]
          Length = 470

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/470 (43%), Positives = 293/470 (62%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G   D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGAATDATIAALKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  +++ W+ G+L SYL++IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTDWNQGELDSYLMEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +SE+Y W L L TI
Sbjct: 300 AASKVLSGPSATPLQGDRAAFVEAVRRALYLSKVISYAQGFAQMRTASEEYGWKLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  +D +  NLL  P   +       SLR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKDSALANLLLDPYFQDIAANYQASLREVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 PVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|291486633|dbj|BAI87708.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 468

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/466 (43%), Positives = 288/466 (61%), Gaps = 3/466 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG  +AVYN   +LTD  ++K+ G  Q +     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLVQKLDG--QSLSPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +I  LKPLL   D+++DGGNSH+ DT+ R  +L EKGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIQSLKPLLEEGDVIMDGGNSHYEDTERRYDELKEKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+G+SGG  GA +G S+M GG+   Y +   IL  I+A+  + PCC  +GP G+GHF KM
Sbjct: 123 GVGISGGEVGALTGPSIMPGGDRDVYEKAAPILTKIAAQVGDDPCCVYIGPKGAGHFTKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR++L     EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        TI   ++FAR LS  ++E    Q   
Sbjct: 243 KTGQPLIDVILDKTGQKGTGKWTSMQAIDNGIPSTIITESLFARYLSSLKEERMAAQDVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P +       D++++ +  ALY   + ++ QGF     SSE Y W+L L  IA I+R 
Sbjct: 303 AGPEAEEKHLDKDTWIEYVRQALYMGKVCAYAQGFAQYKMSSELYGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+  LN I ++ +E P+  NLL  P  ++K+      LR++V      G   P L+
Sbjct: 363 GCIIRADFLNVISEAFSEQPNLANLLIAPYFTDKLHAYQTGLRKVVCEGISTGISFPCLT 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            ALSY+D +   R  ANL+QAQRD+FG+H ++R D     H  W +
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMDGVFHTNWSE 468


>gi|302548061|ref|ZP_07300403.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302465679|gb|EFL28772.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           himastatinicus ATCC 53653]
          Length = 484

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/472 (40%), Positives = 288/472 (61%), Gaps = 2/472 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSNL+ N    G  +AV+N+    T   I++  G     +  +   + V
Sbjct: 11  AQIGVTGLAVMGSNLARNFARHGHTVAVHNRSSAKTKALIEE-HGHEGSFVPAETAAEFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G P D +I++  PLL   D+++DGGN+HF DT+ R   L E+G++
Sbjct: 70  AALQRPRRLVIMVKAGAPTDAVIEEFAPLLEEGDVIIDGGNAHFDDTRRREKALRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG+ ++Y  +  +L SISAK   +PCC  +GPDG+GHFV
Sbjct: 130 FVGTGISGGEEGALNGPSIMPGGSSESYKSLGPLLESISAKVDGTPCCTHIGPDGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR +L   P EI+ +F  W+ G+L SYLI+ITAE+L+ +
Sbjct: 190 KMVHNGIEYADMQLIAESYDLLRRALGLTPGEIAEVFRTWNGGRLESYLIEITAEVLAHT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS + D     Q 
Sbjct: 250 DAATGKPFVDVVQDQAEQKGTGRWTVQTALDLGVPVSGIAEAVFARSLSGHADVRDASQG 309

Query: 304 FFNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
              P++     K  + F  ++E ALYAS I+++ QG   I   S++Y W +    +ARIW
Sbjct: 310 LPGPAAKQLTGKAAERFADEVEQALYASKIVAYAQGIHQIEAGSQEYGWDIDPGAVARIW 369

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ LN I ++  +D     LL     ++ + +   + RR+V T  E G P P 
Sbjct: 370 RGGCIIRARFLNRITEAYGKDNKPVTLLADDYFAQALGEAQDAWRRVVSTSVELGVPAPG 429

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            SAAL+Y+D    +R  A L+Q QRDFFG+H + R D+    H  W +  +E
Sbjct: 430 FSAALAYYDALRSERLPAALVQGQRDFFGAHTYRRTDREGSFHTLWGQDRSE 481


>gi|163842047|ref|YP_001626452.1| 6-phosphogluconate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162955523|gb|ABY25038.1| 6-phosphogluconate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 478

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 292/465 (62%), Gaps = 2/465 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG+NL+ N+   GF +A++N+    TD  + K  G     + T+ L+++V
Sbjct: 3   AQIGVTGLAVMGANLARNLARNGFTVALHNRSVSRTDELLAK-HGDEGNFVRTETLQELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR++L+MV  G PVD ++D+L PLL   DI++D GNSH+ DT+ R   L+ KG++
Sbjct: 62  HSLEKPRRVLIMVKAGAPVDSVVDQLVPLLEEGDIVIDAGNSHYTDTRRREADLATKGLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+GIGVSGG +GA +G S+M GG++++Y  +  +L  ISA     PCCA +GPDG+GHFV
Sbjct: 122 FVGIGVSGGEEGALNGPSIMPGGSKESYQALGPLLEKISAHVDGQPCCAWIGPDGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P E + +F +W+ G LSS+LI+ITAE+L   
Sbjct: 182 KMVHNGIEYADMQVIGEAYDLLRSGAGIEPAEQAEIFKEWNKGTLSSFLIEITAEVLGHV 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D A QKGTG  ++I   +L S  +    ++FAR LS    +  + Q 
Sbjct: 242 DAKTGKPFVDVVVDAAGQKGTGRWTVISALELGSPTSGIAESVFARALSSQSAQRVEAQG 301

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
               S+   L+  + F++D+  AL+AS ++S+ QG  ++  ++++Y+W L L  IA +WR
Sbjct: 302 TL-ASAEVQLELGNDFIEDVRQALFASKLVSYAQGLDMLTGAAKEYNWDLKLDEIASLWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+++L DI K+ +      NLL  P+ ++ + + +P+ RR+V T  + G PVP  
Sbjct: 361 GGCIIRAELLKDITKAYSATDKPGNLLFAPAFTQAIAEALPAWRRVVSTAVQLGIPVPVF 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           S++L+Y+D     R  A L Q  RD FG+H + R D     H  W
Sbjct: 421 SSSLAYYDGLRRKRLPAALTQGLRDLFGAHTYQRVDVDGTFHTLW 465


>gi|253575721|ref|ZP_04853056.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus
           sp. oral taxon 786 str. D14]
 gi|251844764|gb|EES72777.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus
           sp. oral taxon 786 str. D14]
          Length = 472

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 292/472 (61%), Gaps = 8/472 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+  E T   +    G  + ++ T ++E
Sbjct: 4   MSKQQIGVIGLAVMGKNLALNIESRGFTVSVYNRSPEKTHDLLNN-EGKGKNLVGTFSVE 62

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G   D  I++L P L   DI++DGGN+HF DTQ RS +L  K
Sbjct: 63  EFVNSLESPRKILIMVQAGPATDATIEQLLPYLDQGDIIIDGGNAHFPDTQRRSKELEAK 122

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G ++M GG E AY  VE IL +ISAK    PCC  +GPDG+G
Sbjct: 123 GFRFIGTGVSGGEEGALKGPAIMPGGQESAYKLVEPILTAISAKVNGDPCCTYIGPDGAG 182

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+D L  +  E+  +FS+W+ G+L SYLI+ITA+I 
Sbjct: 183 HYVKMVHNGIEYGDMQLICEAYHLLKDVLGVDAKELHEIFSEWNKGELDSYLIEITADIF 242

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE--- 297
           S  D  TG P++DVI D A QKGTG  +      L   +++   ++F+R LS  ++E   
Sbjct: 243 SQYDEETGKPMVDVILDAAGQKGTGKWTSQSALDLGVPLSMITESVFSRFLSAMKEERVA 302

Query: 298 -SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
            SK +     P+     K    F++++  AL+AS I+S+ QGF  +  +SE+Y W L   
Sbjct: 303 ASKILSGPAKPAFSGDKK---EFIENVRKALFASKIVSYAQGFAQMRAASEEYGWDLKYG 359

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA I+R GCIIRSQ L++I ++   DP+  NLL  P     V+    + R +V T    
Sbjct: 360 NIAMIFRGGCIIRSQFLHNIKEAYDRDPALKNLLLDPYFKNIVESYQDAWRNVVSTAVAY 419

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G PVP  ++ALSY+D++  +R  ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 420 GIPVPGFASALSYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHQW 471


>gi|296329941|ref|ZP_06872425.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676666|ref|YP_003868338.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152980|gb|EFG93845.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414910|gb|ADM40029.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 468

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/466 (43%), Positives = 290/466 (62%), Gaps = 3/466 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG  +AVYN   +LTD  ++K+ G  Q +     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLVQKLDG--QSLSPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +I  L PLL   D+++DGGNSH+ DT+ R  +L EKGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIQSLMPLLEEGDVIMDGGNSHYEDTERRYDELKEKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+G+SGG  GA +G S+M GG+ + Y +V  IL  I+A+  + PCC  +GP G+GHF KM
Sbjct: 123 GVGISGGEVGALTGPSIMPGGDREVYEKVAPILTKIAAQVGDDPCCVYIGPKGAGHFTKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR++L     EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        TI   ++FAR LS  ++E    Q   
Sbjct: 243 KTGQPLIDVILDKTGQKGTGKWTSMQAIDNGIPSTIITESLFARYLSSLKEERVAAQDML 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P +       D++++ +  ALY   + ++ QGF     SSE Y W+L L  IA I+R 
Sbjct: 303 AGPEAEEKHFDKDTWIEYVRQALYMGKVCAYAQGFAQYKMSSELYGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+  LN I ++ +E P+  NLL  P  ++K++     LR++V      G   P L+
Sbjct: 363 GCIIRADFLNVISEAFSEQPNLANLLIAPYFTDKLQAYQTGLRKVVCEGISTGISFPCLT 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            ALSY+D +   R  +NL+QAQRD+FG+H ++R D     H  W +
Sbjct: 423 TALSYYDGYRTGRSNSNLLQAQRDYFGAHTYERTDMDGVFHTNWSE 468


>gi|160901923|ref|YP_001567504.1| 6-phosphogluconate dehydrogenase, decarboxylating [Petrotoga
           mobilis SJ95]
 gi|160359567|gb|ABX31181.1| 6-phosphogluconate dehydrogenase, decarboxylating [Petrotoga
           mobilis SJ95]
          Length = 472

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/470 (42%), Positives = 300/470 (63%), Gaps = 4/470 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++ DI +IG+  MG NL+LN+  KG +++VYN+  E T  F+++    ++ +  T +LE+
Sbjct: 4   QKNDIAVIGMAVMGQNLALNMGSKGLKVSVYNRTSEKTKRFVEE-RAKNKNIQGTYSLEE 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V ++  PRKI++MV  G PVD +I++L P L+ EDI++DGGNS++ DT  R  +L +KG
Sbjct: 63  LVNSLKTPRKIILMVKAGKPVDDVIEELLPYLNKEDIIIDGGNSYYKDTDRRYEELHKKG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I F+G G+SGG  GA  G S+M GG+E AY  V+NIL + +A+ ++ PC   LGP  SGH
Sbjct: 123 IRFLGTGISGGEYGALHGPSIMPGGDESAYEEVKNILEATAAQTEDGPCVTYLGPKSSGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEYA M+LIA+ Y I+R  L   P ++S +F +W+     SYL++IT +IL 
Sbjct: 183 YVKMVHNGIEYAIMELIAETYDIMRKVLKMTPQDMSKVFKEWNEDH-KSYLMEITYKILE 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG PI+DVI D A QKGTG  S+ +   L+ S+     A+ AR LS  +DE  ++
Sbjct: 242 WKDEETGQPIVDVILDSAKQKGTGKWSVQDALDLNISIPTINAAVNARTLSSIKDERIRI 301

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              +   +   L   +SF+  L +ALY STI+++ +G  ++  +S++Y ++L L+ +ARI
Sbjct: 302 GEIYETPTEMNLD--ESFINSLRDALYISTIIAYAEGMKLLQVASKEYGYNLDLSEVARI 359

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           W  GCIIRS  L  I ++  +DP+  NL+         KK IP+LR +V    + G P+P
Sbjct: 360 WEDGCIIRSTFLKPIQRAFKKDPNLVNLIISDEFKSDFKKKIPNLREVVSQIKKAGIPIP 419

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
           SLS+AL YFD        ANLIQAQRD+FG+H ++R+DK    H  WQ +
Sbjct: 420 SLSSALDYFDGLSSKELPANLIQAQRDYFGAHTYERRDKEGIFHTEWQDI 469


>gi|212638817|ref|YP_002315337.1| 6-phosphogluconate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560297|gb|ACJ33352.1| 6-phosphogluconate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 456

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/458 (44%), Positives = 291/458 (63%), Gaps = 3/458 (0%)

Query: 14  MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKIL 73
           MG NL+LNI  +G+ +AVYN+  E TD F+++  G  + +I T ++E+ V A+ KPRKIL
Sbjct: 1   MGKNLALNIESRGYSVAVYNRSREKTDEFLQEAKG--KNIIGTYSIEEFVHALEKPRKIL 58

Query: 74  MMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV 133
           +MV  G   D  I++LKP L   DI++DGGN++F DTQ R+ +L+E GI+FIG GVSGG 
Sbjct: 59  LMVKAGAATDATIEQLKPHLEKGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGE 118

Query: 134 KGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYA 193
           +GA  G S+M GG ++A+  V  I  +I+AK    PC   +GPDG+GH+VKM+HNGIEY 
Sbjct: 119 EGALKGPSIMPGGQKEAHELVRPIFEAIAAKVDGEPCTTYIGPDGAGHYVKMVHNGIEYG 178

Query: 194 NMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIID 253
           +MQLIA+ Y +L+  L  N  E+  +F++W+ G+L SYLI+ITA+I +  D  TG P++D
Sbjct: 179 DMQLIAEAYFLLKHVLGLNAQELHEVFAEWNKGELDSYLIEITADIFTKIDEETGKPLVD 238

Query: 254 VICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPL 313
           VI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K        +  P 
Sbjct: 239 VILDKAGQKGTGKWTSQNALDLGVPLPIITESVFARFISAMKDERVKASKLLAGPAVKPY 298

Query: 314 KCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQI 372
           +   + F++ +  ALY S I S+ QGF  +  +SE+Y+W+L    IA I+R GCIIR+Q 
Sbjct: 299 EGDRAHFIEAVRRALYMSKICSYAQGFAQMKAASEEYNWNLQYGNIAMIFRGGCIIRAQF 358

Query: 373 LNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDT 432
           L  I ++   DP+  NLL  P   + V+    SLR IV T    G PVP+ ++AL+Y+D+
Sbjct: 359 LQKIKEAYDRDPALPNLLLDPYFKDIVENYQQSLREIVATAAMRGIPVPAFASALAYYDS 418

Query: 433 FIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           +  +   ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 YRMETLPANLIQAQRDYFGAHTYERIDKEGIFHTEWLK 456


>gi|251797795|ref|YP_003012526.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           sp. JDR-2]
 gi|247545421|gb|ACT02440.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           sp. JDR-2]
          Length = 470

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 289/469 (61%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+  E TD  IK+ +G  + +     +E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGFTVSVYNRSREKTDELIKESAG--KNLAPAYTVE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  ID L P L   DI++DGGN++F DT  RS  L E+
Sbjct: 59  EFVQSLESPRKILIMVQAGAGTDATIDALVPHLDKGDIIIDGGNAYFPDTVRRSKALEEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG GVSGG +GA  G S+M GG E AY  VE IL +ISAK  +  CC  +GPDG+G
Sbjct: 119 GIRFIGTGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVGDDACCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+++L+ N  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYDLLKNTLDLNAEELHSIFTEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   ++I   ++F R LS  +DE   
Sbjct: 239 SKYDPETGKPMVDVILDSAGQKGTGKWTSQSSLDLGVPLSIITESVFTRFLSAMKDERIA 298

Query: 301 MQSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                N     P +    +F++ +  AL+AS I S+ QGF  +  +SE+Y W+L    IA
Sbjct: 299 ASKVLNGPEKKPFEGDKVAFIESVRKALFASKICSYAQGFAQMRAASEEYDWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR++ L +I  +   D +  NLL  P     V     + R +V T   NG P
Sbjct: 359 MIFRGGCIIRARFLQNIKDAYDRDANLRNLLLDPYFQGIVDSYQGAWREVVGTAVANGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++ALSYFD++  +R  ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 419 VPAFASALSYFDSYRTERLPANLLQAQRDYFGAHTFKRLDKEGSFHHNW 467


>gi|169830136|ref|YP_001700294.1| 6-phosphogluconate dehydrogenase [Lysinibacillus sphaericus C3-41]
 gi|168994624|gb|ACA42164.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lysinibacillus
           sphaericus C3-41]
          Length = 466

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/464 (43%), Positives = 295/464 (63%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG ++AVYN   +LTD  ++K+ G  Q +     +E  V +
Sbjct: 5   IGVIGLGVMGSNIALNMANKGEQVAVYNYTRDLTDKLLQKVEG--QALTPYYEIEDFVLS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G  +D +I  L P L   DI++DGGNSH+ DT+ R  +L  +GI ++
Sbjct: 63  LEKPRKIFLMVTAGKAIDSVIASLVPFLETGDIIMDGGNSHYQDTERRHDELMARGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA +G S+M GGN + Y +V  IL  I+A+++ + CC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEVGALTGPSIMPGGNREVYEKVAPILTKIAAQFKGNSCCTYMGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR ++  +  EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRKNVGLSVEEIAEIFETWNQGELKSYLIEITAEILRKKDD 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
           +TG+P+ID+I DKA QKGTG  + ++        +I   A+FAR +S  ++E    ++  
Sbjct: 243 VTGLPLIDMILDKAGQKGTGKWTSMQSIDNGIPTSIITEALFARYISSLKEERVHAEAVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             PSS  P    D +V+ +  ALY   I ++ QGF     +SE Y+W+L L  IA I+R+
Sbjct: 303 AGPSSTQPNLDKDVWVEYVRQALYMGKICAYAQGFTQYKMTSELYNWNLPLKDIALIFRS 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR++ LN I  +  + P+  NLL  P  +EK K     LR+IV    + G   P LS
Sbjct: 363 GCIIRAEFLNVISDAYHKQPTLANLLIAPYFAEKTKDYQSGLRKIVCEGIQAGNAFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           A+L+Y+D++      ANL+QAQRD+FG+H ++R D     H  W
Sbjct: 423 ASLTYYDSYRTRSSNANLLQAQRDYFGAHTYERTDLAGVFHTDW 466


>gi|52080930|ref|YP_079721.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786305|ref|YP_092134.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645114|ref|ZP_07999347.1| 6-phosphogluconate dehydrogenase [Bacillus sp. BT1B_CT2]
 gi|52004141|gb|AAU24083.1| 6-phosphogluconate dehydrogenase, decarboxylating YqjI [Bacillus
           licheniformis ATCC 14580]
 gi|52348807|gb|AAU41441.1| YqjI [Bacillus licheniformis ATCC 14580]
 gi|317392923|gb|EFV73717.1| 6-phosphogluconate dehydrogenase [Bacillus sp. BT1B_CT2]
          Length = 469

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 292/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +GF ++VYN+  E T+ F+K+  G  + V+ T ++E
Sbjct: 1   MAKQQIGVVGLAVMGKNLALNIESRGFSVSVYNRSSEKTEEFLKEAEG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPRKIL+MV  G P D  I  L P L   DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVESLEKPRKILLMVKAGTPTDATIQSLLPHLEKGDILIDGGNTYYKDTQRRNRELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  +  +  E+  +FS+W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKHIVGLSSDELHEVFSEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISSMKEERVK 298

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P +    +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASKLLAGPEAKPAAENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYGWDLKYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   DP   NLL  P     V+    +LR+ +    E G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKEAYDRDPELDNLLLDPYFKNIVESYQGALRKTISLAVEQGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  S+AL+YFD++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPCFSSALAYFDSYRTATLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|261405753|ref|YP_003241994.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           sp. Y412MC10]
 gi|329922672|ref|ZP_08278224.1| phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus sp.
           HGF5]
 gi|261282216|gb|ACX64187.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           sp. Y412MC10]
 gi|328942014|gb|EGG38297.1| phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus sp.
           HGF5]
          Length = 473

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/475 (42%), Positives = 298/475 (62%), Gaps = 11/475 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KGF ++VYN+  + T+  +K+  G  ++V  T ++E
Sbjct: 5   MSKQQIGVIGLAVMGKNLALNIESKGFTVSVYNRSPQKTEDMLKETEG--KQVKGTFSIE 62

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I++L P L   DI++DGGN++F DTQ RS +L+EK
Sbjct: 63  EFVDSLETPRKILIMVQAGQATDATIEQLIPHLDQGDIIIDGGNAYFPDTQRRSKELAEK 122

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG E AY  VE IL +ISAK    PCC  +GPDG+G
Sbjct: 123 GFNFIGAGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVNEEPCCTYIGPDGAG 182

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+D L  +  ++  +F++W+ G+L SYLI+ITA+I 
Sbjct: 183 HYVKMVHNGIEYGDMQLICEAYQLLKDVLGLDAKDLHGIFTEWNQGELDSYLIEITADIF 242

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   +++   ++F+R LS  ++E   
Sbjct: 243 SKYDEETGKPMVDVILDTAGQKGTGKWTSQSSLDLGVPLSMITESVFSRFLSAMKEERVA 302

Query: 301 MQSFFN-PSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                N P +      FD     F++++  AL+AS I+S+ QGF  +  +S++Y W+L  
Sbjct: 303 ASKILNGPKT----AAFDGDKAEFIENVRKALFASKIVSYAQGFAQLRVASDEYGWNLQY 358

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             +A+IWR GCIIRS+ L +I  +   +P   NLL  P  ++ ++    + R++V +   
Sbjct: 359 GNLAKIWRGGCIIRSRFLQNITDAYENNPELKNLLLDPFFTDIIESYQDAWRKVVASAVS 418

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            G PVP  S+AL+Y+D++      ANL+QAQRD+FG+H F R DK    H  W +
Sbjct: 419 LGIPVPGFSSALAYYDSYRTANLPANLLQAQRDYFGAHTFKRVDKEGTFHYNWME 473


>gi|307323147|ref|ZP_07602357.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           violaceusniger Tu 4113]
 gi|306890636|gb|EFN21612.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           violaceusniger Tu 4113]
          Length = 484

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/466 (40%), Positives = 282/466 (60%), Gaps = 2/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSNL+ N    G  +A++N+ F  T   +++  G     +  ++  + V
Sbjct: 11  AQIGVTGLAVMGSNLARNFARHGHTVALHNRTFAKTKALMEE-HGHEGSFVPAESAAEFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G P D +I++  PLL   D+++DGGN+HF DT+ R   L E+G++
Sbjct: 70  AALQRPRRLVIMVKAGAPTDAVIEEFAPLLEEGDVIIDGGNAHFDDTRRREKSLRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG+ ++Y  +  +L  ISAK    PCC  +GPDG+GHFV
Sbjct: 130 FVGTGISGGEEGALNGPSIMPGGSAESYKSLGPLLEDISAKVDGVPCCTHIGPDGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR +L   P EI+ +F  W+ G+L SYLI+ITAE+L  +
Sbjct: 190 KMVHNGIEYADMQLIAESYDLLRRALGMTPGEIAEVFRTWNGGRLESYLIEITAEVLGHT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS + D  +  Q 
Sbjct: 250 DAATGKPFVDVVQDQAEQKGTGRWTVQTALDLGVPVSGIAEAVFARSLSGHADLREASQG 309

Query: 304 FFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
              PS         + F  D+E ALYAS I+++ QG   I   S++Y W +    +A+IW
Sbjct: 310 LPGPSGEKLTGAAAERFADDVEQALYASKIVAYAQGIHQIEAGSQEYGWDIDPGAVAKIW 369

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ LN I ++  +D     LL     +E +     + RR+V T  E G P P 
Sbjct: 370 RGGCIIRARFLNRITEAYAKDGKPVTLLTDDHFAEALGAAQDAWRRVVSTSVELGVPAPG 429

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            SAAL+Y+D    +R  A L+Q QRDFFG+H + R D+    H  W
Sbjct: 430 FSAALAYYDALRSERLPAALVQGQRDFFGAHTYRRVDREGSFHTMW 475


>gi|325522772|gb|EGD01256.1| 6-phosphogluconate dehydrogenase [Burkholderia sp. TJI49]
          Length = 470

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 294/474 (62%), Gaps = 11/474 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE
Sbjct: 1   MGKQAIGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDG 178
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG
Sbjct: 119 GLHFIGTGVSGGEEGALHGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+IT++
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNEELGAVYTEWNQGELDSYLIEITSK 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E 
Sbjct: 239 IFGKKDDETGKYLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTER 298

Query: 299 KKMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
                  +  +  P   FD    +F++ +  ALY S ++S+ QGF  +  +S++Y W+L 
Sbjct: 299 VAASKILSGPAAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASQEYGWNLD 355

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L TIA+I+RAGCIIR++ L  I  +   D +  NLL  P   +   K   SLR +V+   
Sbjct: 356 LGTIAKIFRAGCIIRARFLQKITDAYANDAALANLLLDPYFQDIAAKYQASLRDVVIAAV 415

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 416 KAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|329121483|ref|ZP_08250107.1| 6-phosphogluconate dehydrogenase [Dialister micraerophilus DSM
           19965]
 gi|327469398|gb|EGF14868.1| 6-phosphogluconate dehydrogenase [Dialister micraerophilus DSM
           19965]
          Length = 470

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/470 (42%), Positives = 304/470 (64%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A +G+IGL  MG+NL+ N    GF   VYN+ +  T+ F+K+  G +  ++  + LE+
Sbjct: 3   QKAKLGLIGLAVMGANLARNAARNGFTTCVYNRTYSKTENFMKEF-GNNPHLVSAETLEE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +VE + KPRKIL+M+  G+ VD+ I+++ PL+   DI++DGGNS++ DTQ R   LS KG
Sbjct: 62  LVEKLEKPRKILLMIKAGEAVDKTIEQILPLIEKGDIIIDGGNSYYKDTQRREKYLSGKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I ++G+GVSGG +GA +G SLM G N KAYN ++ IL +ISAK    PC   +G DG+GH
Sbjct: 122 IEYVGMGVSGGEEGALNGPSLMPGANLKAYNELKPILEAISAKANGEPCVDYIGKDGAGH 181

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VK +HNGIEYA+MQ+IAD+Y  +++ L     E+++ + KW+ GKLSSYL++IT++IL 
Sbjct: 182 YVKTVHNGIEYADMQMIADVYMFMKEILCMTTDEMANTWEKWNKGKLSSYLVEITSQILR 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSM-TITETAIFARNLSLYRDESKK 300
             D  TG P++DVI DKA QKGTG  + +   +L ++  TITE A+FAR +S  ++E   
Sbjct: 242 KKDDETGKPMVDVILDKAMQKGTGKWTSLSALELGTAAPTITE-AVFARIMSSNKEERTA 300

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           +   +  + + P    D    + DLENALY + I ++ QGF +I ++S+ Y W + L  I
Sbjct: 301 LAKIYE-TVNLPKTDIDKKQIIDDLENALYGAKICAYAQGFNLIAQASKTYDWDVKLGNI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+IWR GCIIR+  L+ + ++  +     NLL     ++ +K++     RIV T   +G 
Sbjct: 360 AKIWRNGCIIRAGFLDRVTEAYEKQKEIENLLFTDYFAKALKESRAGWGRIVSTAVLSGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            VP+L +AL YFD +   +  A+LIQAQRD+FG+H ++R DK    H  W
Sbjct: 420 AVPALGSALQYFDAYRKSQSGASLIQAQRDYFGAHTYERNDKKGTFHTEW 469


>gi|89099010|ref|ZP_01171889.1| 6-phosphogluconate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086140|gb|EAR65262.1| 6-phosphogluconate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 468

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 291/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IGL  MG NL+ NI  +G+ ++VYN+  E T+  +K+  G  + +  T ++E
Sbjct: 1   MTKQEIGVIGLAVMGKNLAWNIESRGYAVSVYNRSSEKTEEMLKESEG--KNITGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPRKI++MV  G P D  I++LKP L   DIL+DGGN+ F DTQ R+ +LSE 
Sbjct: 59  EFVNSLEKPRKIMLMVKAGGPTDATIEQLKPHLEKGDILIDGGNTFFADTQRRNKELSEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++AY+ V  I   ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAYDLVAPIFKDISAKVNGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y +L++ L  +  E+  +F+ W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFLLKNVLGLSAEELHTVFADWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI D A QKGTG  +      L   + I   ++FAR LS  ++E   
Sbjct: 239 TKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGVPLPIITESVFARFLSAMKEERVH 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P +       ++F++ +  ALY S I S+ QGF  +  +S++YSW L    IA
Sbjct: 299 ASRLLKGPEAKSFQGNREAFIESVRKALYMSKICSYAQGFAQMRAASDEYSWDLKYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   +P   NLL  P   E  +    +LR I+ +  +NG P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDREPGLKNLLLDPYFKEIAESYQAALREIISSAVQNGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP  SAALSY+D++  +   ANL+QAQRD+FG+H + R DK    H  W
Sbjct: 419 VPCFSAALSYYDSYRTETLPANLLQAQRDYFGAHTYQRTDKEGTFHTNW 467


>gi|253576627|ref|ZP_04853955.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus
           sp. oral taxon 786 str. D14]
 gi|251844041|gb|EES72061.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paenibacillus
           sp. oral taxon 786 str. D14]
          Length = 470

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 291/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MK+  IG+IGL  MG NL+LNI  KGF +A+YN+  E T   +++  G  +  + T ++E
Sbjct: 1   MKKQQIGVIGLAVMGKNLALNIESKGFSVALYNRSPEKTKELLEEAPG--KNFVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G P D  I++L P L   DIL+DGGN+HF DTQ R+  L  +
Sbjct: 59  EFVQSLETPRKILIMVKAGKPTDDTINQLVPYLEKGDILIDGGNAHFPDTQRRNKLLEAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG GVSGG +GA  G ++M GG   AY  VE IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIRFIGAGVSGGEEGALKGPAIMPGGQRDAYELVEPILTAISAKVNGDPCSTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+D L  +  E+  +F++W++G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIGEAYHLLKDVLGLSVDELHKIFTEWNSGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG P++DVI D A QKGTG  +      L   ++I   ++FAR +S  + E   
Sbjct: 239 GKKDPATGKPMVDVILDSAGQKGTGKWTSQSALDLGVPLSIITESVFARFISAMKSERVA 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                N  +  P     ++F++ +  ALYAS I S+ QGF  +  +SE+Y W L+   IA
Sbjct: 299 ASKRLNGPATQPYDGDKEAFIEAVRKALYASKIASYAQGFAQMRLASEEYGWDLNYGAIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR++ L +I  +   DP+  NLL        V+    + R++V T    G P
Sbjct: 359 MIFRGGCIIRARFLQNIKDAYDRDPNLKNLLLDDYFKNVVENYQDAWRQVVATAVTRGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+ S+AL+Y+D++  +R  ANL+QAQRD+FG+H F+R D+    H  W
Sbjct: 419 IPAFSSALAYYDSYRSERLPANLLQAQRDYFGAHTFERVDQEGTFHFQW 467


>gi|167463315|ref|ZP_02328404.1| 6-phosphogluconate dehydrogenase [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322383339|ref|ZP_08057133.1| 6-phosphogluconate dehydrogenase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321152373|gb|EFX45178.1| 6-phosphogluconate dehydrogenase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 470

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/472 (43%), Positives = 295/472 (62%), Gaps = 9/472 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++V+N+  E T   +++  G  + ++ T +LE
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFTVSVFNRSPEKTKDLMEEAKG--RNLVGTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G   D  I++L PLLS  DIL+DGGN+HF DTQ RS +L  K
Sbjct: 59  EFVNSLETPRKILIMVKAGAATDATIEQLVPLLSEGDILIDGGNAHFPDTQRRSKELEAK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            I FIG GVSGG +GA  G ++M GG ++AY  VE+IL SISAK    PCC  +GPDG+G
Sbjct: 119 NIRFIGTGVSGGEEGALKGPAIMPGGQKEAYALVEDILTSISAKVNGDPCCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+D LN N  E+  +F +W+ G+L SYLI+IT +I 
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYHLLKDVLNVNAEELHEIFREWNKGELDSYLIEITRDIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  T  P++DVI D A QKGTG  +      L   ++I   ++F+R +S  ++E   
Sbjct: 239 TKYDLETKQPMVDVILDSAGQKGTGKWTSQSALDLGVPLSIITESVFSRFISAMKEERVA 298

Query: 301 MQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                +  +    K FD    SF++ +  ALYAS I S+ QGF  +  +SE+Y+W L   
Sbjct: 299 ASKVLSGPTQ---KLFDGDRKSFIEAVRKALYASKICSYAQGFAQMRSASEEYNWDLDFG 355

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +I+ I+R GCIIR++ L +I  +   +P   NLL        V++   + R++V T    
Sbjct: 356 SISMIFRGGCIIRARFLQNIKDAYDRNPGLKNLLLDEYFKNIVEEYQDAWRQVVATAITR 415

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G PVP+ ++AL+Y+D++  +R  ANL+QAQRD+FG+H F R D+    H  W
Sbjct: 416 GVPVPAFASALAYYDSYRTERLPANLLQAQRDYFGAHTFQRVDREGTFHFNW 467


>gi|311070530|ref|YP_003975453.1| 6-phosphogluconate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310871047|gb|ADP34522.1| 6-phosphogluconate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 467

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/467 (44%), Positives = 287/467 (61%), Gaps = 9/467 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+  KG R+AVYN   +LTD  ++K+ G  Q V     L+  V++
Sbjct: 5   IGVIGLGVMGSNIALNMASKGERVAVYNYTRDLTDRLVQKLDG--QSVNPYYELQDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           +  PRKI +MVT G PVD +I  L PLL   D+++DGGNSH+ +T+ R  QL EKGI ++
Sbjct: 63  LETPRKIFLMVTAGKPVDSVIHSLIPLLEKGDVIMDGGNSHYNETEQRYDQLKEKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA  G S+M GG++  Y +   IL  I+A+  + PCC  +GP GSGHFVKM
Sbjct: 123 GIGISGGEVGALKGPSIMPGGDQDVYEKAAPILTKIAAQVGDDPCCVYIGPKGSGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LRD+L     EI+ +F +W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRDTLRLPLNEIADIFEEWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            T  P+IDVI DKA QKGTG  + ++        +I   ++FAR LS  +DE    +   
Sbjct: 243 RTDAPLIDVILDKAGQKGTGKWTSMQAIDNGIPSSIITESLFARYLSALKDERVAAEQIL 302

Query: 306 N-PSS---HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           + P +   HF    +  +V+    ALY   + ++ QGF     +SE Y + L L  IA I
Sbjct: 303 SGPETEKKHFDKNLWIDYVR---QALYMGKVCAYAQGFAQYKMTSELYGYDLPLKDIALI 359

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           +R GCIIR++ LN I ++  E P   NLL  P  SEK+K     LR++V      G   P
Sbjct: 360 FRGGCIIRAEFLNIISEAFQEQPDLPNLLIAPYFSEKLKAYQTGLRKVVCEGINAGISFP 419

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            LS ALSY+D +   R  AN++QAQRD+FG+H ++R D     H  W
Sbjct: 420 CLSTALSYYDGYRTGRSNANILQAQRDYFGAHTYERTDMDGFFHTEW 466


>gi|126651942|ref|ZP_01724134.1| 6-phosphogluconate dehydrogenase [Bacillus sp. B14905]
 gi|126591211|gb|EAZ85320.1| 6-phosphogluconate dehydrogenase [Bacillus sp. B14905]
          Length = 466

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/464 (43%), Positives = 295/464 (63%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG ++AVYN   +LTD  ++K+ G  Q +     +E  V++
Sbjct: 5   IGVIGLGVMGSNIALNMANKGEQVAVYNYTRDLTDKLLQKVEG--QALTPYYEIEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G  +D +ID L P L   D+++DGGNSH+ DT+ R   L  +GI ++
Sbjct: 63  LEKPRKIFLMVTAGKAIDSVIDSLVPFLETGDVIMDGGNSHYQDTERRHDGLMARGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA +G S+M GG+ + Y +   IL  I+A+++ + CC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEVGALTGPSIMPGGDREVYEKAAPILTKIAAQFKGTSCCTYMGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR+++  +  EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRNNVGLSVEEIAEIFETWNEGELKSYLIEITAEILRKKDD 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
           +TG+P+ID+I DKA QKGTG  + ++        +I   A+FAR +S  ++E  + +   
Sbjct: 243 VTGLPLIDMILDKAGQKGTGKWTSMQSIDNGIPTSIITEALFARYISSLKEERVRAEVVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             PSS  P    D +V+ +  ALY   I ++ QGF     +SE Y W+L L  IA I+R+
Sbjct: 303 AGPSSTQPNLDKDMWVEYVRQALYMGKICAYAQGFTQYKMTSELYIWNLPLKDIALIFRS 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR++ LN I  +  + P+  NLL  P  +EK K     LR+IV    + G   P LS
Sbjct: 363 GCIIRAEFLNVISDAYEKQPTLANLLIDPYFAEKTKDYQSGLRKIVCEGIQAGNAFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           A+L+Y+D++      ANL+QAQRD+FG+H ++R D     H  W
Sbjct: 423 ASLTYYDSYRTGSSNANLLQAQRDYFGAHTYERTDLAGFFHTDW 466


>gi|271965416|ref|YP_003339612.1| 6-phosphogluconate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270508591|gb|ACZ86869.1| 6-phosphogluconate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 476

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/474 (41%), Positives = 287/474 (60%), Gaps = 1/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA IG+ GL  MG+NL+ N+   G  +AV+N+    T   +++  G     +  +  E
Sbjct: 1   MAQAQIGVTGLAVMGANLARNLARHGHAVAVHNRSQSRTKALMEQ-HGDEGTFVACETPE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V A+ +PR+IL+MV  G P D +I++  PLL P D+L+DGGN+HF DT+ R   L E+
Sbjct: 60  ELVAALERPRRILIMVKAGAPTDAVIEEFAPLLEPGDMLVDGGNAHFLDTRRREAALRER 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+F+G GVSGG +GA  G S+M GG+ ++Y  +  +L  I+AK    PCC  +GPDG+G
Sbjct: 120 GIHFVGAGVSGGEEGALLGPSIMPGGSRESYEALGPLLEDIAAKVDGVPCCTHIGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEYA+MQLIA+ Y +LR  L  +P E++ +F +W+ G+LSSYLI+ITAE+L
Sbjct: 180 HFVKMVHNGIEYADMQLIAEAYDLLRQGLGLSPAELADVFEEWNKGELSSYLIEITAEVL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG P++DVI D+A QKGTG  ++     L   ++    A+FAR++S + D  + 
Sbjct: 240 RQVDATTGRPLVDVIADRAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSVSGHADLREA 299

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            +    PS        + F +D+  ALYAS I+++ QGF  I   S +Y W +   ++A 
Sbjct: 300 ARGLPGPSGVPAGPVGEGFAEDVRRALYASKIIAYAQGFDQIRAGSAEYGWDVDPGSLAT 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+  L+ I ++   +     LL  P  +E +     S RR+V    E G P 
Sbjct: 360 IWRGGCIIRAVFLDRIREAYEGETPPVTLLTAPLFAEALGLAQDSWRRVVAKAAELGIPA 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  S AL+Y+D+   +R  A LIQ QRDFFG+H + R D+    H  W    TE
Sbjct: 420 PGFSTALAYYDSLRAERLPAALIQGQRDFFGAHTYQRTDREGSFHTLWSGDRTE 473


>gi|315646134|ref|ZP_07899254.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           vortex V453]
 gi|315278333|gb|EFU41649.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           vortex V453]
          Length = 469

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/473 (42%), Positives = 296/473 (62%), Gaps = 11/473 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  KGF ++VYN+  + T+  +K+  G  ++V  T  +E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESKGFTVSVYNRSPQKTEDMLKETEG--KQVKGTFTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I++L P L   DI++DGGN++F DTQ RS +L+E+
Sbjct: 59  EFVDSLETPRKILIMVQAGQATDATIEQLIPHLDQGDIIIDGGNAYFPDTQRRSKELAEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG E AY  VE IL +ISAK    PCC  +GPDG+G
Sbjct: 119 GFNFIGAGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKINEEPCCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+D L  +  ++  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYQLLKDVLGLDAKDLHGIFTEWNQGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   +++   ++F+R LS  ++E   
Sbjct: 239 SKYDEETGKPMVDVILDTAGQKGTGKWTSQSSLDLGVPLSMITESVFSRFLSAMKEERVA 298

Query: 301 MQSFFN-PSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                N P +      FD     F++++  AL+AS I+S+ QGF  +  +S++Y W+L  
Sbjct: 299 ASKILNGPKT----AAFDGDKAEFIENVRKALFASKIVSYAQGFAQLRVASDEYGWNLQY 354

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             +A+IWR GCIIRS+ L +I  +   +P   NLL  P  ++ ++    + R++V +   
Sbjct: 355 GNLAKIWRGGCIIRSRFLQNITDAYENNPELKNLLLDPFFTDIIETYQDAWRKVVASAVS 414

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP  S+AL+Y+D++      ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 415 LGIPVPGFSSALAYYDSYRTANLPANLLQAQRDYFGAHTFKRVDKEGTFHYNW 467


>gi|169629499|ref|YP_001703148.1| 6-phosphogluconate dehydrogenase [Mycobacterium abscessus ATCC
           19977]
 gi|169241466|emb|CAM62494.1| 6-phosphogluconate dehydrogenase [Mycobacterium abscessus]
          Length = 484

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/468 (41%), Positives = 291/468 (62%), Gaps = 5/468 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G     + ++++E+ 
Sbjct: 11  KAQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLAE-HGSEGNFVRSESIEEF 69

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PR++L+MV  GDP D +I++L   +   DI++DGGNS + DT  R   ++++G+
Sbjct: 70  VAALERPRRVLIMVKAGDPTDAVINELADAMEQGDIIIDGGNSLYTDTIRREKAMADRGL 129

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +K+Y  +  +L  ISA     PCC  +GPDGSGHF
Sbjct: 130 HFVGAGISGGEEGALNGPSIMPGGPKKSYESLGPLLEEISAHVDGVPCCTHIGPDGSGHF 189

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLI + Y +LRD L  +  +I+ +F+ W+ G+L SYLI+ITAE+L  
Sbjct: 190 VKMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFTAWNKGELESYLIEITAEVLKQ 249

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS  + +     
Sbjct: 250 VDAKTGKPLVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSKPQRAASV 309

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            F   S     K  D+  FV+D+  ALYAS I+++ QGF  I   S +Y W++S   +A 
Sbjct: 310 GF--ASGQLGEKPSDAKQFVEDVRQALYASKIVAYAQGFNQIAAGSAEYGWNVSPGDLAT 367

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+Q LN + ++  + P    L+  P   + V+K I S RR+VVT T+ G PV
Sbjct: 368 IWRGGCIIRAQFLNRVKEAFADRPDLATLIAAPYFRDAVEKGIDSWRRVVVTATQLGIPV 427

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  +++LSY+D    DR  A L QAQRDFFG+H ++R D   + H  W
Sbjct: 428 PGFASSLSYYDGLRTDRLPAALTQAQRDFFGAHTYERIDAPGKFHTLW 475


>gi|229493667|ref|ZP_04387452.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rhodococcus
           erythropolis SK121]
 gi|229319628|gb|EEN85464.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rhodococcus
           erythropolis SK121]
          Length = 485

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/474 (41%), Positives = 291/474 (61%), Gaps = 3/474 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G  +A++N+    TD  I +  G     + T+ +E+ 
Sbjct: 10  RAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALIAE-HGSEGDFVRTETVEEF 68

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ KPR++L+MV  G P D +I++L   + P DI++DGGNS + DT  R   +  +G+
Sbjct: 69  VAALQKPRRVLIMVKAGAPTDAVIEELANAMEPGDIIIDGGNSLYTDTIRREAAIRARGL 128

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +++Y  +  +L SISA    +PCC  +GPDGSGHF
Sbjct: 129 HFVGAGISGGEEGALNGPSIMPGGPKESYEALGPLLESISAHVDGTPCCTHIGPDGSGHF 188

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y + RD+L  +  +++ +F++W+ G L SYLI+ITAE+L  
Sbjct: 189 VKMVHNGIEYADMQLIGEAYNLFRDALGYDASQVADVFTEWNKGTLESYLIEITAEVLRQ 248

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS  R++    Q
Sbjct: 249 VDAETGKPLVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSRNQRAAAQ 308

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +    +     K  D+  F  D++ ALYAS I+++ QGF  I   S +Y W+L  A +A 
Sbjct: 309 AQGLAAGSLGDKPADAEQFAADIQAALYASKIVAYAQGFDQIAAGSAEYDWNLKPADLAT 368

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+Q LN I  +   DPS  +L+  P   E ++  I S RR+V T T  G PV
Sbjct: 369 IWRGGCIIRAQFLNRIKDAFDADPSLPSLILAPYFREAIEAGIDSWRRVVATATMLGIPV 428

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q QRDFFG+H ++R DK  + H  W    +E
Sbjct: 429 PAFASSLSYYDGLRAERLPAALTQGQRDFFGAHTYERIDKPGKFHTLWSGDRSE 482


>gi|218130783|ref|ZP_03459587.1| hypothetical protein BACEGG_02377 [Bacteroides eggerthii DSM 20697]
 gi|217987127|gb|EEC53458.1| hypothetical protein BACEGG_02377 [Bacteroides eggerthii DSM 20697]
          Length = 491

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/472 (43%), Positives = 306/472 (64%), Gaps = 18/472 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQ--KVIVT 56
           + + DIG+IGL  MG NL+LN+ DKG++++VYN+     +  V  + ++G ++  ++   
Sbjct: 4   LNKTDIGLIGLAVMGENLALNMADKGWQVSVYNRTVPGVEEGVVERFMNGRARGKRIQGY 63

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++   VE++  PRKI+MMV  G+ VD+L+++L PLLSP DIL+DGGNS++ DT  R   
Sbjct: 64  TDMALFVESIATPRKIMMMVRAGNAVDELMEQLFPLLSPGDILIDGGNSNYEDTNRRVAL 123

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
             EKG  F+G GVSGG +GA +GAS+M GG+  A+  V+ +L SI+AK  + +PCC  +G
Sbjct: 124 AEEKGFRFVGAGVSGGEEGALNGASIMPGGSVSAWEEVKPVLQSIAAKASDGTPCCQWVG 183

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLI++ Y ++++ L     E+S +FS W+ GKL SYLI+I
Sbjct: 184 PAGSGHFVKMIHNGIEYGDMQLISEAYWLMKNLLKLGNEEMSSVFSYWNEGKLRSYLIEI 243

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA IL   D   G  +ID I D A QKGTG  S++   +L   + +  TA+F R+LS  +
Sbjct: 244 TANILQHKDKSGGF-LIDKILDVAGQKGTGKWSVVNAMELGMPLGLIATAVFERSLSAQK 302

Query: 296 DESKKMQSFFNPSSHFPLKCFD------SFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +  +        S HF  +  D        VKD+ +ALYAS ++S+ QGF V+ ++SE +
Sbjct: 303 NLREA------ASRHFVCRHTDVVYNKSEMVKDIYSALYASKLVSYAQGFAVLQRASEAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L+LA+IAR+WR GCIIRS  LNDI  +  ++    +LL  P  S ++K+ +P  + +
Sbjct: 357 GWQLNLASIARMWRGGCIIRSVFLNDIAAAFEQNEKPQHLLLAPYFSNEMKQLLPGWKHL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 417 VAQAMKEELPVPAFSSALNYFYSLVSVKLPANMIQAQRDYFGAHTFERVDEL 468


>gi|310642787|ref|YP_003947545.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           polymyxa SC2]
 gi|309247737|gb|ADO57304.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           polymyxa SC2]
          Length = 468

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 290/469 (61%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++V+N+  E T   IK+  G  +K+  T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGFTVSVFNRSPEKTHDLIKEAEG--KKLTGTFSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G   D  I++L P L   DI++DGGN++F DTQ RS +L EK
Sbjct: 59  EFVNSLESPRKILIMVQAGKATDATIEQLVPHLDKGDIIIDGGNAYFPDTQRRSKELEEK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG GVSGG +GA +G ++M GG E AY  VE IL +ISAK    PCC  +GPDG+G
Sbjct: 119 GLRFIGTGVSGGEEGALNGPAIMPGGQESAYKLVEPILTAISAKVDGDPCCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+  LN +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIGEAYHLLKSVLNVSAEELHEIFTEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   +++   ++F+R LS  +DE   
Sbjct: 239 SQYDAETGKPMVDVILDAAGQKGTGKWTSQSALDLGVPLSMITESVFSRFLSAMKDERIA 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                + P +         F++ +  AL+AS I+S+ QGF  +  +S++Y W L    IA
Sbjct: 299 ASKVLSGPKAESFSGDKKEFIESVRKALFASKIVSYAQGFAQMRAASDEYDWDLKYGKIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIRSQ L +I  +   DP+  NLL        V+    + R+++      G P
Sbjct: 359 MIFRGGCIIRSQFLQNIKDAYDRDPALKNLLLDSYFKNVVETYQDAWRQVISVAVSQGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP  S+AL+Y+D++  +R  ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 419 VPGFSSALAYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHQW 467


>gi|258654898|ref|YP_003204054.1| 6-phosphogluconate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258558123|gb|ACV81065.1| 6-phosphogluconate dehydrogenase, decarboxylating [Nakamurella
           multipartita DSM 44233]
          Length = 486

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/477 (41%), Positives = 286/477 (59%), Gaps = 5/477 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +ADIG+ GL  MGSNL+ N    GF  AV+N+ +  T   I++  G     + +++    
Sbjct: 8   KADIGVTGLAVMGSNLARNFARNGFVTAVHNRSYAKTAALIEEHGG-DGVFVPSESAADF 66

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ KPRKIL+MV  G+P D +I++L  L+ P+DI++DGGN+ F DT+ R   L+E+GI
Sbjct: 67  VASLAKPRKILIMVKAGEPTDAVIEELAALVEPDDIIIDGGNAKFADTRRRQAALAERGI 126

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA +G S+M GG+ K+Y  +  IL  ISA+   +PCC  +G DG+GHF
Sbjct: 127 HFVGCGVSGGEEGALNGPSIMPGGSAKSYESLGPILEKISAQVDGAPCCTHIGTDGAGHF 186

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR     +P EI  +F +W+ G L S+LI+ITA++L+ 
Sbjct: 187 VKMVHNGIEYADMQLIAEAYDLLRRGAGLSPAEIGQIFGEWNKGDLDSFLIEITAQVLAQ 246

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D A  KGTG  ++     L   ++    A+FAR LS    +     
Sbjct: 247 VDADTGKPFVDVVVDAAGMKGTGTWTVQTALDLGIPVSGIAEAVFARGLSSAAAQRAAAA 306

Query: 303 SFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                P   +P+   D+FV+D+  ALYAS I+++ QG   I   + +Y W +++  +ARI
Sbjct: 307 GVLPGPDGTWPIADVDAFVEDVRIALYASKIVAYAQGLDEIFAGAAEYDWDINVGAVARI 366

Query: 362 WRAGCIIRSQILNDIVKSLTE---DPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           WR GCIIR++ LN I ++      D +  +LL  P  ++ +     S RR+V      G 
Sbjct: 367 WRGGCIIRAKFLNRITEAYDNTAVDATPASLLLAPYFTDAIAHAQDSWRRVVAGAATAGL 426

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           P P  +AALSY+D     R  A LIQ QRDFFG+H + R DK    H  W    TE+
Sbjct: 427 PTPGFAAALSYYDGLRSQRLPAALIQGQRDFFGAHTYHRVDKPGTFHTLWSGDRTET 483


>gi|222099208|ref|YP_002533776.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga
           neapolitana DSM 4359]
 gi|221571598|gb|ACM22410.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga
           neapolitana DSM 4359]
          Length = 472

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/469 (41%), Positives = 314/469 (66%), Gaps = 6/469 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK-KISGLSQKVIVTKNLEQ 61
           ++ IG+IGL  MG NL+LNI  KG++++V+N+  + T+ F+K ++ G  +++    +++ 
Sbjct: 5   KSSIGLIGLAVMGQNLALNIARKGYKVSVFNRTAQKTEEFVKNRVKG--EEIEPHYDIKD 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ +PRKI++MV  G PVD  I +L P L P D+++DGGNSH+ DT+ R   L+EKG
Sbjct: 63  FVESLERPRKIILMVKAGKPVDDTISQLLPYLEPGDLIIDGGNSHYLDTERRFKDLTEKG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
             F+G+GVSGG  GA  G SLM GG++KAY+ VE+ILL I+AK ++ PCC  +G   +GH
Sbjct: 123 FLFLGMGVSGGEYGALHGPSLMPGGSKKAYSLVEDILLKIAAKTEDGPCCTYVGERSAGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA MQ IA+IY I+RD L+    E+S +F +W++G+L+S+L++IT +IL 
Sbjct: 183 FVKMVHNGIEYAIMQSIAEIYHIMRDVLDLPTDEMSDIFKEWNSGELNSFLVEITYKILK 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++DVI D+A QKGTG  +      L         A+  R +S +++E  K+
Sbjct: 243 RKDEETGKPMVDVILDRAEQKGTGKWTSQAALDLGIPTPSINLAVVERIISHFKEERTKL 302

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              +N      L+  + F+KDL+++L+ +  ++F+QG W+I ++S+++S+++ L  + RI
Sbjct: 303 SKLYNKRRS-ALQKSEEFLKDLKDSLFFAMFMAFSQGMWLISEASKEFSYNVDLFEVLRI 361

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           W+ GCIIR+++++ + + ++++  + +LL    +   +K+ I SL+ ++    EN  PVP
Sbjct: 362 WKGGCIIRAKLIDTLRRYISDE--NAHLLESEEVISLLKERIGSLKNVLKVSIENEIPVP 419

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            LS+A +YF +   +R  ANLIQAQRDFFG+H F+R DK    H  W++
Sbjct: 420 VLSSAYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDKEGVFHINWEE 468


>gi|226306588|ref|YP_002766548.1| 6-phosphogluconate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|226185705|dbj|BAH33809.1| 6-phosphogluconate dehydrogenase [Rhodococcus erythropolis PR4]
          Length = 485

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/474 (41%), Positives = 291/474 (61%), Gaps = 3/474 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G  +A++N+    TD  I +  G     + T+ +E+ 
Sbjct: 10  RAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALIAE-HGSEGDFVRTETVEEF 68

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ KPR++L+MV  G P D +I++L   + P DI++DGGNS + DT  R   +  +G+
Sbjct: 69  VAALQKPRRVLIMVKAGAPTDAVIEELANAMEPGDIIIDGGNSLYTDTIRREAAIRARGL 128

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +++Y  +  +L SISA    +PCC  +GPDGSGHF
Sbjct: 129 HFVGAGISGGEEGALNGPSIMPGGPKESYEALGPLLESISAHVDGTPCCTHIGPDGSGHF 188

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y + RD+L  +  +++ +F++W+ G L SYLI+ITAE+L  
Sbjct: 189 VKMVHNGIEYADMQLIGEAYNLFRDALGYDAGQVADVFTEWNKGTLESYLIEITAEVLRQ 248

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS  R++    Q
Sbjct: 249 VDAETGKPLVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSRNQRAAAQ 308

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +    +     K  D+  F  D++ ALYAS I+++ QGF  I   S +Y W+L  A +A 
Sbjct: 309 AQGLAAGSLGDKPADAEQFAADIQAALYASKIVAYAQGFDQIAAGSAEYDWNLKPADLAT 368

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+Q LN I  +   DPS  +L+  P   E ++  I S RR+V T T  G PV
Sbjct: 369 IWRGGCIIRAQFLNRIKDAFDADPSLPSLILAPYFREAIEAGIDSWRRVVATATMLGIPV 428

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q QRDFFG+H ++R DK  + H  W    +E
Sbjct: 429 PAFASSLSYYDGLRAERLPAALTQGQRDFFGAHTYERIDKPGKFHTLWSGDRSE 482


>gi|317474305|ref|ZP_07933581.1| 6-phosphogluconate dehydrogenase [Bacteroides eggerthii 1_2_48FAA]
 gi|316909615|gb|EFV31293.1| 6-phosphogluconate dehydrogenase [Bacteroides eggerthii 1_2_48FAA]
          Length = 491

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/472 (43%), Positives = 305/472 (64%), Gaps = 18/472 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQ--KVIVT 56
           + + DIG+IGL  MG NL+LN+ DKG++++VYN+     +  V  + ++G ++  ++   
Sbjct: 4   LNKTDIGLIGLAVMGENLALNMADKGWQVSVYNRTVPGVEEGVVERFMNGRARGKRIQGY 63

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++   VE++  PRKI+MMV  G  VD+L+++L PLLSP DIL+DGGNS++ DT  R   
Sbjct: 64  TDMALFVESIATPRKIMMMVRAGSAVDELMEQLFPLLSPGDILIDGGNSNYEDTNRRVAL 123

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
             EKG  F+G GVSGG +GA +GAS+M GG+  A+  V+ +L SI+AK  + +PCC  +G
Sbjct: 124 AEEKGFRFVGAGVSGGEEGALNGASIMPGGSVSAWEEVKPVLQSIAAKASDGTPCCQWVG 183

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLI++ Y ++++ L     E+S +FS W+ GKL SYLI+I
Sbjct: 184 PAGSGHFVKMIHNGIEYGDMQLISEAYWLMKNLLKLGNEEMSSVFSYWNEGKLRSYLIEI 243

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA IL   D   G  +ID I D A QKGTG  S++   +L   + +  TA+F R+LS  +
Sbjct: 244 TANILQHKDKSGGF-LIDKILDVAGQKGTGKWSVVNAMELGMPLGLIATAVFERSLSAQK 302

Query: 296 DESKKMQSFFNPSSHFPLKCFD------SFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +  +        S HF  +  D        VKD+ +ALYAS ++S+ QGF V+ ++SE +
Sbjct: 303 NLREA------ASRHFVCRHTDVVYNKSEMVKDIYSALYASKLVSYAQGFAVLQRASEAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L+LA+IAR+WR GCIIRS  LNDI  +  ++    +LL  P  S ++K+ +P  + +
Sbjct: 357 GWQLNLASIARMWRGGCIIRSVFLNDIAAAFEQNEKPQHLLLAPYFSNEMKQLLPGWKHL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 417 VAQAMKEELPVPAFSSALNYFYSLVSVKLPANMIQAQRDYFGAHTFERVDEL 468


>gi|296129575|ref|YP_003636825.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cellulomonas
           flavigena DSM 20109]
 gi|296021390|gb|ADG74626.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cellulomonas
           flavigena DSM 20109]
          Length = 484

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/473 (40%), Positives = 286/473 (60%), Gaps = 4/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    GF +AV+N+ F  T   +   +      + ++++   V
Sbjct: 11  AQIGVTGLAVMGRNLARNFARHGFTVAVHNRTFARTQSLVADHAS-DGTFVPSESMADFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRK+++MV  G P D +ID+L PLL P DI++D GN+HF DT  R   L EKG++
Sbjct: 70  ASLERPRKVVVMVQAGAPTDAVIDELVPLLEPGDIVVDAGNAHFPDTVRREAALREKGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG +++Y  +  IL +ISAK    PCC  +GPDG+GHFV
Sbjct: 130 FVGTGVSGGEEGALNGPSIMPGGTKESYESLGPILEAISAKVDGVPCCTHVGPDGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR  L  +  EI  +F+ W+TG L S+LI++TAE+L+ +
Sbjct: 190 KMVHNGIEYADMQLIAEAYDLLRSGLGASAPEIGEVFAAWNTGDLESFLIEVTAEVLAHT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D A QKGTG  ++     L   +T    A FAR LS    +    + 
Sbjct: 250 DAATGRPFVDVVADAAEQKGTGRWTVQNALDLGVPITGIAEATFARALSGSAPQRAAARG 309

Query: 304 FFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              P+        D  +F++D+  ALYAS +++++QGF  I  +S ++ W +    +ARI
Sbjct: 310 VL-PADTLEWNVPDPGAFIEDVRLALYASKVVAYSQGFDQIAAASAQFGWDIDRGAMARI 368

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ L+ I ++   D +   LL  P  +  V   + + RR+V     +G P P
Sbjct: 369 WRGGCIIRAKFLDRITQAYERDANLPLLLADPYFTAAVANGVAAWRRVVSAAAAHGVPTP 428

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           + S++L+Y+D    +R  ANLIQAQRDFFG+H + R D+    H  W    +E
Sbjct: 429 AFSSSLAYYDGVRAERLPANLIQAQRDFFGAHTYRRTDREGTFHTDWSGDRSE 481


>gi|313891447|ref|ZP_07825063.1| phosphogluconate dehydrogenase (decarboxylating) [Dialister
           microaerophilus UPII 345-E]
 gi|313120222|gb|EFR43398.1| phosphogluconate dehydrogenase (decarboxylating) [Dialister
           microaerophilus UPII 345-E]
          Length = 470

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 302/470 (64%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A +G+IGL  MG+NL+ N    GF   VYN+ +  T+ F+K+  G +  ++  + LE+
Sbjct: 3   QKAKLGLIGLAVMGANLARNAARNGFTTCVYNRTYSKTENFMKEF-GNNPHLVSAETLEE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V  + KPRKIL+M+  G+ VD+ I+++ PL+   DI++DGGNS++ DTQ R   LS KG
Sbjct: 62  LVGKLEKPRKILLMIKAGEAVDKTIEQILPLIEKGDIIIDGGNSYYKDTQRREKYLSGKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I ++G+GVSGG +GA +G SLM G N KAYN ++ IL +ISAK    PC   +G DG+GH
Sbjct: 122 IEYVGMGVSGGEEGALNGPSLMPGANRKAYNELKPILEAISAKANGEPCVDYIGKDGAGH 181

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VK +HNGIEYA+MQ+IAD+Y  +++ L     E++  + KW+ GKLSSYL++IT++IL 
Sbjct: 182 YVKTVHNGIEYADMQMIADVYMFMKEILCMTTDEMASTWEKWNKGKLSSYLVEITSQILR 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSM-TITETAIFARNLSLYRDESKK 300
             D  TG P++DVI DKA QKGTG  + +   +L ++  TITE A+FAR +S  ++E   
Sbjct: 242 KKDDETGKPMVDVILDKAMQKGTGKWTSLSALELGTAAPTITE-AVFARIMSSNKEERTA 300

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           +   +  + + P    D    + DLENALY + I ++ QGF +I ++S+ Y W + L  I
Sbjct: 301 LAKIYE-TVNLPKADIDRKQIIDDLENALYGAKICAYAQGFNLIAQASKTYDWDVKLGNI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+IWR GCIIR+  L+ + ++  +     NLL     ++ +K++     RIV T   +G 
Sbjct: 360 AKIWRNGCIIRAGFLDRVTEAYEKQKEIENLLFTEYFAKALKESRAGWGRIVSTAVLSGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            VP+L +AL YFD +   +  A+LIQAQRD+FG+H ++R DK    H  W
Sbjct: 420 AVPALGSALQYFDAYRKSQSGASLIQAQRDYFGAHTYERNDKKGTFHTEW 469


>gi|304404087|ref|ZP_07385749.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           curdlanolyticus YK9]
 gi|304347065|gb|EFM12897.1| 6-phosphogluconate dehydrogenase, decarboxylating [Paenibacillus
           curdlanolyticus YK9]
          Length = 470

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 289/469 (61%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++V+N+  E TD  I++ +G  + ++ T  +E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFTVSVFNRSREKTDDLIQEAAG--KNLVPTYTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G   D  ID L P LS  DI++DGGN++F DT  RS  L  +
Sbjct: 59  EFVASLEVPRKILIMVQAGAGTDATIDSLVPHLSEGDIIIDGGNAYFPDTVRRSKALEAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG E AY  VE IL +ISAK     CC  +GPDG+G
Sbjct: 119 GFRFIGTGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVNGDACCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y +L+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYNLLQSVLGLDAKELHEIFTEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D  TG P++DVI D A QKGTG  +      L   ++I   ++FAR LS  ++E   
Sbjct: 239 SKYDPETGKPMVDVILDSAGQKGTGKWTSQSSLDLGVPLSIITESVFARFLSAMKEERVA 298

Query: 301 MQSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                      P +    +F++ +  AL+AS I S+ QGF  +  +S++YSW+L    IA
Sbjct: 299 ASKLLKGPKPAPFQGDKAAFIEAVRKALFASKICSYAQGFAQMRAASDEYSWNLRYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR++ L +I  +   DP+ +NLL  P   E V+    + R +V T    G P
Sbjct: 359 MIFRGGCIIRARFLQNIKDAYDRDPNLSNLLLDPYFQEIVESYQGAWREVVGTAVAQGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VPS ++A++YFD++  +R  ANL+QAQRD+FG+H F R DK    H  W
Sbjct: 419 VPSFASAIAYFDSYRTERLPANLLQAQRDYFGAHTFKRLDKEGSFHHNW 467


>gi|308177340|ref|YP_003916746.1| phosphogluconate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744803|emb|CBT75775.1| phosphogluconate dehydrogenase (decarboxylating) [Arthrobacter
           arilaitensis Re117]
          Length = 479

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/472 (40%), Positives = 297/472 (62%), Gaps = 3/472 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG+NL+ N    G+ +A++N+    TD  ++   G     I T++LE++V
Sbjct: 3   AQIGVTGLAVMGANLARNFARNGYTVALHNRSVGKTDALLEA-HGDEGDFIRTESLEELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             +  PR++L+MV  G PVD +ID+L PLL   D+++DGGNSH+ DT+ R   L+EKG++
Sbjct: 62  ANLETPRRVLIMVKAGGPVDSVIDQLVPLLEEGDVVIDGGNSHYTDTRRREAALAEKGLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+GIGVSGG +GA  G S+M GG+ ++Y  +  +L  ISAK  + +PCCA +  DG+GHF
Sbjct: 122 FVGIGVSGGEEGALLGPSIMPGGSAESYKSLGPMLEKISAKADDGAPCCAWISTDGAGHF 181

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQ+I + Y ++R +    P + + +F++W+ G+LSS+LI+ITAE+L  
Sbjct: 182 VKMVHNGIEYADMQVIGEAYDLMRSAAGIEPAKQAQIFNEWNQGELSSFLIEITAEVLGH 241

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P++DVI D A QKGTG  ++  G  + S ++    ++FAR+LS  RD     Q
Sbjct: 242 TDAATGKPLVDVIQDSAGQKGTGRWTVQSGLDMGSPVSAIAESVFARSLSSQRDIRAVGQ 301

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
                 +   +   ++FV+D+  AL+AS ++S+ QG  ++  ++ +Y+W L L  IA +W
Sbjct: 302 EVLTGETA-EVTLPENFVEDVRQALFASKLVSYAQGIDMLTSAAGEYNWELKLDEIAGLW 360

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR+ +L DI  + + D   +NLL  P+ ++ +   +P+ RR+V    + G P P 
Sbjct: 361 REGCIIRAALLKDITAAYSADEKPSNLLFAPAFAKAINDAVPAWRRVVSVAVQLGIPAPV 420

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            S++L+Y+D    DR  A L Q  RD+FG+H + R DK    H  W    TE
Sbjct: 421 FSSSLAYYDGLRRDRLPAALTQGLRDYFGAHTYRRTDKEGTFHTLWSGDRTE 472


>gi|312139812|ref|YP_004007148.1| 6-phosphogluconate dehydrogenase [Rhodococcus equi 103S]
 gi|325676736|ref|ZP_08156409.1| 6-phosphogluconate dehydrogenase [Rhodococcus equi ATCC 33707]
 gi|311889151|emb|CBH48464.1| 6-phosphogluconate dehydrogenase [Rhodococcus equi 103S]
 gi|325552284|gb|EGD21973.1| 6-phosphogluconate dehydrogenase [Rhodococcus equi ATCC 33707]
          Length = 486

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 291/474 (61%), Gaps = 5/474 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G  +A++N+    TD  + +  G     + T+ +E+ 
Sbjct: 13  RAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALLAE-HGDEGDFVRTETIEEF 71

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ KPR++L+MV  GD  D +I++L   + P DI++DGGN+ + DT  R   L E+G+
Sbjct: 72  VGALQKPRRVLIMVKAGDATDAVIEELADAMEPGDIIIDGGNALYTDTIRREAALRERGL 131

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +++Y  +  +L SISA    +PCC  +GPDGSGHF
Sbjct: 132 HFVGAGISGGEEGALNGPSIMPGGPKESYAALGPLLESISAHVDGTPCCTHIGPDGSGHF 191

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y + RD+L  +  +++ +F++W+ G L SYL++ITAE+L  
Sbjct: 192 VKMVHNGIEYADMQLIGEAYNLFRDALGFDAEQVADVFTEWNAGDLESYLVEITAEVLRQ 251

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG  ++DVI D A QKGTG  ++     L   +T    A+FAR LS  R++ K  Q
Sbjct: 252 KDAKTGKALVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSREQRKAAQ 311

Query: 303 SFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                S     K  D   F +D+  ALYAS I+++ QGF  I   S++Y W L+   +A 
Sbjct: 312 GL--ASGELGAKPTDVAQFTEDIRRALYASKIVAYAQGFDQIRAGSDEYGWDLTPGDMAT 369

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ LN I ++   +P  T+L+  P   E ++  I S RR+VVT T  G PV
Sbjct: 370 IWRGGCIIRARFLNRIKEAYDTNPELTSLIVEPYFREAIENAIDSWRRVVVTATTLGIPV 429

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q QRDFFG+H ++R D   + H  W    +E
Sbjct: 430 PAFASSLSYYDGLRAERLPAALTQGQRDFFGAHTYERVDMPGKFHTLWSGDRSE 483


>gi|311032077|ref|ZP_07710167.1| 6-phosphogluconate dehydrogenase [Bacillus sp. m3-13]
          Length = 469

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 292/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL++NI  +G+ ++V+N+  E T+ F+++  G + K   T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLAMNIESRGYSVSVFNRSPEKTEEFLQETEGRNFKG--TYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G P D  ID LKP L   DIL+DGGN+ + DT  R+ +L E 
Sbjct: 59  EFVQSLESPRKILLMVKAGGPTDATIDSLKPYLDKGDILIDGGNTLYTDTIRRNKELGEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG GVSGG +GA  G S+M GG  +AY  VE+IL SISAK +   CC  +GPDG+G
Sbjct: 119 GLNFIGTGVSGGEEGALKGPSIMPGGQREAYELVEDILKSISAKVEGDACCTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y +L++ L  +  E+  +FS+W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISEAYFLLKNVLGLSAQELHEVFSEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI D A QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKVDDETGKPLVDVILDTAGQKGTGKWTSKSALDLGVPLPIITESVFARFISAMKEERVK 298

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P +       ++F++ +  ALY S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASGILRGPEAVGFTGDKEAFIESVRKALYMSKICSYAQGFAQLRAASEEYGWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   +    NLL  P   E V+     LR I+    ++G P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDREAGLANLLLDPYFKEIVESYQGGLREILGVAIQHGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++  +   ANLIQAQRD+FG+H + R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRSETLPANLIQAQRDYFGAHTYQRVDKEGTFHTEWMK 469


>gi|319651458|ref|ZP_08005586.1| 6-phosphogluconate dehydrogenase [Bacillus sp. 2_A_57_CT2]
 gi|317396773|gb|EFV77483.1| 6-phosphogluconate dehydrogenase [Bacillus sp. 2_A_57_CT2]
          Length = 469

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/471 (42%), Positives = 290/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M ++  G+IGL  MG NL++NI  +G+ ++V+N+  E TD  +K++ G + K   T  +E
Sbjct: 1   MTKSQFGVIGLAVMGKNLAMNIESRGYSVSVFNRSREKTDEMLKEVEGRNFKGTYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPRKI++MV  G P D  I++LKPLL   DIL+DGGN+ F DTQ R+ +LSE 
Sbjct: 59  EFVDSLEKPRKIMLMVKAGGPTDATIEQLKPLLDKGDILIDGGNTFFVDTQRRNKELSEL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++AY  V  I   I+AK     C   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPIFQDIAAKVNGEACTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y +L++ L     E+  +F+ W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFLLKNVLGLTAEELHEVFADWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI D A QKGTG  +      L   + I   ++FAR +S  ++E   
Sbjct: 239 TKKDDETGKPLVDVILDTAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVN 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P++        +F++ +  ALY S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASKVLRGPAASEFTGDKKAFIESVRKALYMSKICSYAQGFAQMRAASEEYGWDLKYGDIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   +P   NLL  P   E V+    + R I+ T  +NG P
Sbjct: 359 MIFRGGCIIRAQFLQKIKEAYDREPGLKNLLLDPYFKEIVESYQDATREIISTAVKNGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP  SAALSY+D++  +   ANL+QAQRD+FG+H + R DK    H  W +
Sbjct: 419 VPCFSAALSYYDSYRTETLPANLLQAQRDYFGAHTYQRTDKEGIFHTNWME 469


>gi|186473528|ref|YP_001860870.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           phymatum STM815]
 gi|184195860|gb|ACC73824.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           phymatum STM815]
          Length = 469

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/469 (42%), Positives = 293/469 (62%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G  ++V+N+  E TD  I +     +K++ T  LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGHAVSVFNRTREKTDELIAEFP--DRKLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ILMMV  G+  D  I  L+PLL   DIL+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLEKPRRILMMVKAGEGTDATIASLRPLLEKGDILIDGGNTHFTDTIRRNQELAKSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG  +AY+ V  IL  I+AK  +  PC A +GPDG+G
Sbjct: 120 LHFIGTGVSGGEEGALKGPSIMPGGQREAYDLVAPILTEIAAKAPDGEPCVAYMGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I 
Sbjct: 180 HFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGAVYTEWNKGELDSYLIEITSKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  +D+   
Sbjct: 240 DKKDDETGKDLVDVIMDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKDQRVA 299

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  P      +F++ +  ALY S ++S+ QGF  +  +S++Y W L   TIA
Sbjct: 300 ASKVLEGPAAKPFSGDRAAFIEAVRRALYFSKVISYAQGFAQLRAASDEYKWDLDYGTIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  + T+D    NLL  P   +       +LR +V+  T  G P
Sbjct: 360 KIFRAGCIIRARFLQKITDAYTKDKQIANLLLDPYFRDIAANYQQALRDVVIAATTAGVP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ S+A++YFD +   R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 VPAFSSAIAYFDGYRSARLPANLVQAQRDFFGAHTFERLDKPGSFHANW 468


>gi|329954203|ref|ZP_08295297.1| phosphogluconate dehydrogenase [Bacteroides clarus YIT 12056]
 gi|328527909|gb|EGF54895.1| phosphogluconate dehydrogenase [Bacteroides clarus YIT 12056]
          Length = 491

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 210/479 (43%), Positives = 305/479 (63%), Gaps = 32/479 (6%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGL 49
           + + DIG+IGL  MG NL+LN+ DKG++++VYN+        + D FI      K I G 
Sbjct: 4   LNKTDIGLIGLAVMGENLALNMADKGWQVSVYNRTVPGIEEGVVDRFINGRARGKSIRGY 63

Query: 50  SQKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCD 109
           +       ++ + VE+V  PRKI+MMV  G  VD+L+++L PLLSP DIL+DGGNS++ D
Sbjct: 64  T-------DIARFVESVAAPRKIMMMVRAGSAVDELMEQLFPLLSPGDILIDGGNSNYED 116

Query: 110 TQIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-S 168
           T  R     EKG  F+G GVSGG +GA +GAS+M GG+  A++ V+ IL SI+AK  + +
Sbjct: 117 TNRRVALAEEKGFRFVGAGVSGGEEGALNGASIMPGGSVTAWDEVKPILQSIAAKASDGT 176

Query: 169 PCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKL 228
           PCC  +GP GSGHFVKMIHNGIEY +MQLI++ Y ++++ L  N  E+S +FS W+ GKL
Sbjct: 177 PCCQWVGPAGSGHFVKMIHNGIEYGDMQLISEAYWVMKNLLQLNNEEMSSVFSTWNEGKL 236

Query: 229 SSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFA 288
            SYLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F 
Sbjct: 237 RSYLIEITANILRHKDK-SGGYLIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFE 295

Query: 289 RNLSLYRDESKKMQSFFNPSSHFPLKCFD------SFVKDLENALYASTILSFTQGFWVI 342
           R+LS  +   +      + + HF  +  D        VKD+ +ALYAS ++S+ QGF V+
Sbjct: 296 RSLSAQKSLRE------SAAKHFVCQRTDVVYNKPEMVKDIYSALYASKLVSYAQGFAVL 349

Query: 343 GKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKT 402
            ++S+ + W+L LA+IAR+WR GCIIRS  LNDI  +  +     +LL  P  S ++K+ 
Sbjct: 350 QRASDAFGWNLDLASIARMWRGGCIIRSIFLNDIAAAFEQAGKPQHLLLAPYFSNEMKQL 409

Query: 403 IPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           +   + +V    +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 410 LSGWKHLVAQAMKEELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERVDEL 468


>gi|296270075|ref|YP_003652707.1| 6-phosphogluconate dehydrogenase [Thermobispora bispora DSM 43833]
 gi|296092862|gb|ADG88814.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermobispora
           bispora DSM 43833]
          Length = 479

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/474 (40%), Positives = 286/474 (60%), Gaps = 2/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +ADIG+ GL +MG NL+ N    G+ +AV+N+    T  F+ +  G     +   ++E
Sbjct: 5   MDKADIGVTGLATMGRNLARNFAHHGYTVAVHNRTVSRTKEFMAEHGG-EGAFLPADSIE 63

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ +PRK ++MV  G   D +I++L   + P D+++DGGN+HF DT+ R   L E+
Sbjct: 64  EFVASLKRPRKAIIMVMAGSATDAVIEQLAAHMEPGDMIVDGGNAHFADTRRREAALRER 123

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+F+G G+SGG +GA  G S+M GG+ +AY  +  +L  I+AK   +PCC  +GPDG+G
Sbjct: 124 GIHFVGTGISGGEEGALRGPSIMPGGSPEAYLELGPMLEDIAAKVDGTPCCVHVGPDGAG 183

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEYA+MQLIA+ Y +LR  L   P E++ +F +W+ G L SYLI+ITAE+L
Sbjct: 184 HFVKMVHNGIEYADMQLIAEAYDLLRQGLGATPAELAEIFREWNRGDLESYLIEITAEVL 243

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
             +D  TG P +D++ D+A QKGTG  ++     L   +T    A+FAR LS +  E +K
Sbjct: 244 GHTDPATGSPFVDIVLDRAEQKGTGRWTVQSALDLGVPVTGIAEAVFARALSAH-PEKRK 302

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
             +             D+ V+D+  ALYAS I+++ QGF  I  +S +Y W ++L ++A 
Sbjct: 303 AAATLAGPRGGRAAGGDTLVEDVRKALYASKIIAYAQGFDQIAAASREYGWDVNLGSLAT 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ L+ I  +   DPS   LL  P+ +E +     + RR+V T    G P 
Sbjct: 363 IWRGGCIIRARFLDRIRAAYDADPSLPTLLVDPAFAEALADAQDAWRRVVSTAVTIGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  S+AL+Y+D    DR  A LIQ  RD+FG+H + R D+    H  W     E
Sbjct: 423 PGFSSALAYYDALRRDRLPAALIQGMRDYFGAHTYRRVDREGAFHTDWSGDRAE 476


>gi|313633341|gb|EFS00187.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           seeligeri FSL N1-067]
 gi|313637954|gb|EFS03262.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           seeligeri FSL S4-171]
          Length = 472

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/473 (42%), Positives = 294/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +K+     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMKE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    N  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLNHDELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  ++E   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKEERVY 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  + PSS+        FV+ +  ALY S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASTVLHGPSSYHFEGDKKEFVESVRRALYFSKIASYAQGFAQMRAASEEYDWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNQDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 471


>gi|315303045|ref|ZP_07873753.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           ivanovii FSL F6-596]
 gi|313628580|gb|EFR97005.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           ivanovii FSL F6-596]
          Length = 472

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 294/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMEE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    N  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLNHEELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  ++E   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKEERVY 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  N  S++  +     FV+ +  ALY S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASTVLNGPSNYHFEGDKKEFVESVRRALYFSKIASYAQGFAQMRAASEEYDWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNQDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERIDKPGIFHTEWPQVE 471


>gi|225420204|ref|ZP_03762507.1| hypothetical protein CLOSTASPAR_06547 [Clostridium asparagiforme
           DSM 15981]
 gi|225041150|gb|EEG51396.1| hypothetical protein CLOSTASPAR_06547 [Clostridium asparagiforme
           DSM 15981]
          Length = 475

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/468 (43%), Positives = 294/468 (62%), Gaps = 2/468 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           +++ IGIIGL  MG +L+LN+ D GF+++ YN+   +T+  ++      + +    +LE+
Sbjct: 5   QKSHIGIIGLSVMGRSLALNMADHGFKVSGYNRSASVTEQVMEDHP--HKNLFPFYSLEE 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ +PRK+++M+  G PVD +ID+L PLL   DI++DGGNS F DT+ RS  L+E G
Sbjct: 63  FVNSLERPRKVMLMIQAGAPVDAVIDQLVPLLEQGDIVMDGGNSFFEDTRRRSNALAEAG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I+++G+G+SGG +GAR G S+M GG E AY  V  IL +I+AK    PCCA +GPDG+GH
Sbjct: 123 IHYLGVGISGGEEGARFGPSIMPGGEESAYQAVRPILEAIAAKAMGEPCCAYIGPDGAGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEYA+MQLIA+ Y +L+   N +  E++ +F +W+ G+L SYLI ITA I  
Sbjct: 183 YVKMVHNGIEYADMQLIAEAYLLLKYVGNFSNFELADIFREWNQGELKSYLIGITAGIFR 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
            +D + G  +ID I D A QKGTG  + IE  K    +++  +A  AR LS + DE K  
Sbjct: 243 EADDLDGGQLIDRILDSARQKGTGRWASIESLKQGVDISMITSACGARILSNHLDERKMA 302

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
            +              +F + +  ALYA  I+++ QGF ++  +SE+Y W+L L TIA I
Sbjct: 303 SAQIEGPGILQADDRAAFAETVRRALYAGKIIAYAQGFSLMQDASERYGWNLDLGTIASI 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           +RAGCII++  L DI K+   D ++ NL+  P    ++ +   SLR  V T   NG PVP
Sbjct: 363 FRAGCIIQAVFLGDITKAYEADSNAGNLMFNPFFGNRINEYQDSLRCAVSTGVLNGLPVP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           +LS A SY D F      ANLIQAQRD FG+H ++R D+    H  W+
Sbjct: 423 ALSQAASYLDAFRSPASGANLIQAQRDCFGAHTYERNDRPGSFHHEWR 470


>gi|257057613|ref|YP_003135445.1| 6-phosphogluconate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256587485|gb|ACU98618.1| 6-phosphogluconate dehydrogenase (decarboxylating)
           [Saccharomonospora viridis DSM 43017]
          Length = 484

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/469 (40%), Positives = 286/469 (60%), Gaps = 4/469 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA IG+ GL  MG NL+ N+   G  +A+YN+  + T   +++  G   + + T + ++ 
Sbjct: 7   QASIGVTGLAVMGRNLARNLARHGHTVALYNRTGQRTQDLVEQF-GSEGEFVPTYSPQEF 65

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PRKI++MV  G P D +ID+  PLL P DI++D GN+HF DT+ R   L E+G+
Sbjct: 66  VAALERPRKIIIMVKAGAPTDAVIDEFTPLLEPGDIVVDAGNAHFADTRRREAALRERGL 125

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E +Y  +  +   I+AK   +PCC  +GPDG+GHF
Sbjct: 126 HFVGAGVSGGEEGALHGPSIMPGGSESSYASLGPLFEDIAAKVDGAPCCTHVGPDGAGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ + +LR +L   P +I+ +F  W++G+L SYLI+ITAE+L+ 
Sbjct: 186 VKMVHNGIEYSDMQLIAESFDLLRGALGYEPAQIAEVFRTWNSGRLDSYLIEITAEVLAH 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +D++ D+A QKGTG  ++  G +L   +T    A FAR+LS + D  +  +
Sbjct: 246 TDPATGKPFVDIVADQAEQKGTGRWTVQTGLELGVPITGIAEATFARSLSGHVDLRRAAR 305

Query: 303 SFFNPSSHFPL---KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
               P    P       DSF  D+E ALYAS ++++ QGF  I   S +Y W++ L  +A
Sbjct: 306 GLAGPDRTAPSVRGSVPDSFADDVEQALYASKVVAYAQGFNQIQAGSAEYGWNIDLGAVA 365

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ L+DI  +   + +   LL        V+    + R +V T    G P
Sbjct: 366 AIWRGGCIIRAKFLDDIRAAYRAESTLPTLLASGEFRTAVEDAQDAWRSVVSTAVRLGIP 425

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P  S AL+Y+D    +R  A+LIQ QRD+FG+H + R D+    H  W
Sbjct: 426 TPGFSTALAYYDALRAERLPASLIQGQRDYFGAHTYRRVDRAGSFHTTW 474


>gi|254301219|ref|ZP_04968663.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 406e]
 gi|157811340|gb|EDO88510.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 406e]
          Length = 471

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 293/472 (62%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE 
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLEA 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLATPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + +  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKAQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W+L L TI
Sbjct: 300 AASEVLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASWAE 471


>gi|167577192|ref|ZP_02370066.1| 6-phosphogluconate dehydrogenase [Burkholderia thailandensis TXDOH]
          Length = 471

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 293/472 (62%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  +D+  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                    +  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W L L TI
Sbjct: 300 AASKVLAGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWKLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASWAE 471


>gi|125856984|emb|CAE46567.1| 6-phosphogluconate dehydrogenase [Lactobacillus sanfranciscensis]
          Length = 476

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 302/471 (64%), Gaps = 6/471 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A+IG+IG+  MG NL+LNI  +G+ +A+YN+    T+  +K  S   + ++   N++ 
Sbjct: 4   KKANIGVIGMAVMGKNLALNIESRGYTVAIYNRSASKTEQVMKDHS--DKHLVPAYNVKD 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ +PR ILMMV  G P D +I+++ PLLS  D L+DGGN++F DT  R+ +L++ G
Sbjct: 62  FVDSIEQPRTILMMVKAGKPTDAVINEILPLLSKGDTLIDGGNTNFHDTIARNEELAKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
           I FIG+GVSGG  GA  G SLM GG ++AY+RV  IL  I+AK ++  PC A +G +G+G
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDRVAPILEKIAAKAEDGKPCVAYIGSNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI +++ ILR++   +  +++ +FS W+ G+L+SYLI+ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEELIDEVFNILRNAAGYSVDDLAKIFSDWNKGELNSYLIEITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +      PI+D+I D+ + KGTG  S  +     +  ++   +++AR +S+ +DE
Sbjct: 242 TRKDDLGDDKNKPIVDMILDRGANKGTGKWSSEDALDEGAPQSVITESVYARFVSMLKDE 301

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                   +  +  P    D  V+D+  ALY   I+S+ QGF  +  +S+ + W L    
Sbjct: 302 RVAASKVLHGPAKKPKFGSDDIVEDMRQALYFGKIMSYAQGFEQMRMASDNHKWGLKYGE 361

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +A+IWR GCIIR+Q L +I K+  ++PS  NLL  P   +   K   S RR+V   TE G
Sbjct: 362 LAQIWREGCIIRAQFLXEITKAFEKNPSLDNLLMDPFFGDIANKYQDSARRVVAFATEYG 421

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVPSL+AALSYFD++  +   ANL+QAQRD+FG+H ++R D+    H PW
Sbjct: 422 IPVPSLAAALSYFDSYRAEVLPANLLQAQRDYFGAHTYERTDRPGNFHYPW 472


>gi|78485559|ref|YP_391484.1| 6-phosphogluconate dehydrogenase [Thiomicrospira crunogena XCL-2]
 gi|78363845|gb|ABB41810.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Thiomicrospira
           crunogena XCL-2]
          Length = 482

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 295/474 (62%), Gaps = 17/474 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI------KKISGLSQKVI 54
           M +ADIG++GL  MG NL LN+ D G+ + VYN+  E TD FI      + +SG S    
Sbjct: 1   MSKADIGLVGLAVMGQNLVLNMADHGYHVCVYNRSKEKTDDFIQNRVEDRPVSGAS---- 56

Query: 55  VTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS 114
               LE++V  +  PRK+++MV  GD VD  ID+L PLL   D+++DGGNS + D+  R+
Sbjct: 57  ---TLEELVGCLKAPRKVMLMVKAGDVVDSFIDQLVPLLDKGDMIIDGGNSLYTDSTRRT 113

Query: 115 LQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALL 174
             L EKGI F+G GVSGG +GAR+G S+M GGN  A+  V+ I   I+AK  N+PCC  +
Sbjct: 114 QALKEKGILFVGTGVSGGEEGARTGPSIMPGGNPDAWASVKPIFQDIAAKSDNAPCCDWV 173

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           GP+G+GH+VKM+HNGIEY +MQLI + Y ++R+ L  +  E   +FS W+ G L SYLI+
Sbjct: 174 GPEGAGHYVKMVHNGIEYGDMQLITEAYQLMREGLGLSADECHQVFSDWNNGVLDSYLIE 233

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           ITA+ILS  D   G P++D I D A QKGTG  + I   +L   +T+   +++AR LS  
Sbjct: 234 ITADILSFKDK-DGEPLVDKILDAAGQKGTGKWTGISSLELGMPLTLITESVYARCLSAL 292

Query: 295 RDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           + E       +           D+ ++ + +ALYAS I+S+ QG+ ++ ++++++ W L+
Sbjct: 293 KTERVAASKLYPRKKIVSKTNKDAMLQAIHDALYASKIISYAQGYMLMSEAAKEFDWELN 352

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
              IA +WR GCIIRS  L +I K+  E P+ +NLL  P   + +K    + R+ VV   
Sbjct: 353 YGGIALMWRGGCIIRSTFLAEIKKAYDESPNLSNLLRAPFFEDAIKNAEENWRKAVVFGV 412

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           E+  P P+LS+AL++FD +  +R  ANL+QAQRD+FG+H ++R D    P G +
Sbjct: 413 ESQIPTPALSSALAFFDGYRSERLPANLLQAQRDYFGAHTYERVDA---PRGEY 463


>gi|22298119|ref|NP_681366.1| 6-phosphogluconate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294297|dbj|BAC08128.1| 6-phosphogluconate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 480

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/471 (42%), Positives = 292/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q D G+IGL  MG NL+LN+   GF +AVYN+    T+ F+ + +   ++   T  LE
Sbjct: 1   MSQQDFGVIGLAVMGENLALNVERNGFSVAVYNRTPARTEAFMAERAA-GRRFKATYTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V ++ +PR+IL MV  G PVD LI +LKPLL P DIL+DGGNS + DT+ R  ++   
Sbjct: 60  ELVASLSRPRRILAMVKAGQPVDDLIQQLKPLLEPGDILIDGGNSLYTDTERRVAEMESA 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F G+GVSGG +GA +G SLM GG+ +AY  +E IL  I+A+  + PC   +GP GSG
Sbjct: 120 GLCFFGMGVSGGEEGALNGPSLMPGGSREAYQALEPILTKIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKW-DTGKLSSYLIKITAEI 239
           HFVKM+HNGIEY +MQLIA+ Y +L++ L  N  ++  +F  W +T +L+S+LI+IT++I
Sbjct: 180 HFVKMVHNGIEYGDMQLIAEAYDLLKNLLGLNHQQLHEVFKSWNETPELNSFLIEITSQI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
            +  D  T +P++DVI D A QKGTG  ++    ++  ++     A+ AR +S  + E  
Sbjct: 240 FTYIDPETHLPLVDVIVDAAGQKGTGRWTVESALEMGVAIPTITAAVNARIMSSIKAERM 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEK-YSWSLSLAT 357
              Q    P++HF     + F+  + +ALY S I S+ QG  +I K S++ +   L+L+ 
Sbjct: 300 AAAQVLPGPAAHFSGNT-EEFIGKIRDALYCSKICSYAQGMALIAKGSQELFDHQLNLSE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IARIW+ GCIIR+  LN I ++ +E+P   NLL  P   + +     + R ++V  T  G
Sbjct: 359 IARIWKGGCIIRAGFLNKIKQAYSENPQLANLLLAPEFRQTILDKQAAWREVLVEATRAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             VP+  A+L YFD++  DR   NL QAQRDFFG+H ++R DK    H  W
Sbjct: 419 IAVPAFGASLEYFDSYRRDRLPQNLTQAQRDFFGAHTYERIDKPGTFHTEW 469


>gi|226366439|ref|YP_002784222.1| 6-phosphogluconate dehydrogenase [Rhodococcus opacus B4]
 gi|226244929|dbj|BAH55277.1| 6-phosphogluconate dehydrogenase [Rhodococcus opacus B4]
          Length = 483

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/474 (40%), Positives = 290/474 (61%), Gaps = 5/474 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G  +A++N+    TD  I +  G     + T+ +E+ 
Sbjct: 10  RAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALIAE-HGSEGDFVRTETIEEF 68

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ KPR++L+MV  GDP D +I++L   + P DI++DGGN+ + DT  R   L ++G+
Sbjct: 69  VAALQKPRRVLIMVKAGDPTDAVIEELASAMEPGDIIIDGGNALYTDTIRREAALRDRGL 128

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +++Y  +  +L SI+A+   +PCC  +GPDGSGHF
Sbjct: 129 HFVGAGISGGEEGALNGPSIMPGGPKESYEALGPLLESIAAQVDGTPCCTHIGPDGSGHF 188

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y + RD+L  +  +++ +F+ W+ G L SYL++ITAE+L  
Sbjct: 189 VKMVHNGIEYADMQLIGEAYNLFRDALGYDADQVADVFTDWNAGDLESYLVEITAEVLRQ 248

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG  ++DVI D A QKGTG  ++     L   +T    A+FAR LS  R++ K   
Sbjct: 249 KDAKTGKALVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSREQRKAAV 308

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                S     K  D+  F +D+  ALYAS ++++ QGF  I   S +Y W L  A +A 
Sbjct: 309 GL--ASGALADKPADAAQFTEDIRQALYASKVVAYAQGFDQIAAGSAEYDWGLHPADLAT 366

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ LN I ++  E+P   +L+  P   + ++  I S RR+V T T  G PV
Sbjct: 367 IWRGGCIIRARFLNRIKEAYDENPKLPSLILAPYFRDAIETAIDSWRRVVSTATLLGIPV 426

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q QRDFFG+H ++R D   + H  W    +E
Sbjct: 427 PAFASSLSYYDALRAERLPAALTQGQRDFFGAHTYERVDAEGKFHTLWSGDRSE 480


>gi|256379684|ref|YP_003103344.1| 6-phosphogluconate dehydrogenase, decarboxylating [Actinosynnema
           mirum DSM 43827]
 gi|255923987|gb|ACU39498.1| 6-phosphogluconate dehydrogenase, decarboxylating [Actinosynnema
           mirum DSM 43827]
          Length = 479

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/465 (40%), Positives = 288/465 (61%), Gaps = 2/465 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A I + GL  MGSNL+ N+   GFR+AV+N+    T   I +  G   + +  + L+++V
Sbjct: 8   ARIAVTGLAVMGSNLARNLARHGFRVAVHNRTNARTKALISE-HGHEGEFVPAETLDELV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+I++MV  G P D +ID+L PLL P D+++DGGN+H+ DT+ R   L E G++
Sbjct: 67  GSLQKPRQIIIMVKAGAPTDAVIDELAPLLEPGDMVIDGGNAHYADTRRREAALREAGLH 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG++++Y  V  +L +ISAK     CC  +GPDG+GHFV
Sbjct: 127 FVGAGISGGEEGALNGPSIMPGGSKESYEHVGPVLEAISAKVNGEACCVHVGPDGAGHFV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ + +L  +    P E++ +F  W+TG L SYL++ITAE+L+  
Sbjct: 187 KMVHNGIEYADMQLIAEAFDLLHRAGGLTPAEVAEVFRGWNTGDLESYLVEITAEVLAHV 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG  ++DVI D+A QKGTG  ++ E  +L   +T    A+FAR+LS    + +  ++
Sbjct: 247 DAETGSALVDVIADEAEQKGTGRWTVQEALELGVPVTGIAEAVFARSLSGRASQREAARA 306

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
               +     +  DS V+D+  ALYAS ++++ QGF  +  +S +Y W L L + A IWR
Sbjct: 307 ALGVNEVVASRD-DSLVEDVRQALYASKVVAYAQGFDQMRAASTEYGWDLDLGSTATIWR 365

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ L+ I ++   +P    LL      + V+    + RR+ V   ++G P P  
Sbjct: 366 GGCIIRARFLDRIKEAYDRNPELETLLADDYFRDAVRTAEDAWRRVAVKAVQSGVPAPGF 425

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            +ALSY+D    +R  A+LIQ  RDFFG+H + R D+    H  W
Sbjct: 426 VSALSYYDALRSERLPASLIQGLRDFFGAHTYRRTDREGSFHTLW 470


>gi|119961574|ref|YP_948148.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrobacter
           aurescens TC1]
 gi|119948433|gb|ABM07344.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrobacter
           aurescens TC1]
          Length = 479

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 304/474 (64%), Gaps = 2/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M  A IG+ GL  MG+NL+ N+   GF +A++N+  E TD  ++K  G     I T+ L+
Sbjct: 1   MMSAHIGVTGLAVMGANLARNLARNGFTVALHNRSVEKTDALLEK-HGTDGDFIRTETLQ 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V+++ KPR++L+MV  G PVD +I++L+PLL   DI++D GNSH+ DT+ R   L++K
Sbjct: 60  ELVDSLEKPRRVLIMVKAGAPVDNVIEQLEPLLEAGDIIIDAGNSHYEDTRRREAALAKK 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            ++F+G+GVSGG +GA +G S+M GG+ ++Y+ +  +L  ISAK    PCCA +G DG+G
Sbjct: 120 DLHFVGVGVSGGEEGALNGPSIMPGGSRESYDALGPLLEKISAKVDGEPCCAWIGTDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEYA+MQ+I + + +LR      P E S +F++W+ G LSS+LI+I+AE+L
Sbjct: 180 HFVKMVHNGIEYADMQVIGEAFDLLRSGAGIEPAEQSKIFAEWNKGDLSSFLIEISAEVL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG P +DV+ D A QKGTG  ++I   +L S ++    ++FAR LS  + E +K
Sbjct: 240 GHVDAKTGKPFVDVVVDAAGQKGTGRWTVISALELGSPVSGIAESVFARALS-SQTEQRK 298

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +           ++  ++FV+D+  ALYAS ++S+ QG  ++  ++++Y W L L  IA 
Sbjct: 299 LGQELLAGEEASVEIPETFVEDVRQALYASKLVSYAQGLDMLTSAAKEYGWDLKLDEIAS 358

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WRAGCIIR+++L DI K+   +    NLL  P+ +  + + +P+ RR+V T  + G PV
Sbjct: 359 LWRAGCIIRAELLKDITKAYAAEEKPANLLFAPAFTRAIAEALPAWRRVVATAVQLGIPV 418

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  S++L+Y+D     R  A LIQ QRD FG+H + R D     H  W +  +E
Sbjct: 419 PVFSSSLAYYDGLRRKRVAAALIQGQRDLFGAHTYGRVDTEGTFHTLWGEDKSE 472


>gi|300934003|ref|ZP_07149259.1| 6-phosphogluconate dehydrogenase [Corynebacterium resistens DSM
           45100]
          Length = 496

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/476 (40%), Positives = 296/476 (62%), Gaps = 8/476 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSN++ N    G  +AVYN+    TD F++  +  +   + +  +E+ V
Sbjct: 21  AQIGVVGLAVMGSNIARNFASHGHTVAVYNRTTAKTDKFMEDFAD-TGSFVASATIEEFV 79

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ +PR+ L+MV  G   D +I +L   + P DI++DGGN+ + DT  R  ++ E+G++
Sbjct: 80  QSLERPRRALIMVQAGAGTDAVIAQLADAMEPGDIIIDGGNALYTDTIRREKEIRERGLH 139

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G ++M GG  ++Y  +  +L SISAK    PCC  +GPDG+GHFV
Sbjct: 140 FVGAGISGGEEGALNGPAIMPGGPAESYESLGPLLESISAKVDGEPCCTHIGPDGAGHFV 199

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR++   +P EI+ +F +W+ G L SYLI+ITAE+L+ +
Sbjct: 200 KMVHNGIEYADMQVIGEAYHLLRNATGMSPAEIAEVFREWNAGDLDSYLIQITAEVLAQT 259

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D A QKGTG  ++     L   +T    A+FAR LS  R + +  Q 
Sbjct: 260 DAETGRPLVDIIVDAAGQKGTGRWTVKSALDLGIPVTGIGEAVFARALSGARAQREAAQG 319

Query: 304 FFNPSSHF-----PLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              PS        P +  + F++D+  ALYAS ++++ QGF  I   SE+Y+W L    +
Sbjct: 320 KL-PSGQLTAAIDPTERAE-FIEDVRRALYASKLVAYAQGFDQILAGSEEYNWDLDPKDM 377

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++  E+P   +LL  P  + +++  I S R++V+  T  G 
Sbjct: 378 ARIWRGGCIIRARFLNRITEAYEENPELESLLLAPYFNNELRDLIDSWRKVVIKATGLGL 437

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           PVP  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 438 PVPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYGRVDKPGAFHTLWSGDRSE 493


>gi|220907002|ref|YP_002482313.1| 6-phosphogluconate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219863613|gb|ACL43952.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cyanothece sp.
           PCC 7425]
          Length = 482

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/479 (41%), Positives = 301/479 (62%), Gaps = 8/479 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G+IGL  MG NL+LN+   GF +AVYN+    TD F+ +     + V  T ++E
Sbjct: 1   MSKQQFGLIGLAVMGENLALNVERNGFPIAVYNRTPTKTDAFMAE-RAQGRNVKATYSIE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V A+ +PR+IL+MV  G PVD +I +LKPLL P DIL+DGGNS + DT  R  ++   
Sbjct: 60  ELVAALERPRRILIMVKAGQPVDDMIAQLKPLLEPGDILIDGGNSLYADTSRRVREMEAA 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG  +AY  +E IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLRFVGMGVSGGEEGALNGPSLMPGGTREAYEALEPILTKIAAQVDDGPCVTYIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTG-KLSSYLIKITAEI 239
           H+VK +HNGIEY +MQLIA+ Y +L+++L  N L++  +FS+W+T  +L+S+LI+ITA+I
Sbjct: 180 HYVKTVHNGIEYGDMQLIAEAYDLLKNALGLNHLQLHEIFSEWNTTPELNSFLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRD 296
            S  D  TG+P+++VI D+A QKGTG  +++    L  ++     A+ AR +S   L R 
Sbjct: 240 FSYLDADTGLPLVEVILDEAGQKGTGRWTVVSALDLGVAIPTITAAVNARIMSSEKLERV 299

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
            + K+ +   P+  +      +FV  + +ALY S I S+ QG  ++ K+S++++++L+L 
Sbjct: 300 AAAKVLT--GPTGKYQGDT-QAFVNKIRDALYCSKICSYAQGMALMVKASKEFTFNLNLG 356

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IARIW+ GCIIR+  LN I  +  E+P   NLL  P   + +     + R ++    + 
Sbjct: 357 EIARIWKGGCIIRAAFLNKIKHAFDENPQLANLLLAPEFKQTILDKQQAWREVLSEAAKL 416

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           G  VP+ SA+L YFD++  DR   NL QAQRDFFG+H + R DK    H  W ++S  S
Sbjct: 417 GIAVPAFSASLDYFDSYRRDRLPQNLTQAQRDFFGAHTYQRTDKAGVFHTEWTEISEAS 475


>gi|167841073|ref|ZP_02467757.1| 6-phosphogluconate dehydrogenase [Burkholderia thailandensis
           MSMB43]
          Length = 471

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 294/472 (62%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGEVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + +  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWASQNALDLGVPLPLITESVFARVLSSLKAQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W+L L TI
Sbjct: 300 AASKVLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNTALANLLLDPYFQDIAANYQSALRNVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHANWAE 471


>gi|289434658|ref|YP_003464530.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
 gi|289170902|emb|CBH27444.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
          Length = 472

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 294/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +K+     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMKE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    N  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLNHDELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  ++E   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKEERVY 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  + PSS+        FV+ +  ALY S I S+ QGF  +  +S++Y W L    IA
Sbjct: 299 ASTVLHGPSSYHFEGDKKEFVESVRRALYFSKIASYAQGFAQMRAASDEYDWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNQDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 471


>gi|258654674|ref|YP_003203830.1| 6-phosphogluconate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258557899|gb|ACV80841.1| 6-phosphogluconate dehydrogenase, decarboxylating [Nakamurella
           multipartita DSM 44233]
          Length = 487

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/478 (41%), Positives = 283/478 (59%), Gaps = 9/478 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GL  MGSNL+ N    GF  AV+N+ +  T   I +  G     + +++    V
Sbjct: 10  ADIGVTGLAVMGSNLARNFARNGFVTAVHNRSYAKTKALIDEHGG-DGVFVPSESAADFV 68

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPRKIL+MV  G+P D +I++L  L+ P+DI++DGGN+ F DT+ R   L+E+GI+
Sbjct: 69  ASLAKPRKILIMVKAGEPTDAVIEELAALVEPDDIIIDGGNAKFADTRRRQAALAERGIH 128

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG+ K+Y  +  IL  ISA    +PCC  +G DG+GHFV
Sbjct: 129 FVGCGVSGGEEGALNGPSIMPGGSAKSYESLGPILERISAHVDGAPCCTHIGTDGAGHFV 188

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR     +P  I  +F +W+ G L S+LI+ITA++LS  
Sbjct: 189 KMVHNGIEYADMQLIAEAYDLLRRGAGLSPARIGQIFGEWNKGDLDSFLIEITAQVLSQV 248

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D A  KGTG  ++     L   ++    A+FAR LS           
Sbjct: 249 DAETGAPFVDVVVDAAGMKGTGTWTVQTALDLGIPVSGIAEAVFARGLSSAAAHRAAAAG 308

Query: 304 FF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
               P   +P+   D+FV+D+  ALYAS I+++ QG   I   + +Y W +++  +ARIW
Sbjct: 309 VLPGPDGTWPIADVDAFVEDVRIALYASKIVAYAQGLDEIFAGAAEYGWDINVGAVARIW 368

Query: 363 RAGCIIRSQILNDI-----VKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           R GCIIR++ LN I     V +  E P+S  LL  P  ++ +     S RR+V      G
Sbjct: 369 RGGCIIRAKFLNRITEAYDVSTGIELPAS--LLLAPYFTDAIANAQDSWRRVVAGAATAG 426

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
            P P  +AALSY+D    +R  A LIQ QRDFFG+H + R DK    H  W    TE+
Sbjct: 427 LPTPGFAAALSYYDGLRSERLPAALIQGQRDFFGAHTYQRVDKPGTFHTLWSGDRTET 484


>gi|300865357|ref|ZP_07110168.1| 6-phosphogluconate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300336660|emb|CBN55318.1| 6-phosphogluconate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 484

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/479 (40%), Positives = 304/479 (63%), Gaps = 6/479 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q + G+IGL  MG NL+LN+  +GF ++V+N+ +  T+ F+ K     + +I T+ L+
Sbjct: 1   MAQQNFGVIGLAVMGENLALNVESRGFSVSVFNRTYAKTEEFMAK-RAQGKNIIATQTLQ 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ +PR+IL+MV  G PVD +I +LKP+L PED+++DGGNS + DT+ R+ +L   
Sbjct: 60  EFVESLERPRRILVMVQAGKPVDAVIQQLKPMLDPEDMIIDGGNSLYEDTERRTKELEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+G+SGG +GA +GASLM GG + AY ++E IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLGFVGMGISGGEEGALNGASLMPGGTQTAYGKLEPILTKIAAQVDDGPCVTFIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L++    N  ++  +F++W+ T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNVAGLNGEQLHEVFAEWNTTDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
              +D  T  P+++VI D A QKGTG  +++    +  S+     A+ AR +S Y+DE  
Sbjct: 240 FKFTDPDTKQPLVEVIMDSAGQKGTGRWTVVSALDMGVSIPTITAAVNARIMSSYKDERI 299

Query: 300 KMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K  S  + PS+ +        V  + +ALY S I S+ QG  ++  +S+ +++ L+L+ I
Sbjct: 300 KASSELSGPSAKYEGDP-KELVGKIRDALYCSKICSYAQGMALLSAASKSFNYELALSEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  L+ I K+  +D    NLL  P   + +     + R ++ T +  G 
Sbjct: 359 ARIWKGGCIIRAGFLDKIKKAFNDDAKLPNLLLAPEFKQTILDRQVAWREVLATASTLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVSTES 475
            VP+ SA+L YFD++  DR   NL QAQRD+FG+H ++R DK      H  W + S +S
Sbjct: 419 AVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYERTDKPRGEFFHTEWTQASKDS 477


>gi|299541823|ref|ZP_07052146.1| 6-phosphogluconate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298725561|gb|EFI66202.1| 6-phosphogluconate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 466

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 297/464 (64%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+ +KG ++AVYN   +LTD  ++K+ G  Q +     +E+ V+A
Sbjct: 5   IGVIGLGVMGSNIALNMANKGEQVAVYNYTRDLTDKLLQKVEG--QALTPYYEIEEFVQA 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G+ +D ++  + P L   D+++DGGNSH+ DT+ R  +L   GI ++
Sbjct: 63  LEKPRKIFLMVTAGNAIDSVVQSVVPFLEKGDVIMDGGNSHYKDTERRYDELKALGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA +G S+M GG+++ YN+V  IL  I+A+  ++PCC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEVGALTGPSIMPGGDQEVYNKVAPILTKIAAQVNDTPCCTYIGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR ++  +  EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLRKNIGLSVEEIATIFETWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
           +TG+P+ID+I DKA QKGTG  + ++        +I   A+FAR +S  ++E  + ++  
Sbjct: 243 VTGLPLIDMILDKAGQKGTGKWTSLQSIDNGIPTSIITEALFARYISSLKEERIRAEAIL 302

Query: 306 N-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           + P+        D +++ +  ALY   I ++ QGF     +S  Y W+L L  IA I+R+
Sbjct: 303 SGPNYKQQNLDKDVWIEYVRQALYMGKICAYAQGFTQYKMTSGLYEWNLPLKDIALIFRS 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR++ LN I ++  + PS  NLL  P  +EK       LR+IV    + G   P LS
Sbjct: 363 GCIIRAEFLNVISEAYQKQPSLNNLLIDPYFAEKTMDYQNGLRKIVCEGIQAGNAFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           A+L+Y+D++      AN++QAQRD+FG+H ++R D     H  W
Sbjct: 423 ASLTYYDSYRTGSSNANMLQAQRDYFGAHTYERIDAQGVFHTNW 466


>gi|254186165|ref|ZP_04892683.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157933851|gb|EDO89521.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 471

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 293/472 (62%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE 
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLEA 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + +  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKAQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W+L L TI
Sbjct: 300 AASEMLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASWAE 471


>gi|53716584|ref|YP_105207.1| 6-phosphogluconate dehydrogenase [Burkholderia mallei ATCC 23344]
 gi|53722770|ref|YP_111755.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei K96243]
 gi|76817886|ref|YP_335987.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 1710b]
 gi|124382309|ref|YP_001025596.1| 6-phosphogluconate dehydrogenase [Burkholderia mallei NCTC 10229]
 gi|126444549|ref|YP_001063509.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 668]
 gi|126447314|ref|YP_001077671.1| 6-phosphogluconate dehydrogenase [Burkholderia mallei NCTC 10247]
 gi|126455800|ref|YP_001076409.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 1106a]
 gi|167000048|ref|ZP_02265875.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei PRL-20]
 gi|167820713|ref|ZP_02452393.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 91]
 gi|167850549|ref|ZP_02476057.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei B7210]
 gi|167899142|ref|ZP_02486543.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 7894]
 gi|167907485|ref|ZP_02494690.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei NCTC
           13177]
 gi|167915825|ref|ZP_02502916.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei 112]
 gi|167923663|ref|ZP_02510754.1| 6-phosphogluconate dehydrogenase [Burkholderia pseudomallei BCC215]
 gi|217422170|ref|ZP_03453673.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 576]
 gi|226195759|ref|ZP_03791346.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei Pakistan 9]
 gi|237510436|ref|ZP_04523151.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei MSHR346]
 gi|238561841|ref|ZP_00441366.2| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei GB8 horse 4]
 gi|242311574|ref|ZP_04810591.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1106b]
 gi|254177296|ref|ZP_04883952.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei ATCC 10399]
 gi|254184937|ref|ZP_04891526.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1655]
 gi|254193845|ref|ZP_04900277.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei S13]
 gi|254203158|ref|ZP_04909520.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei FMH]
 gi|254208492|ref|ZP_04914841.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei JHU]
 gi|254264480|ref|ZP_04955345.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1710a]
 gi|254359323|ref|ZP_04975595.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei 2002721280]
 gi|52213184|emb|CAH39224.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei K96243]
 gi|52422554|gb|AAU46124.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei ATCC 23344]
 gi|76582359|gb|ABA51833.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1710b]
 gi|126224040|gb|ABN87545.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 668]
 gi|126229568|gb|ABN92981.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1106a]
 gi|126240168|gb|ABO03280.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei NCTC 10247]
 gi|147746203|gb|EDK53281.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei FMH]
 gi|147751179|gb|EDK58247.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei JHU]
 gi|148028510|gb|EDK86470.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei 2002721280]
 gi|160698336|gb|EDP88306.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei ATCC 10399]
 gi|169650596|gb|EDS83289.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei S13]
 gi|184215529|gb|EDU12510.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1655]
 gi|217394401|gb|EEC34420.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 576]
 gi|225932244|gb|EEH28244.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei Pakistan 9]
 gi|235002641|gb|EEP52065.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei MSHR346]
 gi|238523798|gb|EEP87234.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei GB8 horse 4]
 gi|242134813|gb|EES21216.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1106b]
 gi|243063998|gb|EES46184.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei PRL-20]
 gi|254215482|gb|EET04867.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 1710a]
 gi|261826739|gb|ABN00554.2| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           mallei NCTC 10229]
          Length = 471

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 293/472 (62%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE 
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLEA 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + +  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKAQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W+L L TI
Sbjct: 300 AASEVLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASWAE 471


>gi|269127029|ref|YP_003300399.1| 6-phosphogluconate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268311987|gb|ACY98361.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermomonospora
           curvata DSM 43183]
          Length = 475

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/468 (39%), Positives = 280/468 (59%), Gaps = 2/468 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++A IG+ GL  MG NL+ N+   G  +AV+N+    T+  + +  G     I  K   
Sbjct: 1   MQEASIGVTGLAVMGRNLARNLARHGHPVAVHNRTAARTEELVAEF-GHEGTFIPAKTPR 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V A+ +PR++++MV  G P D +I +  PLL P D+++DGGN+HF DT+ R   L E 
Sbjct: 60  ELVAALRRPRRLIVMVKAGAPTDAVIAEFAPLLEPGDMIVDGGNAHFSDTRRRERWLREH 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+F+G G+SGG +GA  G S+M GG+ ++Y  +  +L  I+AK    PCC  +GPDG+G
Sbjct: 120 GIHFVGTGISGGEEGALHGPSIMPGGSAESYRELGPLLEDIAAKVDGVPCCTHVGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEYA+MQLI + Y +LR      P EI+ +F+ W+ G+L SYLI+ITA++L
Sbjct: 180 HFVKMVHNGIEYADMQLIGEAYDLLRHGAGLAPSEIAEVFAAWNRGRLESYLIEITAQVL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           + +D  TG P +DV+ D+A QKGTG  ++    +L   ++    A+FAR LS +    + 
Sbjct: 240 AHTDPATGRPFVDVVLDRAEQKGTGRWTVQTALELGVPVSGIAEAVFARALSGHAALRRA 299

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            ++   P    P     SF  ++E ALYAS I+++ QGF  I   S +Y W++    +A 
Sbjct: 300 ARALPGPRPSRPADA-GSFADEVEKALYASKIVAYAQGFHQIQAGSAEYGWNIDPGAMAT 358

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ L+ I  +   DP++  LL     ++ +     + R++V T    G P 
Sbjct: 359 IWRGGCIIRARFLDRIRAAYAADPATPTLLADEYFAQALGDAQDAWRKVVATAAHLGIPA 418

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  + ALSY+D    +R  A L QAQRDFFG+H + R D+    H  W
Sbjct: 419 PGFATALSYYDALRAERLPAALTQAQRDFFGAHTYRRVDREGSYHTRW 466


>gi|83717630|ref|YP_438830.1| 6-phosphogluconate dehydrogenase [Burkholderia thailandensis E264]
 gi|167615349|ref|ZP_02383984.1| 6-phosphogluconate dehydrogenase [Burkholderia thailandensis Bt4]
 gi|257141915|ref|ZP_05590177.1| 6-phosphogluconate dehydrogenase [Burkholderia thailandensis E264]
 gi|83651455|gb|ABC35519.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           thailandensis E264]
          Length = 471

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/472 (41%), Positives = 292/472 (61%), Gaps = 6/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATITALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  +D+  
Sbjct: 240 FGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                    +  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W L L  I
Sbjct: 300 AASKVLAGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWKLDLGAI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W +
Sbjct: 420 PVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASWAE 471


>gi|209525229|ref|ZP_03273772.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrospira
           maxima CS-328]
 gi|209494414|gb|EDZ94726.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrospira
           maxima CS-328]
          Length = 474

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/462 (41%), Positives = 297/462 (64%), Gaps = 4/462 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G+IGL  MG NL+LN+   GF +AVYN+    TD F++K     + V    +LE
Sbjct: 1   MSEQKFGVIGLAVMGENLALNVERNGFPVAVYNRTSAKTDEFMQK-RAPGKNVKPAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ +PR+IL+MV  G PVD +ID+LKPLL  +D+++DGGNS + DT+ R+ +L   
Sbjct: 60  EFVQSLERPRRILVMVKAGKPVDAVIDQLKPLLDQDDMIIDGGNSLYEDTERRTKELEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA  G SLM GG E +Y  +E IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLGFMGMGVSGGEEGALWGPSLMPGGTENSYQALEPILTKIAAQVDDGPCVTYIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +LR+ +  N  ++  +F++W+ T +L+S+L++ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLRNVIGLNEQQLYEVFAEWNTTDELNSFLVEITADI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  TG P++D+I D A QKGTG  +++   +L  S+     A+ +R +S Y+DE  
Sbjct: 240 FKQKDPETGKPLVDLILDSAGQKGTGRWTVVSALELGVSIPTITAAVNSRIISSYKDERV 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              Q    PS++F      +F+  + +ALY S I S+ QG  +IGK+S+++++ L+L  I
Sbjct: 300 AASQQLPGPSANFDGDV-SAFINKVRDALYCSKICSYAQGMALIGKASQEFNYHLNLGEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  LN I ++  ++P   NLL  P   + +     + R ++VT    G 
Sbjct: 359 ARIWKGGCIIRAGFLNKIKQAYDQNPQLPNLLLAPEFKQTILDRQSAWREVLVTANTMGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           PVP+ SA+L YFD++       NL QAQRD+FG+H ++R DK
Sbjct: 419 PVPAFSASLDYFDSYRRVSLPQNLTQAQRDYFGAHTYERIDK 460


>gi|189466255|ref|ZP_03015040.1| hypothetical protein BACINT_02626 [Bacteroides intestinalis DSM
           17393]
 gi|189434519|gb|EDV03504.1| hypothetical protein BACINT_02626 [Bacteroides intestinalis DSM
           17393]
          Length = 495

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/465 (43%), Positives = 296/465 (63%), Gaps = 6/465 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVTKNL 59
           ++ DIG+IGL  MG NL+LN+ DKG+ ++VYN+     +  V  +  +G ++   +    
Sbjct: 9   QKTDIGLIGLAVMGENLALNMADKGWHVSVYNRTVPGVEEGVVERFTNGRAKGKTIEGYT 68

Query: 60  E--QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL 117
           E    VE++  PRKI+MMV  G+ VD+L+++L P LSP DIL+DGGNS++ DT  R    
Sbjct: 69  EIPDFVESISTPRKIMMMVRAGNAVDELMEQLFPYLSPGDILIDGGNSNYEDTNRRVALA 128

Query: 118 SEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
            +KG  F+G GVSGG +GA +GAS+M GG+  A++ V+ IL SI+A+  + +PCC  +GP
Sbjct: 129 EQKGFRFVGAGVSGGEEGALNGASIMPGGSVTAWDEVKPILQSIAARAADGTPCCDWIGP 188

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L  +  E++ +F+ W+ GKL SYLI+IT
Sbjct: 189 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLLQLDNEEMASVFAHWNEGKLRSYLIEIT 248

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           A IL   D   G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 249 ANILRHKDKAGGY-LIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQKN 307

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     F       +      VKD+ +ALYAS ++S+ QGF V+ K+SE Y W L LA
Sbjct: 308 LREAASKQFACQRSQVVYNKPELVKDIYSALYASKLVSYAQGFAVLQKASETYGWDLDLA 367

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K+ +   + +V    + 
Sbjct: 368 SIARMWRGGCIIRSVFLNDIAAAFEASQKPKHLLLAPYFREEIKELLSGWKHLVAHAMKE 427

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 428 ELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 472


>gi|111024196|ref|YP_707168.1| 6-phosphogluconate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110823726|gb|ABG99010.1| phosphogluconate dehydrogenase (decarboxylating) [Rhodococcus
           jostii RHA1]
          Length = 483

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/474 (41%), Positives = 291/474 (61%), Gaps = 5/474 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G  +A++N+    TD  I++  G     + T+ +E+ 
Sbjct: 10  RAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALIEE-HGSEGDFVRTETIEEF 68

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ KPR++L+MV  GDP D +I++L   + P DI++DGGN+ + DT  R   L E+G+
Sbjct: 69  VGALQKPRRVLIMVKAGDPTDAVIEELAAAMEPGDIIIDGGNALYTDTIRREASLRERGL 128

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG +++Y  +  +L SI+A+   +PCC  +GPDGSGHF
Sbjct: 129 HFVGAGISGGEEGALNGPSIMPGGPKESYAALGPLLESIAAQVDGTPCCTHIGPDGSGHF 188

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +L  +L  +  +I+ +F++W+ G L SYL++ITAE+L  
Sbjct: 189 VKMVHNGIEYADMQLIGEAYNLLGSALGYDADKIADVFTEWNGGDLESYLVEITAEVLRQ 248

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS  R++ K   
Sbjct: 249 KDAKTGKPLVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSREQRKAAV 308

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                S     K  D+  F +D+  ALYAS ++++ QGF  I   S +Y W L  A +A 
Sbjct: 309 GL--ASGVLADKPTDAAQFTEDIRQALYASKVVAYAQGFDQIAAGSAEYDWDLHPADLAT 366

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ LN I  +  E+P   +L+  P   + ++  I S RR+V T T  G PV
Sbjct: 367 IWRGGCIIRARFLNRIKDAYDENPKLPSLILAPYFRDAIETAIDSWRRVVSTATLLGIPV 426

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q QRDFFG+H ++R D   + H  W    +E
Sbjct: 427 PAFASSLSYYDALRAERLPAALTQGQRDFFGAHTYERVDAEGKFHTLWSGDRSE 480


>gi|254253619|ref|ZP_04946936.1| 6-phosphogluconate dehydrogenase [Burkholderia dolosa AUO158]
 gi|124898264|gb|EAY70107.1| 6-phosphogluconate dehydrogenase [Burkholderia dolosa AUO158]
          Length = 470

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/470 (43%), Positives = 299/470 (63%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLMPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D    +  E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLSNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDEETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  +  PL+    +F++ +  ALY S ++S+ QGF  +  +SE+Y W+L L TI
Sbjct: 300 AASKILSGPAAAPLQGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +   +   SLR +VV   + G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFQDIAAQYQASLRDVVVAAVKAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 PVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|325963689|ref|YP_004241595.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323469776|gb|ADX73461.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 478

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 304/471 (64%), Gaps = 2/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG+NL+ N+   GF +A++N+  E TD  +++  G     I T+ L+++V
Sbjct: 3   AHIGVTGLAVMGANLARNLARNGFTVALHNRSVEKTDALLERY-GSEGDFIRTETLQELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ KPR++L+MV  G PVD +I++L+PLL   DI++D GNSH+ DT+ R   L++K ++
Sbjct: 62  DSLEKPRRVLIMVKAGKPVDSVIEQLEPLLEAGDIIIDAGNSHYEDTRRREAALAKKDLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG +GA +G S+M GG++++Y  +  +L  ISAK    PCCA +G DG+GHFV
Sbjct: 122 FVGVGVSGGEEGALNGPSIMPGGSKESYKALGPLLEKISAKVDGEPCCAWVGTDGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + + +LR      P E + +F+ W+ G+LSS+LI+I+AE+L   
Sbjct: 182 KMVHNGIEYADMQVIGEAFDLLRSGAGIEPAEQAKIFTDWNQGELSSFLIEISAEVLGHV 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D A QKGTG  ++I   +L S ++    ++FAR LS  + E +++  
Sbjct: 242 DAKTGKPFVDVVVDAAGQKGTGRWTVISALELGSPVSGIAESVFARALS-SQTEQRRLGQ 300

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
                +   ++  ++FV+D+  ALYAS ++S+ QG  ++  ++++Y W L L  IA +WR
Sbjct: 301 ELLAGNEADVEIPETFVEDVRQALYASKLVSYAQGLDMLTSAAKEYGWDLKLDEIASLWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIR+++L DI K+   D    NLL  P+ +E +   +P+ RR+V T  + G PVP  
Sbjct: 361 AGCIIRAELLKDITKAYAADEKPANLLFAPAFTEAIAGALPAWRRVVATAVQLGIPVPVF 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S++L+Y+D     R  A LIQ QRD FG+H + R D     H  W +  +E
Sbjct: 421 SSSLAYYDGLRRKRVAAALIQGQRDLFGAHTYGRVDAEGTFHTLWGEDKSE 471


>gi|167763679|ref|ZP_02435806.1| hypothetical protein BACSTE_02057 [Bacteroides stercoris ATCC
           43183]
 gi|167698973|gb|EDS15552.1| hypothetical protein BACSTE_02057 [Bacteroides stercoris ATCC
           43183]
          Length = 491

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/466 (43%), Positives = 298/466 (63%), Gaps = 6/466 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT-- 56
           + + DIG+IGL  MG NL+LN+ DKG+R++VYN+     +  V  + I+G +Q   +   
Sbjct: 4   LNKTDIGLIGLAVMGENLALNMADKGWRVSVYNRTVPGIEEGVVERFINGRAQGKSIEGY 63

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++ + VE+V  PRKI+MMV  G  VD+L+++L PLLSP DIL+DGGNS++ DT  R   
Sbjct: 64  TDIARFVESVAVPRKIMMMVRAGSAVDELMEQLFPLLSPGDILIDGGNSNYEDTNRRVAL 123

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
              +G  F+G GVSGG +GA +GAS+M GG+  A+  V+ +L SI+AK  + +PCC  +G
Sbjct: 124 AEARGFRFVGAGVSGGEEGALNGASIMPGGSVSAWEEVKPVLQSIAAKASDGTPCCQWVG 183

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLI++ Y ++++ L  +  E+S +FS+W+ GKL SYLI+I
Sbjct: 184 PAGSGHFVKMIHNGIEYGDMQLISEAYWVMKNLLKLDNGEMSSVFSQWNEGKLRSYLIEI 243

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  +
Sbjct: 244 TANILQHKDK-SGGYLIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQK 302

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +  K     F       +      V D+ +ALYAS ++S+ QGF V+ ++S+ + W+L L
Sbjct: 303 ELRKSAAGHFTCRRTEVVYNKSEMVGDIYSALYASKLVSYAQGFAVLQRASDSFGWNLDL 362

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
           A+IAR+WR GCIIRS  LNDI  +        +LL  P  S ++K+ +   + +V    +
Sbjct: 363 ASIARMWRGGCIIRSIFLNDIAAAFERSEKPQHLLLTPYFSNEMKQLLSGWKHLVAQAMK 422

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
              PVP+ S+AL+YF + +     AN+IQAQRD+FG+H F+R D +
Sbjct: 423 EELPVPAFSSALNYFYSLVSVNLPANMIQAQRDYFGAHTFERVDGL 468


>gi|220912945|ref|YP_002488254.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrobacter
           chlorophenolicus A6]
 gi|219859823|gb|ACL40165.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arthrobacter
           chlorophenolicus A6]
          Length = 478

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 301/471 (63%), Gaps = 2/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG+NL+ N+   GF +A++N+  E TD  ++K  G     I T+ L+++V
Sbjct: 3   AHIGVTGLAVMGANLARNLARNGFTVALHNRSVEKTDTLLEKY-GTEGDFIRTETLQELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ KPR++L+MV  G PVD +I++L+PLL   DI++D GNSH+ DT+ R   L++K ++
Sbjct: 62  DSLEKPRRVLIMVKAGKPVDSVIEQLEPLLEAGDIIIDAGNSHYEDTRRREAALAKKDLH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG +GA +G S+M GG++++Y  +  +L  ISAK    PCCA +G DG+GHFV
Sbjct: 122 FVGVGVSGGEEGALNGPSIMPGGSKESYKALGPLLEKISAKVDGEPCCAWVGTDGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + + +LR      P E S +F++W+ G LSS+LI+I+AE+L   
Sbjct: 182 KMVHNGIEYADMQVIGEAFDLLRSGAGIEPAEQSKIFTEWNKGDLSSFLIEISAEVLGHV 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +DV+ D A QKGTG  ++I   +L S ++    ++FAR LS    + K  Q 
Sbjct: 242 DAKTGKPFVDVVVDAAGQKGTGRWTVISALELGSPVSGIAESVFARALSSQAGQRKLGQE 301

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
                    ++  ++FV+D+  ALYAS ++S+ QG  ++  ++++Y W L L  IA +WR
Sbjct: 302 LLE-GGESAVEIPETFVEDVRQALYASKLVSYAQGLDMLTSAAKEYGWDLKLDEIASLWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIR+++L DI K+   D    NLL  P+ ++ +   +P+ RR+V T  + G PVP  
Sbjct: 361 AGCIIRAELLKDITKAYAADEKPANLLFAPAFTKAIADALPAWRRVVATAVQLGIPVPVF 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S++L+Y+D     R  A LIQ QRD FG+H + R D     H  W +  +E
Sbjct: 421 SSSLAYYDGLRRKRVAAALIQGQRDLFGAHTYGRVDAEGTFHTLWGEDKSE 471


>gi|116872808|ref|YP_849589.1| 6-phosphogluconate dehydrogenase [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|116741686|emb|CAK20810.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           welshimeri serovar 6b str. SLCC5334]
          Length = 472

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 295/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMEE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    +  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLSHDELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  ++E   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKEERVY 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  + PSS+       +FV+ +  ALY S I S+ QGF  +  +SE+Y W L    IA
Sbjct: 299 ASTVLHGPSSYHFDGDKKAFVESVRRALYFSKIASYAQGFAQMRAASEEYDWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNQDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 471


>gi|319792541|ref|YP_004154181.1| 6-phosphogluconate dehydrogenase, decarboxylating [Variovorax
           paradoxus EPS]
 gi|315595004|gb|ADU36070.1| 6-phosphogluconate dehydrogenase, decarboxylating [Variovorax
           paradoxus EPS]
          Length = 473

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 294/469 (62%), Gaps = 14/469 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K++D G+IGL  MG NL LN+  +GF+++VYN+    T+ FI    G  +K++  K LE+
Sbjct: 3   KKSDFGLIGLAVMGQNLVLNVESRGFQVSVYNRTEATTEAFIADNPG--KKLVGAKTLEE 60

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ KPRKI +MV  G PVDQ+I +L PLL  +DI++DGGNS + DT+ R   LS KG
Sbjct: 61  FVQSLAKPRKIQIMVKAGAPVDQVIKQLIPLLEKDDIVIDGGNSLYTDTERRDAYLSSKG 120

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           + FIG GVSGG +GAR G S+M GG    +  ++ I  SI+AK    PC   +GP G+GH
Sbjct: 121 LRFIGAGVSGGEEGARKGPSIMPGGPLSTWEVMKPIFESIAAKVDGEPCVIHIGPGGAGH 180

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEY +MQLI + Y + + +      E++ +F++W+ G+L SYLI+ITA+ L 
Sbjct: 181 YVKMVHNGIEYGDMQLICEAYSLFK-AAGFTTEEMAAIFNEWNDGELQSYLIQITAKALE 239

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD----E 297
             D  TG PI+D+I DKA QKGTG  ++I   + +  ++    A+ AR LS  +      
Sbjct: 240 QKDPETGKPIVDLILDKAGQKGTGQWTLINAAENAVVISTINAAVEARVLSSQKKARVAA 299

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           SK +Q    P     L+   + V  + +ALYAS ++S+TQGF +I    +K  W L L  
Sbjct: 300 SKVLQ---GPKVELSLEK-KALVAKVHDALYASKVISYTQGFDLIKTMGDKKEWKLDLGG 355

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA IWR GCIIR++ LN I  +   DP+  NL+  P   + + +T  + R +V     NG
Sbjct: 356 IASIWRGGCIIRARFLNRITDAFRTDPALANLMLDPFFKDLLNRTQQNWREVVALAVSNG 415

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
            PVP+ SA+L+Y+D++  +R  ANL+QAQRDFFG+H ++R DK   P G
Sbjct: 416 IPVPAFSASLAYYDSYRTERLPANLLQAQRDFFGAHTYERTDK---PEG 461


>gi|134278654|ref|ZP_01765368.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 305]
 gi|134250438|gb|EBA50518.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           pseudomallei 305]
          Length = 485

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/477 (41%), Positives = 294/477 (61%), Gaps = 5/477 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE
Sbjct: 1   MGKQAIGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  AFVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQA 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG
Sbjct: 119 GLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILEQIAAKAPADGEPCVAYMGPDG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYAEWNQGELDSYLIEITAK 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + + 
Sbjct: 239 IFGKKDDETGEHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKAQR 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                  +  S  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W+L L T
Sbjct: 299 VAASEVLSGPSPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGT 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       +LR +V+   + G
Sbjct: 359 IAKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H    +V+ E
Sbjct: 419 VPVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHASCGRVTAE 475


>gi|265763238|ref|ZP_06091806.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_16]
 gi|263255846|gb|EEZ27192.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_16]
          Length = 491

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 302/465 (64%), Gaps = 8/465 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  +G+ ++VYN+     +  V  + I+G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESRGWNVSVYNRTVPGVEEGVVERFINGRAKGKHIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +E  VE++  PRKI+MMV  G PVD+L+++L P LSP DIL+DGGNS++ DT  R ++L+
Sbjct: 66  IEAFVESIALPRKIMMMVRAGSPVDELMEQLFPYLSPGDILIDGGNSNYEDTN-RRVKLA 124

Query: 119 E-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
           E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+A+  + +PCC  +GP
Sbjct: 125 ESKGFLFVGAGVSGGEEGALNGASIMPGGSEKAWEEVKPILQSIAAQAPDGTPCCQWVGP 184

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L+    E++ +F++W+ GKL SYLI+IT
Sbjct: 185 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKELLDMTNEEMASVFTRWNEGKLRSYLIEIT 244

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
             IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 245 GNILRHKDK-TGAYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSARKE 303

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     +       +       K++ +ALYAS ++S+ QGF V+ ++S+ + W+L LA
Sbjct: 304 LREAAARQYQCGHSMAVYNKQDTEKEIFSALYASKLVSYAQGFAVLQRASDTFGWNLDLA 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +   +++V      
Sbjct: 364 SIARMWRGGCIIRSVFLNDIAAAFEAKEKPKHLLLAPYFEEEIKGLLSGWKKLVAQAMRE 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +     ANL+QAQRD+FG+H F+RKD++
Sbjct: 424 ELPVPAFSSALNYFYSLVSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|158335248|ref|YP_001516420.1| 6-phosphogluconate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158305489|gb|ABW27106.1| 6-phosphogluconate dehydrogenase, decarboxylating [Acaryochloris
           marina MBIC11017]
          Length = 476

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/474 (41%), Positives = 297/474 (62%), Gaps = 4/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q   G+IGL  MG NL+LN+   GF +AVYN+    TD F+ +     ++V+     E
Sbjct: 1   MPQQQFGLIGLAVMGENLALNVERNGFPIAVYNRTRAKTDAFMAE-RAQGRQVVAAFTPE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V ++ +PR+IL+MV  G PVD +I +LKP+L P D+L+DGGNS + DT  R+ +L   
Sbjct: 60  ELVASLERPRRILIMVKAGAPVDAVIQQLKPMLEPGDVLIDGGNSLYGDTVRRTEELEAV 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ FIG+GVSGG +GA +G SLM GG E AY  +  IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLRFIGMGVSGGEEGALNGPSLMPGGTEAAYKDLSPILTKIAAQVDDGPCVTYIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L++ L  +  E+  +FS+W+ T +L+S+LI+ITAEI
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNVLGLSHTELHQVFSEWNTTDELNSFLIEITAEI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
            +  D  T  P++++I DKA QKGTG  +++   +L   +     A+ AR  S ++DE  
Sbjct: 240 FTYVDPDTQQPLVELILDKAGQKGTGRWTVMSALELGVPIPTITAAVNARITSSFKDERV 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K  Q    P++ F      +F+  + +ALY S I S+ QG  ++  +S+++ ++L+L+ I
Sbjct: 300 KASQILTGPTATFSGDK-QAFIGKVRDALYCSKICSYAQGMALMSAASQEFKFNLNLSEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           +RIW+ GCIIR+  L+ I  +  +DP+  NLL  P   + +     + R ++ T  + G 
Sbjct: 359 SRIWKGGCIIRAGFLDKIKSAFADDPALANLLLAPEFRQTILDRQDAWREVMATAAQLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           PVP+ SA+L YFD++  DR   NL QAQRDFFG+H + R DK    H  W  ++
Sbjct: 419 PVPAFSASLDYFDSYRRDRLPQNLTQAQRDFFGAHTYQRIDKEGTFHTEWTAIN 472


>gi|323341629|ref|ZP_08081862.1| 6-phosphogluconate dehydrogenase [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464054|gb|EFY09247.1| 6-phosphogluconate dehydrogenase [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 474

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/469 (41%), Positives = 295/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MK+ DIG+IGL  MGSNL+LN+ D G+ +++YN+ + +    I++     + + + ++LE
Sbjct: 1   MKKNDIGVIGLAVMGSNLALNMADHGYNVSIYNRTYAVGQKVIQE--NPHENLSLFESLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++  PRKI++MV  G  VD++I+ L PLL+  DI++DGGNS+F DT  R+ ++   
Sbjct: 59  DFVTSLEAPRKIILMVKAGPAVDKVIENLIPLLNKGDIIMDGGNSNFKDTIRRTQEIEAL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  ++G+G+SGG +GAR G ++M GG++ AY  V NIL  +SAK Q  PCC  +G +G+G
Sbjct: 119 GFRYLGVGISGGEEGARFGPAIMPGGSKDAYKFVSNILEDVSAKAQGEPCCTYIGENGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLIA+ Y IL+     +  E+  +FS W+ G+L S+LI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYADMQLIAESYSILKHVGGFSNEELEQIFSDWNQGELDSFLIEITAQIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG  ++DVI D A+QKGTG  +  E     +  ++  +A+FAR +S  + E  +
Sbjct: 239 GEIDPDTGKHMVDVILDTAAQKGTGKWTAEEALNTGTDASLLASAVFARFISAKKQERVQ 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            Q   N  + H  L   + F++ +  ALYAS I+++ QGF ++  +S +Y W L    IA
Sbjct: 299 AQEILNYEAPHIQLNDREEFIEQVRQALYASKIIAYAQGFDLMKNASIEYGWDLDFGAIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +++R GCIIR++ LN I  + T +P   NL+   S  E +     SLR +     ++G  
Sbjct: 359 KVFREGCIIRAKFLNRITDAYTLNPELQNLMLDASFKESLLDYQGSLRDVCGLAIQSGIS 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ + A+SYFD + + R  ANLIQAQRD FG+H F+R DK    H  W
Sbjct: 419 VPAFTNAISYFDAYRNGRSNANLIQAQRDLFGAHTFERVDKQGSFHHEW 467


>gi|16803416|ref|NP_464901.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes EGD-e]
 gi|47095960|ref|ZP_00233563.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes str. 1/2a F6854]
 gi|224499952|ref|ZP_03668301.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes Finland
           1988]
 gi|224501680|ref|ZP_03669987.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           R2-561]
 gi|254827637|ref|ZP_05232324.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           N3-165]
 gi|254829866|ref|ZP_05234521.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 10403S]
 gi|254898458|ref|ZP_05258382.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes J0161]
 gi|254912051|ref|ZP_05262063.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes J2818]
 gi|254936378|ref|ZP_05268075.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes F6900]
 gi|284801762|ref|YP_003413627.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 08-5578]
 gi|284994904|ref|YP_003416672.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 08-5923]
 gi|16410792|emb|CAC99454.1| lmo1376 [Listeria monocytogenes EGD-e]
 gi|47015706|gb|EAL06636.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258600016|gb|EEW13341.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           N3-165]
 gi|258608969|gb|EEW21577.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes F6900]
 gi|284057324|gb|ADB68265.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 08-5578]
 gi|284060371|gb|ADB71310.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 08-5923]
 gi|293590018|gb|EFF98352.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes J2818]
          Length = 472

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/473 (41%), Positives = 295/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMEE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    +  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLSHDELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  ++E   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKEERVY 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +     S++  +    +FV+ +  ALY S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASTVLTGPSNYRFEGDKKAFVESVRRALYFSKIASYAQGFAQMRAASEEYNWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNQDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 471


>gi|326383863|ref|ZP_08205547.1| 6-phosphogluconate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197322|gb|EGD54512.1| 6-phosphogluconate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 481

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/474 (40%), Positives = 288/474 (60%), Gaps = 2/474 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + A IG+ GL  MGSN++ N    G  +A++N+    TD  I+   G     I T+ +E+
Sbjct: 6   RLAQIGVTGLAVMGSNIARNFARHGHTVALHNRSIAKTDALIEAHGG-DGDFIRTETMEE 64

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V A+ +PR++L+MV  GDP D +I++L  L+ P DI++DGGNS + DT  R   ++ + 
Sbjct: 65  FVGALERPRRVLIMVKAGDPTDAVIEELANLMEPGDIIIDGGNSLYTDTIRREAAMAARN 124

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           + F+G G+SGG +GA +G S+M GG  ++Y  +  +L SISA+   +PCC  +GPDGSGH
Sbjct: 125 LNFVGAGISGGEEGALNGPSIMPGGPAESYESLGPLLESISAQVDGTPCCTHIGPDGSGH 184

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQLI + Y ++R  L     EI+ +F +W+TG L SYLI+ITAE+LS
Sbjct: 185 FVKMVHNGIEYADMQLIGEAYHLMRGVLGMEVAEIADVFREWNTGVLDSYLIEITAEVLS 244

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++DVI D A QKGTG  ++     L    T    A+FAR LS   D+ K  
Sbjct: 245 QVDAETGKPLVDVIVDAAGQKGTGRWTVKSALDLGIPTTGIAEAVFARALSSATDQRKSA 304

Query: 302 QSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           Q     ++         +FV+D+  ALYAS +++++QGF  I   S +Y W++    +A 
Sbjct: 305 QGLAAGTTGAQAPADKAAFVEDIRKALYASKVVAYSQGFDQIAAGSAEYGWNVDPGKLAT 364

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ L+ I ++  E+P    LL  P   + V+ ++ S RR+++T T  G PV
Sbjct: 365 IWRGGCIIRAKFLDRIREAYAENPDLPALLLAPYFRDAVEDSVESWRRVIITATGMGVPV 424

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P+ +++LSY+D    +R  A L Q  RD+FG+H + R DK    H  W    +E
Sbjct: 425 PAFASSLSYYDALRAERLPAALTQGLRDYFGAHTYLRVDKPGSFHTLWSDDRSE 478


>gi|15643204|ref|NP_228248.1| 6-phosphogluconate dehydrogenase [Thermotoga maritima MSB8]
 gi|4980945|gb|AAD35523.1|AE001722_7 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga
           maritima MSB8]
          Length = 469

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/468 (41%), Positives = 306/468 (65%), Gaps = 4/468 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           ++ IG+IGL  MG NL+LNI  KG++++VYN+  + T+ F+K     ++++    ++E  
Sbjct: 2   KSHIGLIGLAVMGQNLALNIARKGYKVSVYNRTAQRTEEFVKN-RVTNEEIEPHYDIESF 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PRKI++MV  G PVD  I +L P L P D+++DGGNSH+ DT+ R  +LSEKGI
Sbjct: 61  VKSLERPRKIILMVKAGKPVDDTISQLLPHLEPGDLIIDGGNSHYMDTERRFKELSEKGI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G+GVSGG  GA  G SLM GG+ +AYN VE ILL I+AK ++ PCC  +G   +GHF
Sbjct: 121 LFLGMGVSGGEYGALHGPSLMPGGSREAYNLVEEILLEIAAKTEDGPCCTYVGERSAGHF 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA MQ IA++Y I+RD L+ +  E+S +F +W+ G+LSS+L++IT +IL  
Sbjct: 181 VKMVHNGIEYAIMQAIAEVYHIMRDVLSLSSEEMSSIFEEWNRGELSSFLVEITYKILRK 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI DKA QKGTG  +      L         A+  R +S ++D   ++ 
Sbjct: 241 KDEETGKPMVDVILDKAEQKGTGKWTSQAALDLGIPTPSINLAVVERVISHFKDIRTRLS 300

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             +N       +  + F++DL N+L+ +  ++F+QG W+I ++S+++ + +SL+ + RIW
Sbjct: 301 KLYNKRRS-ATQGSEEFLRDLRNSLFFAMFMAFSQGMWLIAEASKEFGYGVSLSEVLRIW 359

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           + GCIIR+++++ + + ++ +  +  LL    +   +K  I SL+ I+    EN  PVP 
Sbjct: 360 KGGCIIRAKLIDTLRRYISNE--NAYLLENEEVMNLLKGKIDSLKNILKASIENEIPVPV 417

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           LS++ +YF +   +R  ANLIQAQRDFFG+H F+R D+    H  W++
Sbjct: 418 LSSSYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDREGVFHINWEE 465


>gi|239978121|ref|ZP_04700645.1| 6-phosphogluconate dehydrogenase [Streptomyces albus J1074]
 gi|291450017|ref|ZP_06589407.1| 6-phosphogluconate dehydrogenase [Streptomyces albus J1074]
 gi|291352966|gb|EFE79868.1| 6-phosphogluconate dehydrogenase [Streptomyces albus J1074]
          Length = 485

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 282/474 (59%), Gaps = 3/474 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +AV+N+    T+  +    G     +     E++V
Sbjct: 11  AQIGVTGLAVMGRNLARNFARNGYTVAVHNRTAAKTEELVSGF-GDEGTFLPASTPEELV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           E++ +PR++L+MV  G P D +I++  PLL   D+++DGGN+HF DT+ R   L E+GI+
Sbjct: 70  ESLERPRRVLVMVKAGAPTDAVIEEFAPLLEEGDMIIDGGNAHFEDTRRREKALRERGIH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G GVSGG +GA  G S+M GG+  +Y+ +  +L  ISAK  + +PC   +GPDG+GHF
Sbjct: 130 FVGTGVSGGEEGALHGPSIMPGGSAASYDALGPMLEKISAKADDGTPCVTHVGPDGAGHF 189

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LR+    +P EI+ +F  W+TG+L SYLI+ITAE+L+ 
Sbjct: 190 VKMVHNGIEYADMQLIGEAYQLLREVGGYSPAEIAEIFRTWNTGRLDSYLIEITAEVLAH 249

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR +S + D  K  +
Sbjct: 250 TDAATGEPFVDVVLDQAEQKGTGRWTVQSALDLGVPVSGIAEAVFARAVSGHADLRKASR 309

Query: 303 SFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               P+    P     +F   +E ALYAS I+++TQGF  I   SE+Y W + L  IA I
Sbjct: 310 HLAGPTPRKLPEDDAATFADQVEQALYASKIVAYTQGFHQIAVGSEQYGWDIDLGRIAAI 369

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WRAGCIIR+  L+ + ++    P   +LL     +++        R +V T   NG P P
Sbjct: 370 WRAGCIIRAAFLDRVTQAYDAQPGMVSLLADQGFADETAAAQDDWRTVVATAVTNGVPTP 429

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
             +A L+Y+D+    R  A L Q QRD+FG+H + R D+    H  W    +E+
Sbjct: 430 GFAATLAYYDSLRAPRLPAALTQGQRDYFGAHTYHRTDRPGTFHTLWGGDRSET 483


>gi|172040745|ref|YP_001800459.1| 6-phosphogluconate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
 gi|171852049|emb|CAQ05025.1| unnamed protein product [Corynebacterium urealyticum DSM 7109]
          Length = 499

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 291/475 (61%), Gaps = 6/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+IGL  MGSN++ N  + G  +AV+N+ F  T+ F++   G     I  + LE  V
Sbjct: 24  AQIGVIGLAVMGSNIARNFANHGHTVAVFNRTFARTEGFMENF-GEQGSFIPAETLEAFV 82

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ L+MV  G   D +I++L  L+ P DI++DGGN+ + DT  R  ++S +G++
Sbjct: 83  ASLEKPRRALIMVQAGPATDAMIEQLADLMDPGDIIIDGGNALYTDTIRREKEISARGLH 142

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G ++M GG  +AY  +  +L SISAK    PCCA +GPDG+GHFV
Sbjct: 143 FVGTGISGGEEGALNGPAIMPGGTAEAYESLGPLLESISAKVDGEPCCAHIGPDGAGHFV 202

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR     +P EIS +F +W+TG+L SYL++ITAE+L+  
Sbjct: 203 KMVHNGIEYADMQVIGEAYHLLRYGAGLSPKEISEVFREWNTGELESYLVEITAEVLAQV 262

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS----LYRDESK 299
           D  TG P++D+I D A QKGTG  ++     L   +T    A+FAR LS      +    
Sbjct: 263 DAETGKPLVDIIVDAAGQKGTGRWTVKSACDLGIPVTGIGEAVFARALSSDGPARQAAQG 322

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           K+ S    +   P +  D F++D+  ALYAS ++++ QGF  I   SE+Y W +    +A
Sbjct: 323 KLASGELATPVDPAQRAD-FIEDVRRALYASKMVAYAQGFDQILAGSEEYGWDVDPRDLA 381

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWR GCIIR++ LN IV +   D    +LL      E++   + S RR+V T T  G+P
Sbjct: 382 RIWRGGCIIRARFLNRIVDAYEADRQLPSLLLDEYFLEQMSGLVDSWRRVVGTATAQGHP 441

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP  +++LSY+D+    R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 442 VPVFASSLSYYDSLRAQRLPAALIQGQRDFFGAHTYGRVDKPGAFHTLWSGDRSE 496


>gi|23097640|ref|NP_691106.1| 6-phosphogluconate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22775863|dbj|BAC12141.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Oceanobacillus
           iheyensis HTE831]
          Length = 468

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 297/470 (63%), Gaps = 5/470 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-KKISGLSQKVIVTKNL 59
           MKQ  IG+IGL  MG N++LN+  KGF +AV+N+ +E T+ F+  + SG  +K I  K +
Sbjct: 1   MKQ-QIGVIGLAVMGKNIALNMESKGFSVAVFNRSYEKTENFLANEASG--KKFIGAKTI 57

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E+ V+++ KPRKI++MV  G   D  I+ LKP L   DIL+DGGN+ + DT  R+ +L E
Sbjct: 58  EEFVDSLEKPRKIMLMVKAGPATDATIESLKPHLDKGDILIDGGNTLYEDTIRRNKELDE 117

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGS 179
            GI+FIG GVSGG +GA +G S+M GG  +AY  V  I  +ISAK    PC   +GP+G+
Sbjct: 118 SGIHFIGTGVSGGEEGALNGPSIMPGGQAEAYKLVAPIFEAISAKVDKDPCVTYIGPNGA 177

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y ++++ L  +  E+ ++F +W+ G+L SYLI+ITA+I
Sbjct: 178 GHFVKMVHNGIEYGDMQLIAEAYDLMKNVLGLDAKELHNVFKEWNDGELDSYLIEITADI 237

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
            +  D  TG P+++VI DKA QKGTG  +      L   + +   ++FAR +S  +DE  
Sbjct: 238 FTKVDEETGKPLVEVILDKAGQKGTGKWTSKNALDLGVPLPLITESVFARFISSLKDERV 297

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           +  +    P++    +  +  ++ +  ALY S I+S+ QGF  +  +S++Y W+LS   I
Sbjct: 298 RASKELSGPTNAMLGESKEELIEAIRQALYMSKIVSYAQGFAQMRAASDEYDWNLSYGDI 357

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A IWR GCIIR++ L  I  +   D    NL+  P   E V+    SLR++V     +G 
Sbjct: 358 AMIWRGGCIIRAKFLQKIKDAYDRDSQLPNLMLDPYFKEIVEGYQSSLRKVVSLAVAHGI 417

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            VP+ S+A++Y+D++  +   ANLIQAQRD+FG+H ++RKDK    H  W
Sbjct: 418 AVPTFSSAIAYYDSYRSEDLPANLIQAQRDYFGAHTYERKDKDGIFHSQW 467


>gi|302340071|ref|YP_003805277.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta
           smaragdinae DSM 11293]
 gi|301637256|gb|ADK82683.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta
           smaragdinae DSM 11293]
          Length = 487

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/470 (41%), Positives = 298/470 (63%), Gaps = 7/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++ADIG+IGL  MG NL LN+ D G+ +AVYN+     D F+   +     +I  ++L +
Sbjct: 3   RRADIGLIGLAVMGQNLVLNMNDHGYSVAVYNRTTSKVDEFLGDAAAGRDTIIGARSLRE 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V ++  PRK+++MV  G+ VD  I+KL PLLSP D+++DGGNSH+ DT  RS +L+ KG
Sbjct: 63  LVSSLSSPRKVMLMVKAGEVVDIFIEKLLPLLSPGDLIIDGGNSHYPDTSRRSRELAAKG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           I FIG G+SGG +GAR G S+M GGN KA+  V+ +  +I+AK ++ +PCC  +G +GSG
Sbjct: 123 ILFIGTGISGGEEGARRGPSIMPGGNPKAWPLVKQLFQAIAAKSEDGAPCCEWVGEEGSG 182

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQ+I + Y +L   L  +  E+  +F++W+ G+L SYLI+IT +I+
Sbjct: 183 HYVKMVHNGIEYGDMQMICEAYDLLYRGLGLSHEEMYEVFTEWNKGELESYLIEITRDIM 242

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              DT  G P++  I DKA QKGTG  + I+   L+  +T+   A++AR LS  ++E K+
Sbjct: 243 KVKDT-DGSPLVTKIADKAGQKGTGKWTGIDSLNLAVPVTVIAEAVYARCLSARKEERKE 301

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              F   + H  L   +    ++D+  AL+AS I+S+TQGF ++ ++++ + W L+   I
Sbjct: 302 AAGFIGEAPHGRLSGDERKGVIEDIRKALFASKIISYTQGFMLLREAADSFGWKLNYGEI 361

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCIIRS  L  I ++   + S  +LL  P   E V       RR V      G 
Sbjct: 362 ALMWRGGCIIRSSFLGKIKEAFDGNRSLKSLLLDPYFKEIVSGCQDGWRRTVSRAALAGI 421

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P P++S+ALS+FD +   +  ANL+QAQRD+FG+H ++R D+   P G +
Sbjct: 422 PTPAMSSALSFFDGYRSGQLPANLLQAQRDYFGAHTYERTDR---PEGEY 468


>gi|53713143|ref|YP_099135.1| 6-phosphogluconate dehydrogenase [Bacteroides fragilis YCH46]
 gi|253566810|ref|ZP_04844262.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 3_2_5]
 gi|52216008|dbj|BAD48601.1| 6-phosphogluconate dehydrogenase [Bacteroides fragilis YCH46]
 gi|251944373|gb|EES84862.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 3_2_5]
          Length = 491

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 301/465 (64%), Gaps = 8/465 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  +G+ ++VYN+     +  V  + I+G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESRGWNVSVYNRTVPGVEEGVVERFINGRAKGKHIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +E  VE++  PRKI+MMV  G PVD+L+++L P LSP DIL+DGGNS++ DT  R ++L+
Sbjct: 66  IEAFVESIALPRKIMMMVRAGSPVDELMEQLFPYLSPGDILIDGGNSNYEDTN-RRVKLA 124

Query: 119 E-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
           E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+A+  + +PCC  +GP
Sbjct: 125 ESKGFLFVGAGVSGGEEGALNGASIMPGGSEKAWEEVKPILQSIAAQAPDGTPCCQWVGP 184

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L+    E++ +F++W+ GKL SYLI+IT
Sbjct: 185 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKELLDMTNEEMASVFTRWNEGKLRSYLIEIT 244

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
             IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 245 GNILRHKDK-TGAYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSARKE 303

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     +       +       K++ +ALYAS ++S+ QGF V+ ++S+ + W+L LA
Sbjct: 304 LREAAARQYQCRHSMAVYNKQDTEKEIFSALYASKLVSYAQGFAVLQRASDTFGWNLDLA 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +   + +V      
Sbjct: 364 SIARMWRGGCIIRSVFLNDIAAAFEAKEKPKHLLLAPYFEEEIKGLLSGWKNLVAQAMRE 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +     ANL+QAQRD+FG+H F+RKD++
Sbjct: 424 ELPVPAFSSALNYFYSLVSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|319949028|ref|ZP_08023125.1| 6-phosphogluconate dehydrogenase [Dietzia cinnamea P4]
 gi|319437316|gb|EFV92339.1| 6-phosphogluconate dehydrogenase [Dietzia cinnamea P4]
          Length = 490

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/471 (41%), Positives = 277/471 (58%), Gaps = 1/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GL  MGSN++ N    G+ +AV+N+    TD  + +  G     I T+ + +  
Sbjct: 18  ADIGVTGLAVMGSNIARNFARHGYTVAVHNRSAGKTDALLSE-HGADGDFIRTETIAEFA 76

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR+ L+MV  G P D +ID L       DI++DGGNS + DT  R   ++E+GI 
Sbjct: 77  AALRSPRRALVMVQAGAPTDAVIDALADAFDEGDIIIDGGNSLYTDTIRREKAMAERGIR 136

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           FIG G+SGG +GA  G S+M GG   +Y  V  +L  ISAK   +PCC  +G DGSGHFV
Sbjct: 137 FIGAGISGGEEGALEGPSIMPGGPASSYEVVGPMLEDISAKVDGTPCCTHVGEDGSGHFV 196

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LR      P  ++ +F +W+TG+L SYLI+ITAE+L+  
Sbjct: 197 KMVHNGIEYSDMQLIGEAYHLLRGVAGIEPAAMADVFREWNTGELDSYLIEITAEVLAQV 256

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    + +  ++
Sbjct: 257 DAETGGPLVDVIVDRAGQKGTGRWTVKSALDLGVPVTGIAEAVFARALSSSVPQREAGRA 316

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
               S   P +    FV+D+  ALYAS ++++ QGF  I  +S +Y W ++   +A IWR
Sbjct: 317 LPAGSVSTPTQTGPEFVEDVRRALYASKVIAYAQGFDQITAASAEYGWDVARGDLATIWR 376

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+  L+ I ++   DPS  +LL  P  +E +   + S RR+V T    G P P  
Sbjct: 377 GGCIIRATFLDRIREAYAADPSLPSLLAAPYFAEALADCVDSWRRVVATAVTAGIPAPGF 436

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           SAAL+Y+D    +R  A LIQ QRDFFG+H + R D+    H  W    +E
Sbjct: 437 SAALAYYDGLRTERLPAALIQGQRDFFGAHTYQRTDREGSFHTLWSGDRSE 487


>gi|60681408|ref|YP_211552.1| 6-phosphogluconate dehydrogenase [Bacteroides fragilis NCTC 9343]
 gi|60492842|emb|CAH07617.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           fragilis NCTC 9343]
 gi|301162865|emb|CBW22412.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           fragilis 638R]
          Length = 491

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 301/465 (64%), Gaps = 8/465 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  +G+ ++VYN+     +  V  + I+G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESRGWSVSVYNRTVPGVEEGVVERFINGRAKGKHIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +E  VE++  PRKI+MMV  G PVD+L+++L P LSP DIL+DGGNS++ DT  R ++L+
Sbjct: 66  IEAFVESIALPRKIMMMVRAGSPVDELMEQLFPYLSPGDILIDGGNSNYEDTN-RRVKLA 124

Query: 119 E-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
           E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+A+  + +PCC  +GP
Sbjct: 125 ESKGFLFVGAGVSGGEEGALNGASIMPGGSEKAWEEVKPILQSIAAQAPDGTPCCQWVGP 184

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L+    E++ +F++W+ GKL SYLI+IT
Sbjct: 185 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKELLDMTNEEMASVFTRWNEGKLRSYLIEIT 244

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
             IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 245 GNILRHKDK-TGAYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSARKE 303

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     +       +       K++ +ALYAS ++S+ QGF V+ ++S+ + W+L LA
Sbjct: 304 LREAAARQYQCRHSMAVYNKQDTEKEIFSALYASKLVSYAQGFAVLQRASDTFGWNLDLA 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +   + +V      
Sbjct: 364 SIARMWRGGCIIRSVFLNDIAAAFEAKEKPKHLLLAPYFEEEIKGLLSGWKNLVAQAMRE 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +     ANL+QAQRD+FG+H F+RKD++
Sbjct: 424 ELPVPAFSSALNYFYSLVSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|311745418|ref|ZP_07719203.1| 6-phosphogluconate dehydrogenase, decarboxylating [Algoriphagus sp.
           PR1]
 gi|311302381|gb|EAZ82187.2| 6-phosphogluconate dehydrogenase, decarboxylating [Algoriphagus sp.
           PR1]
          Length = 470

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/466 (41%), Positives = 290/466 (62%), Gaps = 2/466 (0%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE 64
           D G++GLG MG N  LN+ D  F+   Y+ D E  +  +K+  G   +V  + +++  V+
Sbjct: 7   DFGLVGLGVMGRNFILNVADNNFKAFGYDLDAEKVEA-LKQEGGNLDRVNASTDIKTFVD 65

Query: 65  AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF 124
           ++  PRK++++V  G  VDQ I+ L P L  +DI++DGGNS F DT  R   L EKG++F
Sbjct: 66  SLTLPRKVMLLVPAGKIVDQAIESLLPYLDKDDIIIDGGNSFFTDTDRRETYLKEKGVHF 125

Query: 125 IGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVK 184
            G GVSGG +GAR G S+M GG++ AY  V+ I  ++SAKY+  PC A LGP  +G++VK
Sbjct: 126 FGSGVSGGAEGARKGPSIMPGGDKAAYQHVKPIFEAVSAKYKGEPCVAYLGPKSAGNYVK 185

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEYA MQL ++IY +L+ S + +  E+  ++SKW+ G+L S+L++ITAEI +  D
Sbjct: 186 MVHNGIEYAMMQLTSEIYDLLKKSCDLSNEELHQVYSKWNDGRLQSFLVEITAEIFTQKD 245

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
            +T   ++D+I DKA QKGTG  +      L   +   + A+  R +S  +DE  +    
Sbjct: 246 DLTSADLVDMILDKAKQKGTGKWTSQNAMDLGIPVPTIDMAVSMREISALKDERVQADIL 305

Query: 305 FNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           ++       K  +  ++  E ALY S I+++ QG   +  +S+ Y + L ++TIA+IWRA
Sbjct: 306 YS-RPEVEDKPKEELIEQAEQALYFSFIIAYAQGLHQLMYASKDYGYDLDMSTIAKIWRA 364

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+ +L DI ++ T D S  NLL  PS   KV+ T+P++R +V    +NG PVP LS
Sbjct: 365 GCIIRAGLLADIAEAYTADNSIPNLLLSPSFVPKVQGTLPAVREVVAFAAKNGIPVPGLS 424

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           +ALSYFD +   +   NLIQAQRD FGSH ++R D+    H  W K
Sbjct: 425 SALSYFDAYTSTKLPLNLIQAQRDHFGSHTYERTDREGIFHTEWGK 470


>gi|237727166|ref|ZP_04557647.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           D4]
 gi|265750447|ref|ZP_06086510.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides sp.
           3_1_33FAA]
 gi|229434022|gb|EEO44099.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides dorei
           5_1_36/D4]
 gi|263237343|gb|EEZ22793.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides sp.
           3_1_33FAA]
          Length = 478

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 298/465 (64%), Gaps = 8/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYN-----KDFELTDVFIKKISGLSQKVIV 55
           M++ADIG+IGLG MG NL+LN+ DKG+++ V+N     K+  + D FI       + +I 
Sbjct: 1   MEKADIGLIGLGVMGQNLALNLADKGWKVVVWNRTVPGKEENVVDNFIAN-RAKGKGIIG 59

Query: 56  TKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL 115
           +  L   VEA+  PR IL+MV  G  VD+L+ KL PLL   DIL+DGGNS++ DT+ R  
Sbjct: 60  SNELTDFVEALKAPRVILLMVQAGPAVDELMGKLLPLLDKGDILIDGGNSYYEDTERRVK 119

Query: 116 QLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALL 174
           +L +KG+YF+G G+SGG +GA  GAS+M GG ++A+  ++ +L SI+AK ++ +PCC  +
Sbjct: 120 ELYDKGMYFVGCGISGGEEGALHGASIMPGGAQEAWPVIQPMLKSIAAKAEDGTPCCEWV 179

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           GP G+GH+VKM+HNGIEY +MQLIA+ Y  ++  L     +++ +F +W+ G+L SYLI+
Sbjct: 180 GPGGAGHYVKMVHNGIEYGDMQLIAETYFAMKHLLALKNEQMADIFEQWNKGRLHSYLIE 239

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           IT+ IL   +   G  ++D I D A QKGTG  S+I   +L++ + +   A+FARNLS  
Sbjct: 240 ITSAILRHKEQGGGY-LLDNILDAAGQKGTGRWSVINSLQLNTPLDVIAEAVFARNLSAE 298

Query: 295 RDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           ++    M   +    + P+  +   V  LE+ LYA+ ++ + QGF ++  +SE+Y W L 
Sbjct: 299 KNLRVLMSQHYMHVENHPVYNYQDTVAGLESTLYAARLIGYAQGFALMRTASEQYGWKLD 358

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L+TIA +WRAGCIIRS  LNDI ++    P  ++LL       +V + +P+ ++ +    
Sbjct: 359 LSTIALLWRAGCIIRSAFLNDIAEAYRRAPGLSHLLLDEHFGREVTEALPAWKKYIGVML 418

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           + G PVP LSAAL+YF     +   AN+IQA RD+FG+H F+R D
Sbjct: 419 KEGLPVPVLSAALNYFLGLTTNHSPANMIQAMRDYFGAHTFERVD 463


>gi|78063028|ref|YP_372936.1| 6-phosphogluconate dehydrogenase [Burkholderia sp. 383]
 gi|77970913|gb|ABB12292.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           sp. 383]
          Length = 470

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/473 (43%), Positives = 297/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYL++IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTEWNQGELDSYLMEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDEETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +  +  P   FD    +FV+ +  ALY S ++S+ QGF  +  +SE+Y W+L L
Sbjct: 300 AASKVLSGPAAAP---FDGDRAAFVEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       SLR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDIAANYQASLRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|17232767|ref|NP_489315.1| 6-phosphogluconate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17134414|dbj|BAB76974.1| 6-phosphogluconate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 476

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 292/474 (61%), Gaps = 4/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+ + +G  + V     LE
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMAQRAG-GRNVKAAFTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DTQ R+ +L   
Sbjct: 60  EFVAALERPRKILVMVQAGKPVDAVIQQLKPLLDEGDIIIDGGNSWFEDTQRRTQELEPA 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG + +Y  +  I   I+A+  + PC   +GP GSG
Sbjct: 120 GLRFLGMGVSGGEEGALNGPSLMPGGTQSSYEYLSPIFNKIAAQVDDGPCVTYVGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L+++   N  ++  +F++W+ T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNAGGLNAKQLHEVFTEWNTTDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  T +P++D+I D A QKGTG  ++    +L  S+     A+ AR +S  RDE  
Sbjct: 240 FPYIDPETKLPLVDLIVDAAGQKGTGRWTVQTALELGVSIPTITAAVNARIISSIRDERI 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              +    PS  +       F+  + +ALY S I S+ QG  ++  +S  ++W+L+L+ +
Sbjct: 300 AASKQLTGPSGKYDGDT-KEFINKVRDALYCSKICSYAQGMALLSTASATFNWNLNLSEM 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  LN I K+  E+P+  NLL  P   + +     + R +++T  + G 
Sbjct: 359 ARIWKGGCIIRAGFLNKIKKAFNENPALPNLLLAPEFKQTILDRQAAWREVIITAAKLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           PVP+ SA+L YFD++  DR   NL QAQRD+FG+H + R DK    H  W  ++
Sbjct: 419 PVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYLRTDKAGAFHTEWVPIA 472


>gi|239624760|ref|ZP_04667791.1| 6-phosphogluconate dehydrogenase [Clostridiales bacterium
           1_7_47_FAA]
 gi|239521146|gb|EEQ61012.1| 6-phosphogluconate dehydrogenase [Clostridiales bacterium
           1_7_47FAA]
          Length = 476

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/474 (41%), Positives = 295/474 (62%), Gaps = 6/474 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + DIGI+GL  MG +L+LN+ D GF++  YN+   +TD  +K+     Q +I   +L 
Sbjct: 1   MTKLDIGIVGLSVMGRSLALNMADHGFKVGGYNRSASVTDQVMKEHP--HQNLIPFHDLG 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           Q++ ++ +PRK+++M+  G PVD +I++L PLL   DI+LDGGNS + DT+ R+  L E+
Sbjct: 59  QLIASLSRPRKVMLMIQAGKPVDAVIEQLIPLLGQGDIILDGGNSFYEDTRRRAKMLEEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+++G+G+SGG +GAR G S+M GGN  AY  V  IL +I+AK  + PCC  +GP+G+G
Sbjct: 119 GIHYLGVGISGGEEGARFGPSIMPGGNRDAYESVRPILKAIAAKAMDEPCCTYIGPEGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLIA+ Y +L+     +  E++ +F  W+ G+L SYLI ITA+I 
Sbjct: 179 HYVKMVHNGIEYADMQLIAESYLLLKYVGGFSNRELADIFHSWNQGELHSYLIGITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
             +D +T   +ID I D A QKGTG  + IE  K    +++  +A  AR +S + +  KK
Sbjct: 239 READDLTDGELIDYILDSAKQKGTGRWASIEALKQGVDISMITSACSARIMSNHLEARKK 298

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                N  +  P+   + F   +  ALY   I+++ QGF ++  +SE+Y W+L L  IA 
Sbjct: 299 ASGLVNAPAFNPVTDKEQFASMVREALYTGKIIAYAQGFSLMQDASEQYGWNLDLGRIAS 358

Query: 361 IWRAGCIIRSQILNDIVKSLT----EDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           I+RAGCII++  LNDI K+      +D    NL+       ++ +   SLR+ V T   N
Sbjct: 359 IFRAGCIIQAVFLNDITKAFESGSGDDGKPENLIFDRFFLSRINEHQDSLRKAVSTGVMN 418

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           G P+P+L  A+SY D F      ANLIQAQRD FG+H ++R D+    H  W+K
Sbjct: 419 GLPIPALCNAISYLDEFRGKAVGANLIQAQRDCFGAHTYERTDREGTFHHEWRK 472


>gi|134293079|ref|YP_001116815.1| 6-phosphogluconate dehydrogenase [Burkholderia vietnamiensis G4]
 gi|134136236|gb|ABO57350.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           vietnamiensis G4]
          Length = 470

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 297/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDDETGKQLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +  +  P   FD    +FV+ +  ALY S ++S+ QGF  +  +SE+Y W+L L
Sbjct: 300 AASKILSGPAAAP---FDGDRAAFVEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       +LR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDIAANYQTALRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R D+    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDRPGSFHANW 469


>gi|320104729|ref|YP_004180320.1| 6-phosphogluconate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319752011|gb|ADV63771.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Isosphaera
           pallida ATCC 43644]
          Length = 487

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/459 (42%), Positives = 291/459 (63%), Gaps = 3/459 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN+   G+ +AVYN+     D FI    G  +K++      ++V
Sbjct: 6   ADIGLIGLAVMGENLVLNMESHGYTVAVYNRTTSKVDEFING-RGRGKKLVGCHTPAELV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PRKI++MV  G  VD +ID+L PLL P D+L+DGGN+H+ DT  R   L  K + 
Sbjct: 65  AALKRPRKIMIMVKAGAAVDAVIDELVPLLEPGDLLIDGGNTHYPDTTRRERALRAKNLL 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           FIG GVSGG +GA  G S+M GGN + +  ++ I  SI+AK ++ SPCC  +GP+G+GH+
Sbjct: 125 FIGTGVSGGEEGALKGPSIMPGGNVEGWPLIKPIFQSIAAKVEDGSPCCDWVGPEGAGHY 184

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + + ++   L  +  +   +F +W+ G+L+SYLI+ITA+IL  
Sbjct: 185 VKMVHNGIEYGDMQLICEAHHLMSAVLGYDASKQHEIFKRWNQGRLNSYLIEITADILGY 244

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++D+I D A QKGTG  ++     L + +T+   A++AR LS  ++E    +
Sbjct: 245 IDPETGKPLVDLILDAAGQKGTGKWTVNSSTDLGTPLTLIAEAVYARCLSALKEERVAAE 304

Query: 303 SFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                 +  P     D+FV DLE ALYAS ++S++QG+ ++ + +++  W+ +   IA +
Sbjct: 305 PLLKGPNPPPFDGDPDAFVNDLEQALYASKLISYSQGYVLMREMAKESGWNFNYGGIALM 364

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIRS  L  I ++   +P  +NLL  P   +++ +   S RR+V T    G P+P
Sbjct: 365 WRGGCIIRSVFLGKIKEAFDANPHLSNLLVDPYFRDQIAQAQDSWRRVVATAALRGVPIP 424

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           ++++ALSYFD +   R  ANL+QAQRD+FG+H ++R DK
Sbjct: 425 AMASALSYFDGYRSGRLPANLLQAQRDYFGAHTYERVDK 463


>gi|54023142|ref|YP_117384.1| 6-phosphogluconate dehydrogenase [Nocardia farcinica IFM 10152]
 gi|54014650|dbj|BAD56020.1| putative 6-phosphogluconate dehydrogenase [Nocardia farcinica IFM
           10152]
          Length = 480

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 288/472 (61%), Gaps = 1/472 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G     + T+ +E+ 
Sbjct: 7   RAHIGVTGLAVMGSNIARNFARHGYTVALHNRSVAKTDALLAEHGG-DGDFVRTETIEEF 65

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PR++L+MV  G+  D +I++L   + P DI++DGGN+ + DT  R   L E+G+
Sbjct: 66  VAALERPRRVLIMVKAGEATDAVIEELAAAMEPGDIIIDGGNALYTDTIRREAALRERGL 125

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G G+SGG +GA +G ++M GG  ++Y  +  +L SI+AK   +PCC  +GPDGSGHF
Sbjct: 126 NFVGAGISGGEEGALNGPAIMPGGPAESYESLGPLLESIAAKVDGTPCCTHIGPDGSGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y + RD+L  +  +I+ +F++W++G L SYL++ITAE+L+ 
Sbjct: 186 VKMVHNGIEYADMQLIGEAYHLFRDALGFDAGQIAAVFTQWNSGDLESYLVEITAEVLNQ 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS  R + K   
Sbjct: 246 VDAKTGRPLVDVIVDAAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSRAQRKAAT 305

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
                +        + F +D+  ALYAS ++++ QGF  I   S +Y W+L    +A IW
Sbjct: 306 GLAAGTLADRPTDVEQFTEDIRRALYASKVVAYAQGFDQIAAGSAEYGWNLRPGDLATIW 365

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ LN I ++  +DP   +L+  P   E ++  I S RR+V T T  G PVP+
Sbjct: 366 RGGCIIRARFLNRIKEAYDKDPQLPSLILDPYFREAIEAGIDSWRRVVSTATLLGIPVPA 425

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             ++LSY+D     R  A L QAQRD+FG+H ++R D   + H  W    +E
Sbjct: 426 FGSSLSYYDALRSPRLPAALTQAQRDYFGAHTYERIDADGKYHTLWSGDRSE 477


>gi|228475860|ref|ZP_04060572.1| 6-phosphogluconate dehydrogenase, decarboxylating [Staphylococcus
           hominis SK119]
 gi|228270092|gb|EEK11557.1| 6-phosphogluconate dehydrogenase, decarboxylating [Staphylococcus
           hominis SK119]
          Length = 468

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/472 (43%), Positives = 296/472 (62%), Gaps = 12/472 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ++IGI+GLG MG NL+ NI DK + ++++++D    +  I+K     QK+    NL++ V
Sbjct: 3   SNIGILGLGVMGKNLAWNIEDKKYSVSIHSRDNNEINDTIQK--SHYQKIYPAYNLKEFV 60

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ KPRKIL+M+  G P D +I+ L PLL  EDIL+DGGN+++ DT  R+  L+E G+ 
Sbjct: 61  DSLEKPRKILLMIKAGSPTDNMINALLPLLDDEDILIDGGNTNYQDTIRRNKTLAESGVN 120

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           FIG+GVSGG  GA +G SLM GG E AYN+V +IL +I+AK Q+ + C   +GP+G+GH+
Sbjct: 121 FIGMGVSGGEVGALTGPSLMPGGQEAAYNKVSDILDAIAAKAQDGASCVTYIGPNGAGHY 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +++D L  +  EIS  F  W+ G+L SYLI+IT +I + 
Sbjct: 181 VKMVHNGIEYADMQLIAESYTMMKDLLGMSHTEISQTFKDWNAGELESYLIEITGDIFTK 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D     P+++ I D A QKGTG  + I   +L   +TI   ++FAR +S  ++E     
Sbjct: 241 LDE-NNEPLVEKILDTAGQKGTGKWTSINALELGIPLTIITESVFARFISSIKEERVNAS 299

Query: 303 SFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              N     P   FD     F++ +  ALY S I S+ QGF  + KSSE + W+L L  +
Sbjct: 300 KSLNG----PQASFDGNKEEFLEKIRKALYMSKICSYAQGFAQMRKSSEDHEWNLKLGEL 355

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A IWR GCIIR+Q L  I  +   +P   NLL  P     V     +LR +V T  +NG 
Sbjct: 356 AMIWREGCIIRAQFLQKIKDAYDNNPELENLLLDPYFKNIVTDYQDALRDVVATGVKNGV 415

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P P  SA+++Y+D++  +  +ANLIQAQRD+FG+H ++RKD+    H  W +
Sbjct: 416 PTPGFSASVNYYDSYRSEDLSANLIQAQRDYFGAHTYERKDREGVFHTQWDE 467


>gi|212694876|ref|ZP_03303004.1| hypothetical protein BACDOR_04410 [Bacteroides dorei DSM 17855]
 gi|212662554|gb|EEB23128.1| hypothetical protein BACDOR_04410 [Bacteroides dorei DSM 17855]
          Length = 478

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 298/465 (64%), Gaps = 8/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYN-----KDFELTDVFIKKISGLSQKVIV 55
           M++ADIG+IGLG MG NL+LN+ DKG+++ V+N     K+  + D FI       + +I 
Sbjct: 1   MEKADIGLIGLGVMGQNLALNLADKGWKVVVWNRTVPGKEENVVDNFIAN-RAKGKGIIG 59

Query: 56  TKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL 115
           +  L   VEA+  PR IL+MV  G  VD+L+ KL PLL   DIL+DGGNS++ DT+ R  
Sbjct: 60  SNELTDFVEALKAPRVILLMVQAGPAVDELMGKLLPLLDKGDILIDGGNSYYEDTERRVK 119

Query: 116 QLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALL 174
           +L +KG+YF+G G+SGG +GA  GAS+M GG ++A+  ++ +L SI+AK ++ +PCC  +
Sbjct: 120 ELYDKGMYFVGCGISGGEEGALHGASIMPGGAQEAWPVIQPMLKSIAAKAEDGTPCCEWV 179

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           GP G+GH+VKM+HNGIEY +MQLIA+ Y  ++  L     +++ +F +W+ G+L SYLI+
Sbjct: 180 GPGGAGHYVKMVHNGIEYGDMQLIAESYFAMKHLLALKNEQMADIFEQWNKGRLHSYLIE 239

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           IT+ IL   +   G  ++D I D A QKGTG  S+I   +L++ + +   A+FARNLS  
Sbjct: 240 ITSAILRHKEQGGGY-LLDNILDAAGQKGTGRWSVINSLQLNTPLDVIAEAVFARNLSAE 298

Query: 295 RDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           ++    M   +    + P+  +   V  LE+ LYA+ ++ + QGF ++  +SE+Y W L 
Sbjct: 299 KNLRVLMSQHYMHVENHPVYNYQDTVAGLESTLYAARLIGYAQGFALMRTASEQYGWKLD 358

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L+TIA +WRAGCIIRS  LNDI ++    P  ++LL       +V + +P+ ++ +    
Sbjct: 359 LSTIALLWRAGCIIRSAFLNDIAEAYRRAPGLSHLLLDEHFGREVTEALPAWKKYIGVML 418

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           + G PVP LSAAL+YF     +   AN+IQA RD+FG+H F+R D
Sbjct: 419 KEGLPVPVLSAALNYFLGLTTNHSPANMIQAMRDYFGAHTFERVD 463


>gi|237785469|ref|YP_002906174.1| 6-phosphogluconate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758381|gb|ACR17631.1| 6-phosphogluconate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 487

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 295/475 (62%), Gaps = 6/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A+IG++GL  MGSN++ N    G+ +AVYN+  E TD F+    G +   I +  +E+ V
Sbjct: 12  ANIGVVGLAVMGSNIARNFASHGYTVAVYNRSHEKTDAFMSDF-GDTGSFIASSTIEKFV 70

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PR+ L+MV  G   D +I +L   +   DI++DGGNS + DT  R  +++ +G++
Sbjct: 71  ASLERPRRALIMVKAGAATDAVISQLADAMEEGDIIIDGGNSLYTDTIRREREIAARGLH 130

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG E++Y  +  +L SI+A+   +PCC  +GP+G+GHFV
Sbjct: 131 FVGAGISGGEEGALNGPSIMPGGPEESYKSLGPLLESIAAQVDGTPCCTHIGPNGAGHFV 190

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR   N  P EI+ +F +W+ G L SYL++ITAE+LS  
Sbjct: 191 KMVHNGIEYADMQVIGEAYHLLRYGANMEPAEIADVFREWNKGDLDSYLVEITAEVLSHV 250

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D+ TG P++DVI D A QKGTG  ++     L   +T    A+FAR LS    +    Q 
Sbjct: 251 DSETGKPLVDVIVDSAGQKGTGRWTVKAALDLGIPVTGIGEAVFARALSGATAQRTATQG 310

Query: 304 FFNPSSHF--PLKC--FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
              PS     P+     +SF++D+  ALYAS ++++ QGF  I   S ++ W++    +A
Sbjct: 311 NL-PSGSLRSPISAEERESFIEDVRRALYASKMVAYAQGFDEIKAGSAEHEWNVDPRDLA 369

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN I ++  ++P    LL  P  +E++   + S RRIVV+ TE G P
Sbjct: 370 TIWRGGCIIRAKFLNRIREAYDQNPDLQLLLLDPYFTEQMSNLVDSWRRIVVSATEMGLP 429

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           +P  +++LSY+D+   +R  A LIQAQRDFFG+H + R DK    H  W    +E
Sbjct: 430 IPVFASSLSYYDSLRAERLPATLIQAQRDFFGAHTYRRIDKDGSFHTLWSGDRSE 484


>gi|187920646|ref|YP_001889678.1| 6-phosphogluconate dehydrogenase [Burkholderia phytofirmans PsJN]
 gi|187719084|gb|ACD20307.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           phytofirmans PsJN]
          Length = 469

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 296/469 (63%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G  ++VYN+  E TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGHAVSVYNRSREKTDELIAEYP--DKKLVPAFTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ KPR+IL+MV  G+  D  I++LKPLL   DIL+DGGN+HF DT  R+  L++ G
Sbjct: 60  FVESLEKPRRILLMVKAGEGTDATINQLKPLLDKGDILIDGGNTHFTDTIRRNQDLAKSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+G
Sbjct: 120 LHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I 
Sbjct: 180 HFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITSKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +   
Sbjct: 240 GKKDDETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKTQRVA 299

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                   +  PL    D+F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TIA
Sbjct: 300 ASKVLEGPAAKPLGVERDAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDYGTIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  + T+D +  NLL  P   +  K    +LR +VV     G P
Sbjct: 360 KIFRAGCIIRARFLQKITDAYTKDKAIANLLLDPYFRDIAKNYQAALREVVVAAVNAGVP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 VPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHANW 468


>gi|254414284|ref|ZP_05028051.1| 6-phosphogluconate dehydrogenase, decarboxylating [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178959|gb|EDX73956.1| 6-phosphogluconate dehydrogenase, decarboxylating [Microcoleus
           chthonoplastes PCC 7420]
          Length = 471

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/472 (40%), Positives = 295/472 (62%), Gaps = 4/472 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q   G+IGL  MG NL+LN+  +GF +AVYN+    T+ F+ K +   + V    +LE
Sbjct: 1   MTQPSFGVIGLAVMGENLALNVESRGFPVAVYNRTSSKTEDFMAKRAS-DKNVTAAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+ + +PRKIL+MV  G PVD +ID+LKPLL P D+++DGGNS + +T+ R+  L   
Sbjct: 60  EFVKTLARPRKILVMVKAGKPVDIVIDQLKPLLEPGDMIIDGGNSLYEETERRTKDLEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA  G SLM GG + AY  +E IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLGFVGMGVSGGEEGALHGPSLMPGGTDTAYQELEPILTKIAAQVDDGPCVTYIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  +  ++  +FS+W+ T +L+S+LI+ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKHGLGLDHKQLHQVFSEWNTTDELNSFLIEITADI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  T  P++D+I D A QKGTG  +++   +L   +     A+ AR +S Y+ E  
Sbjct: 240 FKYIDPDTNQPLVDLILDSAGQKGTGRWTVVSSLELGVPIPTIYAAVNARVISSYKQERV 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              +     + ++      +F+  + +ALY S + S+ QG  ++GK+SE+++++L+LA  
Sbjct: 300 AAAKELIGTTGNYEGDS-QAFINKVRDALYCSKMCSYAQGMALLGKASEEFNYNLNLAET 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  L+ I  +  E+P   NLL  P   + +     + R ++V   + G 
Sbjct: 359 ARIWKGGCIIRAGFLDKIKNAFNENPKLPNLLLAPEFKQTILDRQDAWRDVLVASNQLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ SA+L YFD++  DR   NL QAQRD+FG+H ++R DK    H  W +
Sbjct: 419 PVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYERTDKEGVFHTEWAQ 470


>gi|16800481|ref|NP_470749.1| 6-phosphogluconate dehydrogenase [Listeria innocua Clip11262]
 gi|46907604|ref|YP_013993.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes serotype
           4b str. F2365]
 gi|217964477|ref|YP_002350155.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes HCC23]
 gi|226223977|ref|YP_002758084.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes Clip81459]
 gi|254824564|ref|ZP_05229565.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           J1-194]
 gi|254852576|ref|ZP_05241924.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           R2-503]
 gi|254932561|ref|ZP_05265920.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes HPB2262]
 gi|290893515|ref|ZP_06556498.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           J2-071]
 gi|300766396|ref|ZP_07076353.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes FSL N1-017]
 gi|16413886|emb|CAC96644.1| lin1413 [Listeria innocua Clip11262]
 gi|46880872|gb|AAT04170.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|217333747|gb|ACK39541.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes HCC23]
 gi|225876439|emb|CAS05148.1| Putative 6-phosphogluconate dehydrogenase [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605889|gb|EEW18497.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           R2-503]
 gi|290556860|gb|EFD90391.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           J2-071]
 gi|293584120|gb|EFF96152.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes HPB2262]
 gi|293593803|gb|EFG01564.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes FSL
           J1-194]
 gi|300512900|gb|EFK39990.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes FSL N1-017]
 gi|307570958|emb|CAR84137.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes L99]
 gi|328467514|gb|EGF38583.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 1816]
 gi|328475026|gb|EGF45816.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes 220]
 gi|332311818|gb|EGJ24913.1| 6-phosphogluconate dehydrogenase [Listeria monocytogenes str. Scott
           A]
          Length = 472

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/473 (41%), Positives = 294/473 (62%), Gaps = 3/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHTVSIFNRSTEKTKAVMEE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLEVPRRILIMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL++    +  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYTILKEIGGLSHDELADVFEEWNNGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+DVI DKA QKGTG  +      L   +++   ++FAR +S  +DE   
Sbjct: 239 KVKDEETGKPIVDVILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKDERVY 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  +  S++  +    +FV+ +  ALY S I S+ QGF  +  +SE+  W L    IA
Sbjct: 299 ASTVLSGPSNYRFEGDKKAFVESVRRALYFSKIASYAQGFAQMRAASEENDWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +        LR +V    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNKDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ +AA+SY+D++  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 VPTFTAAISYYDSYRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 471


>gi|194016907|ref|ZP_03055520.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus pumilus
           ATCC 7061]
 gi|194011513|gb|EDW21082.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus pumilus
           ATCC 7061]
          Length = 469

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 290/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVVGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQESKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L   DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGAATDATIQSLLPHLEKGDILIDGGNTYYKDTQRRNQELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+     +  E+  +FS+W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKHVAGLSAEELHEVFSEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-K 299
           +  D  T  P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  +
Sbjct: 239 TKVDEETNQPLVDVILDKAGQKGTGKWTSQSSLDLGVPLPIITESVFARYISAMKDERVE 298

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             Q    P      +     ++ +  AL+ S I S+ QGF  +  +S++Y+W L    IA
Sbjct: 299 ASQLIEGPKPAQSAENKQELIEAVRKALFMSKICSYAQGFAQMKAASDEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL  P   +  +    SLR+++    E G P
Sbjct: 359 MIFRGGCIIRAAFLQQIKEAYDRNPELKNLLLDPYFKDIAQSYQSSLRKVISLAVEQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPSLS+AL+YFD++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSLSSALAYFDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|312602594|ref|YP_004022439.1| 6-phosphogluconate dehydrogenase [Burkholderia rhizoxinica HKI 454]
 gi|312169908|emb|CBW76920.1| 6-phosphogluconate dehydrogenase (EC 1.1.1.44) [Burkholderia
           rhizoxinica HKI 454]
          Length = 483

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 293/469 (62%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I+ +    +K++ T  L+ 
Sbjct: 17  KQA-IGVIGLAVMGRNLALNIESRGYAVSVYNRTRERTDALIRALP--DRKLVPTNTLQA 73

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++  PR+IL+MV  G P D  I  LKPLL   D+L+DGGN+HF DT  R  +L++ G
Sbjct: 74  FVESLETPRRILLMVKAGTPTDDTIAALKPLLERGDVLIDGGNTHFTDTMRRHRELADAG 133

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG   AY RVE IL  I+A+  +  PC A +GPDG+G
Sbjct: 134 LHFIGTGVSGGEEGALHGPSIMPGGPRDAYERVEPILTRIAARADDGEPCVAYMGPDGAG 193

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+     +  ++  ++++W+ G+L SYLI IT++I 
Sbjct: 194 HYVKMVHNGIEYGDMQLIAESYALLKHVAGLSNAQLRDVYAQWNEGELDSYLIDITSKIF 253

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-K 299
           +  D  TG  ++DV+ D+A+QKGTG  +      L   + +   ++FAR LS  + E   
Sbjct: 254 ARKDDETGQDLVDVVLDRAAQKGTGKWTSQNALDLGVPLQLITESVFARVLSSLKSERVM 313

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +    PS        + F++ +  ALY S ++S+ QGF  +  +S++Y W L   TIA
Sbjct: 314 ASRQLSGPSPRALTGAREPFIEAIRRALYLSKVISYAQGFAQLRAASDEYGWDLQYGTIA 373

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RI+RAGCIIR++ L  I  +  ++P+  NLL  P   +   +   +LR +VV   + G P
Sbjct: 374 RIFRAGCIIRARFLQKITDAYAQNPALVNLLLAPYFRDVAAQYQAALREVVVAAVQAGVP 433

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++A++YFD +  +   ANLIQAQRDFFG+H F+R DK    H  W
Sbjct: 434 VPAFASAIAYFDAYRAETLPANLIQAQRDFFGAHTFERIDKPGSFHARW 482


>gi|229817743|ref|ZP_04448025.1| hypothetical protein BIFANG_03015 [Bifidobacterium angulatum DSM
           20098]
 gi|229785532|gb|EEP21646.1| hypothetical protein BIFANG_03015 [Bifidobacterium angulatum DSM
           20098]
          Length = 482

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 292/476 (61%), Gaps = 5/476 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G   +    K LE+ 
Sbjct: 4   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRTYARTEKLMNE-HGTEGEFYPAKTLEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 63  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC A +G +G+GHF
Sbjct: 123 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVAHIGLNGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 183 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E   
Sbjct: 243 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAA 302

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P+    L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 303 KQGFAGPNGELNLNSEEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYGWDIDLAAV 362

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 363 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIETAEKSWRNVVAQAALNGL 422

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W +   E
Sbjct: 423 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLWAEPGRE 478


>gi|221196996|ref|ZP_03570043.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD2M]
 gi|221203669|ref|ZP_03576687.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD2]
 gi|221175835|gb|EEE08264.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD2]
 gi|221183550|gb|EEE15950.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD2M]
          Length = 470

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/474 (42%), Positives = 296/474 (62%), Gaps = 11/474 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE
Sbjct: 1   MGKQAIGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDG 178
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG
Sbjct: 119 GLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+IT++
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYAVLKHVAGLTNDELGAVYTEWNQGELDSYLIEITSK 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E 
Sbjct: 239 IFGKKDDETGQHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTER 298

Query: 299 KKMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
                  +  +  P   FD    +F++ +  ALY S ++S+ QGF  +  +SE+Y W+L 
Sbjct: 299 VAASKILSGPAAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLD 355

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P      ++   SLR +VV   
Sbjct: 356 LGTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFRGIAEQYQASLREVVVAAV 415

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 416 KAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|115358036|ref|YP_775174.1| 6-phosphogluconate dehydrogenase [Burkholderia ambifaria AMMD]
 gi|171320307|ref|ZP_02909360.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria MEX-5]
 gi|115283324|gb|ABI88840.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           ambifaria AMMD]
 gi|171094454|gb|EDT39515.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria MEX-5]
          Length = 470

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/473 (43%), Positives = 295/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G  ++VYN+    TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDDATGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +  +  P   FD    +F++ +  ALY S ++S+ QGF  +  +SE+Y WSL L
Sbjct: 300 AASKILSGPAAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWSLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       SLR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDIAANYQASLRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|170702788|ref|ZP_02893642.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria IOP40-10]
 gi|170132296|gb|EDT00770.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria IOP40-10]
          Length = 470

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/473 (43%), Positives = 294/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G  ++VYN+    TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDDATGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +     P   FD    +F++ +  ALY S ++S+ QGF  +  +SE+Y WSL L
Sbjct: 300 AASKILSGPVAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWSLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       SLR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLAPYFKDIAANYQASLRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|148269622|ref|YP_001244082.1| 6-phosphogluconate dehydrogenase [Thermotoga petrophila RKU-1]
 gi|147735166|gb|ABQ46506.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Thermotoga
           petrophila RKU-1]
          Length = 469

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 306/468 (65%), Gaps = 4/468 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           ++ IG+IGL  MG NL+LNI  KG++++VYN+  + T+ F+K     ++++    ++E  
Sbjct: 2   KSHIGLIGLAVMGQNLALNIARKGYKVSVYNRTAQRTEEFVKN-RVTNEEIEPHYDIESF 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PRKI++MV  G PVD  I +L P L P D+++DGGNSH+ DT+ R  +LSEKGI
Sbjct: 61  VKSLERPRKIILMVKAGKPVDDTISQLLPHLEPGDLIIDGGNSHYMDTERRFKELSEKGI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G+GVSGG  GA  G SLM GG+ +AYN VE ILL I+AK ++ PCC  +G   +GHF
Sbjct: 121 LFLGMGVSGGEYGALYGPSLMPGGSREAYNLVEEILLKIAAKTEDGPCCTYVGERSAGHF 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA MQ IA++Y I+RD L+ +  E+S +F +W+ G+LSS+L++IT +IL  
Sbjct: 181 VKMVHNGIEYAIMQAIAEVYHIMRDVLSLSSEEMSSIFEEWNRGELSSFLVEITYKILRK 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI DKA QKGTG  +      L         A+  R +S ++D   ++ 
Sbjct: 241 KDEETGKPMVDVILDKAEQKGTGKWTSQAALDLGIPTPSINLAVVERVISHFKDIRTRLS 300

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             +N       +  + F++DL N+L+ +  ++F+QG W+I ++S+++ + ++L+ + RIW
Sbjct: 301 KLYNKRRS-ATQGSEEFLRDLRNSLFFAMFMAFSQGMWLIAEASKEFGYGVNLSEVLRIW 359

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           + GCIIR+++++ + + ++ +  +  LL    +   +K  I SL+ I+    EN  PVP 
Sbjct: 360 KGGCIIRAKLIDTLRRYISNE--NAYLLENEEVMNLLKGKIDSLKNILKASIENEIPVPV 417

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           L+++ +YF +   +R  ANLIQAQRDFFG+H F+R D+    H  W++
Sbjct: 418 LNSSYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDREGVFHINWEE 465


>gi|225351825|ref|ZP_03742848.1| hypothetical protein BIFPSEUDO_03426 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157072|gb|EEG70411.1| hypothetical protein BIFPSEUDO_03426 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 487

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/476 (39%), Positives = 292/476 (61%), Gaps = 5/476 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G   +    K LE+ 
Sbjct: 9   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRSYGRTEKLMNE-HGNEGEFFPAKTLEEF 67

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 68  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 127

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 128 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 187

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 188 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 247

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
           +D  TG P++DVI D A  KGTG  ++     L+  +T    A+FAR LS   D  E   
Sbjct: 248 ADKKTGEPLVDVIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAA 307

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P  +  L   +  +F++D+  ALYAS I+++ QGF  I  ++E+Y W + LA +
Sbjct: 308 KQGFNGPDGNLNLTDDEKKAFIEDIRQALYASKIVAYAQGFNEITTAAEEYGWDIDLAAV 367

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 368 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIETAEKSWRNVVAQAAVNGL 427

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W +   E
Sbjct: 428 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLWAEPGRE 483


>gi|302523758|ref|ZP_07276100.1| 6-phosphogluconate dehydrogenase [Streptomyces sp. AA4]
 gi|302432653|gb|EFL04469.1| 6-phosphogluconate dehydrogenase [Streptomyces sp. AA4]
          Length = 478

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/475 (39%), Positives = 280/475 (58%), Gaps = 4/475 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG+ GL  MG NL+ N+   G  +A++N+  E T   +++  G     I     ++
Sbjct: 3   KKASIGVTGLAVMGRNLARNLARHGHTVALHNRSEERTRSLVEQF-GDEGDFIPAYTAQE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+A+ +PR+I++MV  G P D +I++  PLL P D+++D GN+HF DT+ R   L E+G
Sbjct: 62  FVDALERPRQIVIMVKAGGPTDAVIEEFAPLLEPGDVIVDAGNAHFADTRRREQALRERG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++F+G GVSGG +GA  G S+M GG++++Y  +  +   ISAK    PCC  +G DG+GH
Sbjct: 122 LHFVGTGVSGGEEGALHGPSIMPGGSKESYESLGPLFEDISAKVDGEPCCTHVGADGAGH 181

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQLIA+ + +LR +   +P EI+ +F  W+TG+L SYLI+ITA++L 
Sbjct: 182 FVKMVHNGIEYADMQLIAESFDLLRGAAGYSPAEIADVFGTWNTGRLDSYLIEITAQVLK 241

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  +G P +DV+ D A QKGTG  ++  G  L   ++    A+FAR+LS         
Sbjct: 242 HVDGASGKPFVDVVEDAAEQKGTGRWTVQIGLDLGVPISGIAEAVFARSLSGSTGLRSAA 301

Query: 302 QSFFNPSSHFPL--KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           +    P +  PL     ++F  D+E ALYAS ++++ QGF  I   + +Y W + L  +A
Sbjct: 302 RGLGGP-TRTPLTGSALETFADDVEQALYASKVVAYAQGFNQIQAGAAEYGWDIDLGRVA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LNDI  +   +P    LL        V+    S R ++ T    G P
Sbjct: 361 SIWRGGCIIRAKFLNDITSAYAAEPGLPTLLTSGDFRAAVENAQDSWRSVISTAVRLGIP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            P  S AL+Y+D    DR  A L+Q QRDFFG+H + R D+    H  W    +E
Sbjct: 421 TPGFSTALAYYDGLRADRLPAALVQGQRDFFGAHTYRRVDRPGSFHTLWAGDQSE 475


>gi|170288298|ref|YP_001738536.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga sp.
           RQ2]
 gi|170175801|gb|ACB08853.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga sp.
           RQ2]
          Length = 469

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 305/468 (65%), Gaps = 4/468 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           ++ IG+IGL  MG NL+LNI  KG++++VYN+  + T+ F+K     ++++    ++E  
Sbjct: 2   KSHIGLIGLAVMGQNLALNIARKGYKVSVYNRTAQRTEEFVKN-RVTNEEIEPHYDIESF 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PRKI++MV  G PVD  I +L P L P D+++DGGNSH+ DT+ R  +LSEKGI
Sbjct: 61  VKSLERPRKIILMVKAGKPVDDTISQLLPHLEPGDLIIDGGNSHYMDTERRFKELSEKGI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G+GVSGG  GA  G SLM GG+ +AYN VE ILL I+AK +  PCC  +G   +GHF
Sbjct: 121 LFLGMGVSGGEYGALYGPSLMPGGSREAYNLVEEILLKIAAKTEEGPCCTYVGERSAGHF 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA MQ IA++Y I+RD L+ +  E+S +F +W+ G+LSS+L++IT +IL  
Sbjct: 181 VKMVHNGIEYAIMQAIAEVYHIMRDVLSLSSEEMSSIFEEWNRGELSSFLVEITYKILRK 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI DKA QKGTG  +      L         A+  R +S ++D   ++ 
Sbjct: 241 KDEETGKPMVDVILDKAEQKGTGKWTSQAALDLGIPTPSINLAVVERVISHFKDIRTRLS 300

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             +N       +  + F++DL N+L+ +  ++F+QG W+I ++S+++ + ++L+ + RIW
Sbjct: 301 KLYNKRRS-ATQGSEEFLRDLRNSLFFAMFMAFSQGMWLIAEASKEFGYGVNLSEVLRIW 359

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           + GCIIR+++++ + + ++ +  +  LL    +   +K  I SL+ I+    EN  PVP 
Sbjct: 360 KGGCIIRAKLIDTLRRYISNE--NAYLLENEEVMNLLKGKIDSLKNILKASIENEIPVPV 417

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           L+++ +YF +   +R  ANLIQAQRDFFG+H F+R D+    H  W++
Sbjct: 418 LNSSYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDREGVFHINWEE 465


>gi|107026803|ref|YP_624314.1| 6-phosphogluconate dehydrogenase [Burkholderia cenocepacia AU 1054]
 gi|116692004|ref|YP_837537.1| 6-phosphogluconate dehydrogenase [Burkholderia cenocepacia HI2424]
 gi|170736002|ref|YP_001777262.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           cenocepacia MC0-3]
 gi|206562796|ref|YP_002233559.1| 6-phosphogluconate dehydrogenase [Burkholderia cenocepacia J2315]
 gi|254248751|ref|ZP_04942071.1| 6-phosphogluconate dehydrogenase [Burkholderia cenocepacia PC184]
 gi|105896177|gb|ABF79341.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           cenocepacia AU 1054]
 gi|116650004|gb|ABK10644.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Burkholderia
           cenocepacia HI2424]
 gi|124875252|gb|EAY65242.1| 6-phosphogluconate dehydrogenase [Burkholderia cenocepacia PC184]
 gi|169818190|gb|ACA92772.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           cenocepacia MC0-3]
 gi|198038836|emb|CAR54798.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           cenocepacia J2315]
          Length = 470

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 297/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G+ ++V+N+  E TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGYAVSVFNRSREKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYSVLKDVAGLTNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDEETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +  +  P   FD    +FV+ +  ALY S ++S+ QGF  +  +SE+Y W+L L
Sbjct: 300 AASKILSGPAAAP---FDGDRAAFVEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       +LR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDIAANYQTALRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|75908741|ref|YP_323037.1| 6-phosphogluconate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75702466|gb|ABA22142.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Anabaena
           variabilis ATCC 29413]
          Length = 476

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/474 (41%), Positives = 291/474 (61%), Gaps = 4/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+ + +G  + V     LE
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMAQRAG-GRNVKAAFTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DTQ R+ +L   
Sbjct: 60  EFVAALERPRKILVMVQAGKPVDAVIQQLKPLLDEGDIIIDGGNSWFEDTQRRTQELEPA 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG + +Y  +  I   I+A+  + PC   +GP GSG
Sbjct: 120 GLRFLGMGVSGGEEGALNGPSLMPGGTQSSYEYLSPIFNKIAAQVDDGPCVTYVGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L+ +   +  ++  +F++W+ T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKTAGGLDAKQLHEVFAQWNTTDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  T +P++D+I D A QKGTG  ++    +L  S+     A+ AR +S  RDE  
Sbjct: 240 FPYVDPDTKLPLVDLIVDAAGQKGTGRWTVQTALELGVSIPTITAAVNARIISSIRDERI 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              +    PS  +       F+  + +ALY S I S+ QG  ++  +S  ++W+L+L+ +
Sbjct: 300 AASKQLTGPSGKYDGDT-KEFINKVRDALYCSKICSYAQGMALLSTASTTFNWNLNLSEL 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  LN I K+  E+P+  NLL  P   + +     + R +++T  + G 
Sbjct: 359 ARIWKGGCIIRAGFLNKIKKAFNENPALPNLLLAPEFKQTILDRQAAWREVIITAAKLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           PVP+ SA+L YFD++  DR   NL QAQRD+FG+H + R DK    H  W  ++
Sbjct: 419 PVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYLRTDKAGAFHTEWVPIA 472


>gi|281411660|ref|YP_003345739.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga
           naphthophila RKU-10]
 gi|281372763|gb|ADA66325.1| 6-phosphogluconate dehydrogenase, decarboxylating [Thermotoga
           naphthophila RKU-10]
          Length = 469

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 307/469 (65%), Gaps = 6/469 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIK-KISGLSQKVIVTKNLEQ 61
           ++ IG+IGL  MG NL+LNI  KG++++V+N+  + T+ F+K ++ G  +++    +++ 
Sbjct: 2   KSSIGLIGLAVMGQNLALNIARKGYKVSVFNRTAQKTEEFVKNRVKG--EEIEPHYDIKD 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ +PRKI++MV  G PVD  I +L P L P D+++DGGNSH+ DT+ R  +LSEKG
Sbjct: 60  FVESLERPRKIILMVKAGKPVDDTISQLLPYLEPGDLIIDGGNSHYMDTERRFKELSEKG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I F+G+GVSGG  GA  G SLM GG+ +AYN VE ILL I+AK +  PCC  +G   +GH
Sbjct: 120 ILFLGMGVSGGEYGALYGPSLMPGGSREAYNLVEEILLKIAAKTEEGPCCTYVGERSAGH 179

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA MQ IA++Y I+RD L+ +  E+S +F +W+ G+LSS+L++IT +IL 
Sbjct: 180 FVKMVHNGIEYAIMQAIAEVYHIMRDVLSLSSEEMSSIFEEWNRGELSSFLVEITYKILR 239

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++DVI DKA QKGTG  +      L         A+  R +S ++D   ++
Sbjct: 240 KKDEETGKPMVDVILDKAEQKGTGKWTSQAALDLGIPTPSINLAVVERVISHFKDIRTRL 299

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              +N       +  + F++DL N+L+ +  ++F+QG W+I ++S+++ + ++L+ + RI
Sbjct: 300 SKLYNKRRS-ATQGSEEFLRDLRNSLFFAMFMAFSQGMWLIAEASKEFGYGVNLSEVLRI 358

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           W+ GCIIR+++++ + + ++ +  +  LL    +   +K  I SL+ I+    EN  PVP
Sbjct: 359 WKGGCIIRAKLIDTLRRYISNE--NAYLLENEEVMNLLKGKIDSLKNILKASIENEIPVP 416

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            L+++ +YF +   +R  ANLIQAQRDFFG+H F+R D+    H  W++
Sbjct: 417 VLNSSYNYFMSLTEERLPANLIQAQRDFFGAHTFERVDREGVFHINWEE 465


>gi|161521218|ref|YP_001584645.1| 6-phosphogluconate dehydrogenase [Burkholderia multivorans ATCC
           17616]
 gi|189352607|ref|YP_001948234.1| 6-phosphogluconate dehydrogenase [Burkholderia multivorans ATCC
           17616]
 gi|221212401|ref|ZP_03585378.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD1]
 gi|160345268|gb|ABX18353.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans ATCC 17616]
 gi|189336629|dbj|BAG45698.1| 6-phosphogluconate dehydrogenase [Burkholderia multivorans ATCC
           17616]
 gi|221167500|gb|EED99969.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           multivorans CGD1]
          Length = 470

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/474 (42%), Positives = 296/474 (62%), Gaps = 11/474 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ ++VYN+  E TD  I +  G  + ++ T  LE
Sbjct: 1   MGKQAIGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPG--RNLVPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDG 178
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG
Sbjct: 119 GLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+IT++
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYAVLKHVAGLTNEELGAVYTEWNQGELDSYLIEITSK 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E 
Sbjct: 239 IFGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTER 298

Query: 299 KKMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
                  +  +  P   FD    +F++ +  ALY S ++S+ QGF  +  +SE+Y W+L 
Sbjct: 299 VAASKILSGPAAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWNLD 355

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P      ++   SLR +VV   
Sbjct: 356 LGTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFRGIAEQYQASLRDVVVAAV 415

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 416 KAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|157692891|ref|YP_001487353.1| 6-phosphogluconate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681649|gb|ABV62793.1| phosphogluconate 2-dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 469

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/471 (42%), Positives = 290/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +GF ++VYN+    T+ F+++ +G  + V+ T ++E
Sbjct: 1   MSKQQIGVVGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLEESNG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L   DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGAATDATIQSLLPHLEKGDILIDGGNTYYKDTQRRNQELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+     +  E+  +FS+W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKHVAGLSAEELHEVFSEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-K 299
           +  D  T  P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  +
Sbjct: 239 TKVDEETNQPLVDVILDKAGQKGTGKWTSQSSLDLGVPLPIITESVFARYISAMKDERVE 298

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             Q    P      +     ++ +  AL+ S I S+ QGF  +  +S++Y+W L    IA
Sbjct: 299 ASQLIEGPKPAQSAENKQELIEAVRKALFMSKICSYAQGFAQMKAASDEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL  P   +  +    SLR+++    E G P
Sbjct: 359 MIFRGGCIIRAAFLQQIKEAYDRNPELKNLLLDPYFKDIAQSYQSSLRKVISLAVEQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+YFD++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYFDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|295699075|ref|YP_003606968.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           CCGE1002]
 gi|295438288|gb|ADG17457.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           CCGE1002]
          Length = 469

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 201/470 (42%), Positives = 294/470 (62%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++GL  MG NL+LNI  +G  ++VYN+    TD  I +     +K++    LE
Sbjct: 1   MSKQAIGVVGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAEYP--DRKLVPAFTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+ILMMV  G+P D  I  LKPLL   DIL+DGGN+ F DT  R+ +L++ 
Sbjct: 59  EFVDSLEKPRRILMMVKAGEPTDATIASLKPLLEKGDILIDGGNTPFTDTIRRNQELAKA 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+
Sbjct: 119 GLHFIGTGVSGGEEGALKGPSIMPGGQRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I
Sbjct: 179 GHFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITSKI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            S  D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +  
Sbjct: 239 FSKKDDETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKTQRV 298

Query: 300 KMQSFFNPSSHFPLK-CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                       PL+   ++F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TI
Sbjct: 299 AASKVLEGPQAKPLEGAKEAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDYGTI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  + T+D +  NLL  P   +  K    +LR +VV     G 
Sbjct: 359 AKIFRAGCIIRARFLQKITDAYTKDKALANLLLDPYFRDIAKNYQAALREVVVAAVNAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 PVPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHAQW 468


>gi|283457844|ref|YP_003362444.1| 6-phosphogluconate dehydrogenase [Rothia mucilaginosa DY-18]
 gi|283133859|dbj|BAI64624.1| 6-phosphogluconate dehydrogenase [Rothia mucilaginosa DY-18]
          Length = 490

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 202/479 (42%), Positives = 302/479 (63%), Gaps = 8/479 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG+ GL  MG+NL+ N+   G+ +A++N+  E TD  + +  G     I T++L++
Sbjct: 5   KKAQIGVTGLAVMGANLARNLARNGYTVALHNRSVEKTDALLAE-HGADGDFIRTESLQE 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V+++  PR+IL+MV  G PVD +I++L PLL   DI++DGGNSHF DT  R   L+EKG
Sbjct: 64  LVDSLESPRRILIMVKAGAPVDAVIEQLTPLLDEGDIIIDGGNSHFPDTIRRERALAEKG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++F+G+GVSGG +GA  G S+M GG+ ++Y  +  +L  I+AK     +PCCA +  DGS
Sbjct: 124 LHFVGVGVSGGEEGALWGPSMMPGGSAESYKHIGPMLEKIAAKAPQDGAPCCAWISTDGS 183

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEYA+MQ+I + Y +LR      P E + +F  W+ G LSSYLI+ITAE+
Sbjct: 184 GHFVKMVHNGIEYADMQVIGEAYDLLRSVAGIEPAEQAEIFKTWNEGDLSSYLIEITAEV 243

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D  TG P++DVI D A QKGTG+ +   G  L S ++    ++FAR LS    E +
Sbjct: 244 LAQVDAKTGKPLVDVIVDAAGQKGTGLWTAKAGLDLGSPVSAIAESVFARALSSSEREQR 303

Query: 300 KMQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +      P+         +    FV+D+  AL+AS ++++ QG  ++ ++ ++Y W L L
Sbjct: 304 EQAQRELPAGLIATTGIGAGDPEFVEDVRRALFASKLVAYAQGMDLLTRAGKEYGWDLKL 363

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA +WRAGCIIR+++L DI+ +   D +  N+L  P+    +++ +PS RR+V   T 
Sbjct: 364 DTIASLWRAGCIIRAELLGDIMAAYA-DEAPANMLLAPAFKNLMEELVPSWRRVVAKATA 422

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            G PVP  ++ALSY+D    DR  A+LIQ QRDFFG+H + R D+    H  W    +E
Sbjct: 423 LGIPVPVFASALSYYDGLRRDRLPASLIQGQRDFFGAHTYGRIDEEGAFHTMWSGDRSE 481


>gi|291484823|dbj|BAI85898.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 469

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/471 (41%), Positives = 292/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEKFLQEAKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 298

Query: 301 MQSFFNPSSHFPL-KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P+ +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASGLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL        V+    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|1703017|sp|P52207|6PGD_BACLI RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|563953|dbj|BAA06504.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis]
          Length = 467

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/464 (43%), Positives = 281/464 (60%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+  KG ++AVYN   +LTD  ++K  G  Q V     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMASKGEQVAVYNYTRDLTDQLVQKTGG--QTVKPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +ID L PLL   D+++DGGNSH+ DT+ R   L  KGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIDSLVPLLEEGDVIMDGGNSHYEDTERRYDSLKAKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA  G S+M GG+   Y +   IL  I+A+ +  PCC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEVGALKGPSIMPGGDRDVYEKAAPILTKIAAQVEGDPCCVYIGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR+ L     EI+ +F  W+ G+L SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLREKLLLPIDEIADIFDTWNQGELKSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        +I   ++FAR LS  +DE    ++  
Sbjct: 243 RTGAPLIDVILDKTGQKGTGKWTSLQAIDNGIPSSIITESLFARYLSSLKDERTAAENVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P +       + ++  +  ALY   + ++ QGF     +S+   W L L  IA I+R 
Sbjct: 303 AGPETEERPLDQNVWIDRVRQALYMGKVCAYAQGFAQYKMTSDLNGWHLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+Q LN I +   + P  +NLL  P  +EK+K+    LR++V     +G   P LS
Sbjct: 363 GCIIRAQFLNLISEVYDKQPDLSNLLVAPDFAEKLKEYQSGLRKVVCEGISSGISFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            ALSY+D +   R  ANL+QAQ ++FG+H ++R D     H  W
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQANYFGAHTYERTDMEGVFHTDW 466


>gi|239814700|ref|YP_002943610.1| 6-phosphogluconate dehydrogenase, decarboxylating [Variovorax
           paradoxus S110]
 gi|239801277|gb|ACS18344.1| 6-phosphogluconate dehydrogenase, decarboxylating [Variovorax
           paradoxus S110]
          Length = 474

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 298/475 (62%), Gaps = 13/475 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           ++D G+IGL  MG NL LN+  +GF+++VYN+    T+ F+    G  +K++  K LE+ 
Sbjct: 5   KSDFGLIGLAVMGQNLVLNVESRGFQVSVYNRTEATTEAFVAANPG--KKLVGAKTLEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PRKI +MV  G PVDQ+I++L PLL  +DI++DGGNS + DT+ R   L+ KG+
Sbjct: 63  VQSLARPRKIQIMVKAGAPVDQVIEQLIPLLDKDDIVIDGGNSLYTDTERRDAYLATKGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            FIG GVSGG +GAR G S+M GG    +  ++ I  SI+AK    PC   +GP G+GH+
Sbjct: 123 RFIGAGVSGGEEGARKGPSIMPGGPLSTWEVMKPIFESIAAKVDGEPCVIHIGPGGAGHY 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + Y + + +   +  E++ +F++W+ G+L SYLI+ITA+ L  
Sbjct: 183 VKMVHNGIEYGDMQLICEAYSLFK-AAGFSTDEMAAVFNEWNEGELQSYLIQITAKALEQ 241

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD----ES 298
            D  TG PI+++I DKA QKGTG  +++   + +  ++    A+ AR LS  +      S
Sbjct: 242 KDPETGQPIVELILDKAGQKGTGQWTLVNAAENAVVISTINAAVEARVLSSQKTARVAAS 301

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K +Q    P     L    + V  + +ALYAS ++S+TQGF +I    EK +W L L  I
Sbjct: 302 KLLQG---PKVELSLGK-KALVAKVHDALYASKVVSYTQGFDLIQTMGEKKAWKLDLGGI 357

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A IWR GCIIR++ LN I  +   DPS  NL+  P   + + +T  + R +V     NG 
Sbjct: 358 AAIWRGGCIIRARFLNRITDAYRADPSLGNLMLDPFFKDLLNRTQQNWREVVALAVGNGI 417

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKV 471
           PVP+ SA+L+Y+D++  +R  ANL+QAQRDFFG+H ++R DK +    H  W +V
Sbjct: 418 PVPAFSASLAYYDSYRTERLPANLLQAQRDFFGAHTYERVDKPAGEFFHTNWPEV 472


>gi|50812264|ref|NP_390267.2| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221310305|ref|ZP_03592152.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221314629|ref|ZP_03596434.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221319552|ref|ZP_03600846.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221323828|ref|ZP_03605122.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|321311866|ref|YP_004204153.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis BSn5]
 gi|33518617|sp|P80859|6PGD2_BACSU RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 2;
           AltName: Full=GNTZII
 gi|32468789|emb|CAB14318.2| NADP+-dependent 6-P-gluconate dehydrogenase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|320018140|gb|ADV93126.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis BSn5]
          Length = 469

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/471 (41%), Positives = 292/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQEAKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 298

Query: 301 MQSFFNPSSHFPL-KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P+ +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASGLLSGPEVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL        V+    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|296333461|ref|ZP_06875914.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675033|ref|YP_003866705.1| NADP+-dependent 6-P-gluconate dehydrogenase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296149659|gb|EFG90555.1| 6-phosphogluconate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413277|gb|ADM38396.1| NADP+-dependent 6-P-gluconate dehydrogenase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 469

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/471 (41%), Positives = 292/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQEAKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSADELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 298

Query: 301 MQSFFNPSSHFPL-KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P+ +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASGLLSGPDVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL        V+    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKEAYDREPELDNLLLDSYFKNIVESYQGALRQVISLAVAQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|284029841|ref|YP_003379772.1| 6-phosphogluconate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283809134|gb|ADB30973.1| 6-phosphogluconate dehydrogenase, decarboxylating [Kribbella
           flavida DSM 17836]
          Length = 479

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/467 (41%), Positives = 287/467 (61%), Gaps = 4/467 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A I + GL  MG NL+ N+   GFR+AV+N+    TD  I++  G   + +   +L  +V
Sbjct: 6   AQIAVTGLAVMGRNLARNLARNGFRVAVHNRSQGRTDALIEEF-GHEGEFVPAADLPALV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRKI++MV  G+P D +ID+L PLL   DI++D GN+HF DT+ R   L EKG++
Sbjct: 65  ASLEQPRKIIVMVKAGEPTDAVIDELVPLLDEGDIVVDAGNAHFADTRRREDALKEKGLH 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG+ ++Y  +E +L  I+A     PCC  +GPDG+GHFV
Sbjct: 125 FVGAGVSGGEEGALNGPSIMPGGSPESYAALEPMLTKIAAHVNGEPCCVHVGPDGAGHFV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR+ L  +  EI+ +F +W++G L S+LI+ITAE+LS  
Sbjct: 185 KMLHNGIEYADMQLIAESYDLLRNVLGLSAAEIAEVFREWNSGDLESFLIEITAEVLSQV 244

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--LYRDESKKM 301
           D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS  + R  +   
Sbjct: 245 DESTGQPFVDVVLDQAEQKGTGRWTVQVALDLGIPVSGMAEAVFARSLSGDVVR-RTAAA 303

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                P+        D+F++D+ +ALY+S ++++ QGF  I  +SE+Y W++ L  +A I
Sbjct: 304 GVLPGPTEAKADVDRDAFIEDVRHALYSSKLVAYAQGFDAIRAASEQYGWNIDLGAMATI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ L+ I ++   D    +LL      + V     + RR+V T    G P P
Sbjct: 364 WRGGCIIRARFLDRIKEAYDRDADLGSLLVDDYFKDAVANGQDAWRRVVATAATTGVPAP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             SAALSY+D    +R  A LIQ  RD FG+H + R D+    H  W
Sbjct: 424 GFSAALSYYDGLRAERLPAALIQGLRDLFGAHTYHRVDREGAFHLDW 470


>gi|224539294|ref|ZP_03679833.1| hypothetical protein BACCELL_04199 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224519083|gb|EEF88188.1| hypothetical protein BACCELL_04199 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 495

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 295/465 (63%), Gaps = 6/465 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVTKNL 59
           ++ DIG+IGL  MG NL+LN+ DKG+ ++V+N+     +  V  + I+G ++   +    
Sbjct: 9   QKTDIGLIGLAVMGENLALNMADKGWHVSVFNRTVPGVEEGVVERFINGRAKGKSIEGYT 68

Query: 60  E--QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL 117
           E    VE++  PRKI+MMV  G  VD+L+++L P LSP DIL+DGGNS++ DT  R    
Sbjct: 69  EIPDFVESISTPRKIMMMVRAGSAVDELMEQLFPHLSPGDILIDGGNSNYEDTNRRVALA 128

Query: 118 SEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
             KG  F+G GVSGG +GA +GAS+M GG+  A++ V+ IL SI+A+  + +PCC  +GP
Sbjct: 129 ESKGFRFVGAGVSGGEEGALNGASIMPGGSVTAWDEVKPILQSIAARAADGTPCCDWIGP 188

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L  N  +++ +F+ W+ GKL SYLI+IT
Sbjct: 189 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLLQLNNEDMASVFAHWNEGKLRSYLIEIT 248

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           A IL   D   G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 249 ANILRHKDKAGGY-LIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQKN 307

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     F       +      VKD+ +ALYAS ++S+ QGF V+ K+SE + W L LA
Sbjct: 308 LREAASKQFICQRSQVVYNKPELVKDIYSALYASKLVSYAQGFAVLQKASESFGWDLDLA 367

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K+ +   + +V    + 
Sbjct: 368 SIARMWRGGCIIRSIFLNDIAAAFEAQQKPKHLLLAPYFREEIKELLSGWKHLVAHAMKE 427

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 428 ELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 472


>gi|159039355|ref|YP_001538608.1| 6-phosphogluconate dehydrogenase [Salinispora arenicola CNS-205]
 gi|157918190|gb|ABV99617.1| 6-phosphogluconate dehydrogenase, decarboxylating [Salinispora
           arenicola CNS-205]
          Length = 478

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 284/467 (60%), Gaps = 2/467 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA IG+ GL  MG NL+ N+   G  +AV+N+  E T   + +  G   + + T+++   
Sbjct: 4   QAQIGVTGLAVMGRNLARNLARNGLTVAVHNRSPERTRGLVAE-HGDEGRFVPTESMADF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PR ++MMV  G P D +ID+L PLL   DI++D GN+HF DT+ R   L    +
Sbjct: 63  VAALERPRAVIMMVKAGGPTDAVIDELVPLLDAGDIIVDCGNAHFADTRRREEALRRHDL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+ ++Y ++  I   I+A+    PCC  +GPDG+GHF
Sbjct: 123 HFVGTGVSGGEEGALWGPSIMPGGSAESYRKLGPIFERIAAQVDGEPCCRHIGPDGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR  L+  P E++  F +W++G+L S+LI+ITA++L  
Sbjct: 183 VKMVHNGIEYADMQLIAEAYDLLRAGLDATPAELAETFRQWNSGELESFLIEITADVLGH 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM- 301
           +D  TG   +DV+ D+A QKGTG  ++     L   +T    A FAR+LS + D+ +   
Sbjct: 243 TDASTGQAFVDVVLDQAEQKGTGRWTVQSALDLGIPITGIAEATFARSLSGHADQREATR 302

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           ++F      + +   D+FV+D+  AL AS I+++ QGF  I   S++Y W++ L   A I
Sbjct: 303 RAFAGTGPAWQVADRDTFVEDVRRALLASKIVAYAQGFDHIRAGSQEYDWNIDLGGTATI 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ L+ I ++  + P    LL  P  ++ V+  +P  RR+V    + G P P
Sbjct: 363 WRGGCIIRARFLDRIRQAYDDHPDLPTLLVAPWFADTVRDGVPGWRRVVAEAAQAGVPTP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + +++LSYFD    +R  A LIQ  RD FG+H + R D+    H  W
Sbjct: 423 AFASSLSYFDALRANRLPAALIQGLRDNFGAHTYRRVDRDGSFHTIW 469


>gi|73662553|ref|YP_301334.1| 6-phosphogluconate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495068|dbj|BAE18389.1| 6-phosphogluconate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 469

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 292/465 (62%), Gaps = 5/465 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG++GL  MG NL+ NI  +G+ ++V+N+  E TD  +K+  G  + +  T ++E+ V +
Sbjct: 5   IGVVGLAVMGKNLAWNIESRGYSVSVFNRSSEKTDEMVKESEG--KNIHPTYSIEEFVNS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKIL+MV  G   D  ID L PLL  +DIL+DGGN+++ DT  R+  L+E G+ FI
Sbjct: 63  LEKPRKILLMVKAGPATDATIDSLLPLLDNDDILIDGGNTNYQDTIRRNKALAESGVNFI 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHFVK 184
           G+GVSGG  GA +G SLM GG E A+++V +IL SISAK  + + C A +GP+G+GH+VK
Sbjct: 123 GMGVSGGEVGALTGPSLMPGGQEAAFDKVSDILESISAKADDGAACVAYIGPNGAGHYVK 182

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEYA+MQLIA+ Y +++D L  +  EIS  F  W+ G+LSSYLI+IT +I +  D
Sbjct: 183 MVHNGIEYADMQLIAESYAMMKDLLGMSHEEISQTFKDWNAGELSSYLIEITGDIFTKLD 242

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
                 +++ I D A QKGTG  + I   +L   +TI   ++FAR +S  ++E       
Sbjct: 243 DNADDALVEKILDTAGQKGTGKWTSINALELGIPLTIITESVFARFISSIKEERVNASKQ 302

Query: 305 FN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
            N P++ F     D F++ +  ALY S I S+ QGF  + K+SE   W+L L  +A IWR
Sbjct: 303 LNGPNAKFEGNK-DEFLEKIRKALYMSKICSYAQGFAQMRKASEDNEWNLKLGELAMIWR 361

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+Q L  I ++   D    NLL  P   + V     +LR +V T  +NG P P  
Sbjct: 362 EGCIIRAQFLQKIKEAYDNDTELQNLLLDPYFKDIVTNYQDALRDVVATGVQNGVPTPGF 421

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           SA+++Y+D++  +   ANLIQAQRD+FG+H ++RKD+    H  W
Sbjct: 422 SASINYYDSYRSENLPANLIQAQRDYFGAHTYERKDREGVFHTQW 466


>gi|150005319|ref|YP_001300063.1| 6-phosphogluconate dehydrogenase [Bacteroides vulgatus ATCC 8482]
 gi|294777162|ref|ZP_06742619.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           vulgatus PC510]
 gi|149933743|gb|ABR40441.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides
           vulgatus ATCC 8482]
 gi|294449031|gb|EFG17574.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           vulgatus PC510]
          Length = 478

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 298/465 (64%), Gaps = 8/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYN-----KDFELTDVFIKKISGLSQKVIV 55
           M++ADIG+IGLG MG NL+LN+ +KG+++ V+N     K+  + + FI       + +I 
Sbjct: 1   MEKADIGLIGLGVMGQNLALNLANKGWKVVVWNRTVPGKEENVVEHFIAN-RAKGKGIIG 59

Query: 56  TKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL 115
           +  L   VEA+  PR IL+MV  G  VD+L  KL PL+   DIL+DGGNS++ DT+ R  
Sbjct: 60  SNELTDFVEALKTPRVILLMVQAGPAVDELTGKLFPLMEKGDILIDGGNSYYEDTERRVK 119

Query: 116 QLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALL 174
           +L +KG+YF+G G+SGG +GA  GAS+M GG ++A++ ++ +L SI+AK ++ +PCC  +
Sbjct: 120 ELYDKGMYFVGCGISGGEEGALHGASIMPGGAQEAWSVIQPMLKSIAAKAEDGTPCCEWV 179

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           GP G+GH+VKM+HNGIEY +MQLIA+ Y  ++  L     +++ +F +WD G+L SYLI+
Sbjct: 180 GPGGAGHYVKMVHNGIEYGDMQLIAETYFAMKHLLALKNEQMADIFEQWDKGRLHSYLIE 239

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           IT+ IL   +   G  ++D I D A QKGTG  S+I   +L++ + +   A+FARNLS  
Sbjct: 240 ITSAILRHKEE-GGDYLLDNILDAAGQKGTGRWSVINSLQLNTPLGVIAEAVFARNLSAE 298

Query: 295 RDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           ++    M   +    + P+  +   V  LE+ LYA+ +  + QGF ++  +SE+Y W L+
Sbjct: 299 KNLRVLMSKHYMHVENHPVYNYQDTVIGLESTLYAARLTGYAQGFALMCTASEQYGWKLN 358

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L+TIA +WRAGCIIRS  LNDI ++    P  ++LL       +V + +P+ ++ +    
Sbjct: 359 LSTIALLWRAGCIIRSAFLNDIAEAYHRAPGLSHLLLDEHFGREVMEALPAWKKYIGVML 418

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
             G PVP LSAAL+YF     +R  AN+IQA RD+FG+H F+R D
Sbjct: 419 REGLPVPVLSAALNYFLGLTTNRSPANMIQAMRDYFGAHTFERVD 463


>gi|212716181|ref|ZP_03324309.1| hypothetical protein BIFCAT_01097 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661548|gb|EEB22123.1| hypothetical protein BIFCAT_01097 [Bifidobacterium catenulatum DSM
           16992]
          Length = 487

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/476 (39%), Positives = 292/476 (61%), Gaps = 5/476 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G   +    K LE+ 
Sbjct: 9   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRSYGRTEKLMNE-HGSEGEFFPAKTLEEF 67

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 68  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 127

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 128 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 187

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 188 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 247

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E  +
Sbjct: 248 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAQ 307

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P+    L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 308 KQGFAGPNGELNLNSEEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYGWDIDLAAV 367

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 368 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIETAEKSWRNVVARAALNGL 427

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W +   E
Sbjct: 428 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLWAEPGRE 483


>gi|317507033|ref|ZP_07964798.1| 6-phosphogluconate dehydrogenase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254671|gb|EFV13976.1| 6-phosphogluconate dehydrogenase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 480

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/472 (42%), Positives = 284/472 (60%), Gaps = 4/472 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GLG MG+NL+ N+   G  +A++N+    TD  ++   G     + T+ + + +
Sbjct: 9   AQIGVTGLGVMGANLARNLARHGHTVALHNRSAGRTDALLEA-HGSEGSFVRTETIREFL 67

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ +PR+ L+MV  G   D +I++L   + P DI++DGGNS F DT  R   L E+G++
Sbjct: 68  DALERPRRALIMVQAGAATDAVIEQLAAEMEPGDIIIDGGNSLFTDTIRREASLRERGLH 127

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG  GA  G S+M GG  ++Y  +  +L SISA     PCC  +GPDG+GHFV
Sbjct: 128 FVGMGVSGGEVGALEGPSIMPGGPAESYESLGPLLESISAHVDGVPCCTHIGPDGAGHFV 187

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLIA+ Y +L+D    +  EI+ +F  W+T +L SYLI+ITAE+LS  
Sbjct: 188 KMVHNGIEYSDMQLIAEAYQLLKDVAGLSADEIADIFRGWNTTELESYLIEITAEVLSHK 247

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++    +L   +T    A+FAR LS  R + K    
Sbjct: 248 DPRTGKPLVDVIVDEAEQKGTGRWTVQSALELGVPVTGIAEAVFARALSGSRAQRKAAAG 307

Query: 304 FFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
              PS     K   D FV+D+  AL+AS I+S+ QGF  I   S++Y+W++    +A IW
Sbjct: 308 L--PSGDLAEKPNLDGFVEDVRQALFASKIVSYAQGFDQIKAGSDEYNWNIKPGDLATIW 365

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR+  LNDI ++    P   NLL  P   E V K + S R++V T    G PVP+
Sbjct: 366 RGGCIIRAGFLNDIKQAYDAQPDLPNLLVAPYFEEAVAKALGSWRKVVATAIGLGVPVPA 425

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            S+ L+Y+D     R  A LIQ  RD+FGSH + R D   + H  W    +E
Sbjct: 426 FSSTLAYYDGLRAKRLPAALIQGLRDYFGSHTYARIDDEGKWHTLWSGDGSE 477


>gi|298490512|ref|YP_003720689.1| 6-phosphogluconate dehydrogenase, decarboxylating ['Nostoc azollae'
           0708]
 gi|298232430|gb|ADI63566.1| 6-phosphogluconate dehydrogenase, decarboxylating ['Nostoc azollae'
           0708]
          Length = 476

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/474 (40%), Positives = 293/474 (61%), Gaps = 4/474 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+ + +G  + V+   +LE
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMAQRAG-GRNVVAAFSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DT+ R+ +L   
Sbjct: 60  EFVAALERPRKILVMVQAGKPVDAVIQQLKPLLQEGDIIIDGGNSWFEDTERRTQELEPT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ +IG+GVSGG +GA +G SLM GG + +Y  +  I   I+A+  + PC   +GP GSG
Sbjct: 120 GLRYIGMGVSGGEEGALNGPSLMPGGTKSSYEYLSPIFNKIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKW-DTGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L++    +  ++  +F++W +T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNVAGLSAAQLHEVFTEWNETDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  T  P++D+I D A QKGTG  ++    +L  ++     A+ +R LS  RDE  
Sbjct: 240 FPYVDPETKKPLVDLIIDAAGQKGTGRWTVQTALELGVAIPTITAAVNSRILSSIRDERI 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              +    PS  +  +   SFV  + +ALY S I S+ QG  ++  +S+ Y+W L+L  +
Sbjct: 300 AASKQITGPSGKYTGE-IKSFVNMVRDALYCSKICSYAQGMALLSTASKTYNWDLNLGEM 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  LN I K+  ++P+  NLL  P   + +     + R +++T  + G 
Sbjct: 359 ARIWKGGCIIRAGFLNKIKKAFDQNPALPNLLLAPEFKQTILDRQAAWREVIITAAKLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           PVP+ SA++ YFD++  DR   NL QAQRD+FG+H + R DK    H  W  ++
Sbjct: 419 PVPAFSASVDYFDSYRRDRLPQNLTQAQRDYFGAHTYKRTDKEGTFHTEWVPIA 472


>gi|330469586|ref|YP_004407329.1| 6-phosphogluconate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328812557|gb|AEB46729.1| 6-phosphogluconate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 481

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/466 (40%), Positives = 287/466 (61%), Gaps = 2/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N+   GF +A++N+  E T   + +  G     + T++L   V
Sbjct: 7   AQIGVTGLAVMGRNLARNLARNGFTVALHNRSPERTRSLVAE-HGDEGTFVPTESLADFV 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR +++MV  G P D +ID+L PLL   DI++D GN+HF DT+ R   L   G++
Sbjct: 66  AALERPRAVIIMVKAGGPTDAVIDELVPLLEAGDIIIDCGNAHFADTRRREEALRAHGLH 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG+ ++Y ++  I   I+A+    PCC  +GPDG+GHFV
Sbjct: 126 FVGTGVSGGEEGALWGPSIMPGGSVESYRKLGPIFEKIAAQVDGEPCCQHVGPDGAGHFV 185

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR  L   P E++ +F +W+TG+L S+LI+ITA++L+ +
Sbjct: 186 KMVHNGIEYADMQLIAEAYDLLRAGLGATPSELAEIFREWNTGELESFLIEITADVLAHT 245

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK-KMQ 302
           D  TG   +DV+ D+A QKGTG  ++     L   +T    A FAR+LS +  + +  ++
Sbjct: 246 DAATGEAFVDVVQDRAEQKGTGRWTVQIALDLGIPITGIAEATFARSLSGHVGQREAAVR 305

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
           +F +    + +   ++F++D+  AL AS I+++ QGF  I   S +Y W++ L   ARIW
Sbjct: 306 AFPDSGEKWQVTDREAFIEDVRRALLASKIVAYAQGFDQIRAGSAEYDWNIDLGGTARIW 365

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ L+ I ++  E P    LL  P  ++ V+  +PS RR+V    + G P P+
Sbjct: 366 RGGCIIRARFLDRIKQAYDEQPELPTLLVAPWFADTVRDGVPSWRRVVAEAAQAGVPTPA 425

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            +++L+YFD    +R  A LIQ  RD FG+H + R D+    H  W
Sbjct: 426 FASSLAYFDALRAERLPAALIQGLRDNFGAHTYRRVDRDGSFHTLW 471


>gi|209521521|ref|ZP_03270224.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           H160]
 gi|209498051|gb|EDZ98203.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia sp.
           H160]
          Length = 469

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 293/469 (62%), Gaps = 5/469 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G  ++VYN+    TD  I +     +K++    LE+
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGHAVSVYNRSRTKTDELIAEYP--DRKLVPAFTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++ KPR+ILMMV  G+P D  I  LKPLL   DIL+DGGN+ F DT  R+ +L++ G
Sbjct: 60  FVESLEKPRRILMMVKAGEPTDATIASLKPLLEKGDILIDGGNTPFTDTIRRNQELAKAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           ++FIG GVSGG +GA  G S+M GG   AY+ V  IL  I+AK  +  PC A +GPDG+G
Sbjct: 120 LHFIGTGVSGGEEGALKGPSIMPGGPRDAYDLVAPILTEIAAKAPDGEPCVAYMGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLIA+ Y +L+  +  +  E+  ++++W+ G+L SYLI+IT++I 
Sbjct: 180 HFVKMVHNGIEYGDMQLIAESYAVLKQVVGLSNEELGKVYTEWNQGELDSYLIEITSKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG  ++DVI D+A+QKGTG  +      L + + +   A+FAR LS  + +   
Sbjct: 240 GKKDEETGKDLVDVILDRAAQKGTGKWTSQNALDLGAPLPLITEAVFARVLSSLKTQRVA 299

Query: 301 MQSFFNPSSHFPLK-CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                      PL+   D+F++ +  ALY S ++S+ QGF  +  +SE+Y W L   TIA
Sbjct: 300 ASKVLEGPQARPLEGAKDAFIESVRRALYFSKVISYAQGFAQLRAASEEYKWDLDYGTIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +  +D +  NLL  P   +  K    +LR +VV     G P
Sbjct: 360 KIFRAGCIIRARFLQKITDAYAKDKALANLLLDPYFRDIAKNYQAALREVVVAAVNAGVP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ ++A++YFD +  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 VPAFASAIAYFDAYRSERLPANLVQAQRDFFGAHTFERIDKPGSFHAQW 468


>gi|325970370|ref|YP_004246561.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta sp.
           Buddy]
 gi|324025608|gb|ADY12367.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirochaeta sp.
           Buddy]
          Length = 481

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/457 (43%), Positives = 286/457 (62%), Gaps = 2/457 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+IGL  MG NL LN+  KGF +AVYN+  +  D FI       +++I T +L Q+
Sbjct: 2   KATIGLIGLAVMGENLVLNLESKGFSVAVYNRSIDKVDSFIAG-RAKDKQIIGTHSLRQL 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V++V  PRKI+MMV  G  VD  I+ L PLL   DI++DGGNS++ D+Q R   +  +G+
Sbjct: 61  VDSVASPRKIMMMVKAGQAVDDTIEALLPLLDKGDIIIDGGNSNYEDSQRRMAYVENQGL 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            +IG GVSGG +GA  G S+M GG+ +A+ +V+ IL SISA    +PCC  +G  G+GHF
Sbjct: 121 LYIGTGVSGGEEGALKGPSIMPGGSAQAWEQVKPILQSISAHVDGTPCCDWIGSGGAGHF 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI ++Y ++R  L  +  E+  +F +W+ G+L SYLI+ITA+IL  
Sbjct: 181 VKMVHNGIEYGDMQLIGEVYDLMRRLLKLSNDEMQAVFEEWNKGELDSYLIEITADILGY 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            +   G  ++D I D A QKGTG  + I        +T+   ++FAR++S  ++E     
Sbjct: 241 REE-DGSALVDKILDTAGQKGTGKWTGISALHAGVPLTLIVESVFARSVSSQKEERIAAS 299

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             F      P+   ++FV+ L  ALYA+ I+S+ QGF +I    E+  W L+L  IA +W
Sbjct: 300 KVFGFKPSVPVADKEAFVETLRAALYAAKIISYAQGFSLIKTVGEENKWDLNLGGIALLW 359

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIRS  L+ I ++   DP+  NL+  P  ++ + K   SLR +V     NG P PS
Sbjct: 360 RGGCIIRSAFLDKISQAFITDPALKNLVLDPHFAKILTKAQQSLREVVAAAALNGIPTPS 419

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           L AALS+FD++  +   ANL+QAQRD+FG+H ++R D
Sbjct: 420 LGAALSWFDSYRTENLPANLLQAQRDYFGAHTYERVD 456


>gi|262202665|ref|YP_003273873.1| 6-phosphogluconate dehydrogenase [Gordonia bronchialis DSM 43247]
 gi|262086012|gb|ACY21980.1| 6-phosphogluconate dehydrogenase, decarboxylating [Gordonia
           bronchialis DSM 43247]
          Length = 485

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/468 (40%), Positives = 285/468 (60%), Gaps = 5/468 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MGSN++ N    G+ +A++N+    TD  I+   G     I T+ + + 
Sbjct: 12  RAQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALIENHGG-DGDFIRTETMAEF 70

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PR+ L+MV  GD  D +I++L  ++ P D+++DGGNS + DT  R   +S +G+
Sbjct: 71  VAALERPRRALIMVKAGDATDAVIEELAGVMEPGDVIIDGGNSLYTDTIRREAAMSARGL 130

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHF
Sbjct: 131 NFVGAGISGGEEGALNGPSIMPGGPAESYKSLGPLLEEISAHVDGEPCCTHIGPDGSGHF 190

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y ++R +L+    EI+ +F +W++ +L SYL++ITAE+LS 
Sbjct: 191 VKMVHNGIEYADMQLIGEAYDLMRKALDLPVAEIAEVFRQWNSTELESYLVEITAEVLSQ 250

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D A QKGTG  ++     L    T    A+FAR LS    + +  +
Sbjct: 251 VDAETGKPLVDVIVDAAGQKGTGRWTVKSALDLGIPTTGIAEAVFARALSSSTAQREAAR 310

Query: 303 SFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                + H      D  +F++D+++ALYAS ++++ QGF  I   S +Y W++   ++A 
Sbjct: 311 GL--AAGHLGAAPTDTAAFIEDIKSALYASKVVAYAQGFDQIAAGSAEYGWNVDRGSLAT 368

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+Q LN I ++  +DP   +LL  P   + V+  I S RR+V T T  G PV
Sbjct: 369 IWRGGCIIRAQFLNRIREAYADDPDLPSLLLAPYFRDAVEAGIDSWRRVVATATTLGIPV 428

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+ +++LSY+D    +R  A L Q  RDFFG+H + R DK    H  W
Sbjct: 429 PAFASSLSYYDGLRAERLPAALTQGLRDFFGAHTYQRVDKAGTFHTLW 476


>gi|255008636|ref|ZP_05280762.1| 6-phosphogluconate dehydrogenase [Bacteroides fragilis 3_1_12]
 gi|313146371|ref|ZP_07808564.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides
           fragilis 3_1_12]
 gi|313135138|gb|EFR52498.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides
           fragilis 3_1_12]
          Length = 491

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/465 (43%), Positives = 299/465 (64%), Gaps = 8/465 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  +G+ ++VYN+     +  V  + ++G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESRGWSVSVYNRTVPGVEEGVVERFMNGRAKDKHIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           ++  V ++  PRKI+MMV  G PVD+L+++L P LSP DIL+DGGNS++ DT  R ++L+
Sbjct: 66  IKDFVNSIAVPRKIMMMVRAGSPVDELMEQLFPYLSPGDILIDGGNSNYEDTN-RRVKLA 124

Query: 119 E-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
           E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + SPCC  +GP
Sbjct: 125 ESKGFLFVGAGVSGGEEGALNGASIMPGGSEKAWEEVKPILQSIAAKAPDGSPCCQWVGP 184

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L+    E++ +F++W+ GKL SYLI+IT
Sbjct: 185 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKELLDMTNEEMASVFTRWNEGKLRSYLIEIT 244

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
             IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  ++
Sbjct: 245 GNILRHKDN-TGAYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQKE 303

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     +       +       K++  ALYAS ++S+ QGF V+ ++S+ + W+L LA
Sbjct: 304 LRETAARQYQCKHSMAVYNKQDTEKEIFAALYASKLVSYAQGFAVLQRASDAFGWNLDLA 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   +++K  +   + +V      
Sbjct: 364 SIARMWRGGCIIRSIFLNDIAAAFEAKEKPEHLLLAPYFEQEIKGLLSGWKNLVAQAMRE 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF + +     ANLIQAQRD+FG+H F+RKD++
Sbjct: 424 ELPVPAFSSALNYFYSLVSADLPANLIQAQRDYFGAHTFERKDEL 468


>gi|77918533|ref|YP_356348.1| 6-phosphogluconate dehydrogenase [Pelobacter carbinolicus DSM 2380]
 gi|77544616|gb|ABA88178.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Pelobacter
           carbinolicus DSM 2380]
          Length = 480

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/460 (41%), Positives = 284/460 (61%), Gaps = 2/460 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +ADIG++GL  MG NL+LN+ D G+R+AVYN+    T+ F+         ++   +  
Sbjct: 1   MNKADIGLVGLAVMGQNLALNLQDHGYRVAVYNRTTARTEEFLAGPEA-DNTLVGCYSPA 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +  ++ +PR IL+MV  G  VD  ++ L P L   DI++DGGNSH  DT+ R   L+E+
Sbjct: 60  DLAASLSRPRVILLMVKAGQAVDDTLELLHPYLDAGDIVIDGGNSHPDDTRRRVAALAER 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
            + F+G G+SGG +GAR G SLM GGN  A+  +  IL +I+A+  + PCC  +GPDG+G
Sbjct: 120 NLLFVGCGISGGEEGARRGPSLMPGGNALAWPHIRPILEAIAARVGDQPCCRWIGPDGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY ++QLI + Y +LR  L      ++ LF +W+ G L+SYLI+ITA IL
Sbjct: 180 HFVKMVHNGIEYGDLQLIGEAYQLLRFGLEMPADRLAALFDRWNHGPLNSYLIEITARIL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           S  D   G+P+ID I D A QKGTG  + +E  KL + +T    A+ AR LS  R+E   
Sbjct: 240 SVRDA-EGLPLIDSILDTAGQKGTGRWTSVEALKLGTPLTAINEAVCARYLSARREERVM 298

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
             +     +    K  D  ++ + +ALYA+ I+S+ QGF ++  +++ + W L    IA 
Sbjct: 299 ASNRLATDARPAGKADDHSIQAVHDALYAAKIISYAQGFMLLKDAAKAFDWDLDFEGIAL 358

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIRS  LNDI  +  +D    NLL  P  + +++KT    R+ V+   + G P+
Sbjct: 359 IWRGGCIIRSVFLNDIAAAYRDDGGLENLLLAPFFTGQLRKTDTGWRQAVILGVKLGIPL 418

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           P LS+AL++FD +   R  ANL+QAQRD+FG+H ++R D+
Sbjct: 419 PGLSSALAFFDGYRCSRLPANLLQAQRDYFGAHTYERTDR 458


>gi|257067985|ref|YP_003154240.1| 6-phosphogluconate dehydrogenase [Brachybacterium faecium DSM 4810]
 gi|256558803|gb|ACU84650.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Brachybacterium
           faecium DSM 4810]
          Length = 486

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/477 (40%), Positives = 291/477 (61%), Gaps = 10/477 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ G+  MGSNL+ N+   GF++AV+N+    T+  I +  G   +   ++++   V
Sbjct: 12  ADIGVTGMAVMGSNLARNLARNGFKVAVHNRSVGKTETVIAE-HGSDGEFYPSESMADFV 70

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR  ++MV  G P D +ID+L  L+   DI++D GN+ F DT+ R   L EKG++
Sbjct: 71  ASLQKPRVAIIMVKAGGPTDAVIDELAGLMDSGDIIVDAGNALFTDTRRREAALREKGLH 130

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG +++Y+R+  +   ISA     PCC  +G DG+GHFV
Sbjct: 131 FVGAGVSGGEEGALNGPSIMPGGTKESYDRLGPMFEKISAHVDGVPCCTHVGADGAGHFV 190

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I++ Y ++  +L     EI  +F++W+ G L S+LI+ITAE+L  +
Sbjct: 191 KMVHNGIEYADMQVISEAYDLMSKALGMGASEIGDVFAEWNKGDLESFLIEITAEVLHHT 250

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDESKK 300
           D+ TG P +DVI D+A+QKGTG  ++     L   +T    A FAR+ S     R+  +K
Sbjct: 251 DSTTGKPFVDVILDQAAQKGTGAWTVQTALDLGVPVTGIAEATFARSTSGSTPQREAGRK 310

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           +     P+    L+  D   F+ DL+ ALYA+ ++S++QGF  I   +E+Y W + L  +
Sbjct: 311 VL----PAEAEALEIADRAQFIDDLQKALYAAKLVSYSQGFDEIAAGAEEYDWDIDLGAM 366

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++   D     LL     + ++ K IP+ RRIV     +GY
Sbjct: 367 ARIWRGGCIIRARFLNRITEAYERDAKLPLLLADDYFTTEIAKCIPAWRRIVAFAAASGY 426

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           PVP  S+ LSY+D    +R  A L+QAQRD+FG+H + R D     H  W +   E+
Sbjct: 427 PVPVFSSTLSYYDAVRAERLPAALVQAQRDYFGAHTYQRVDAEGTFHVEWTQDRRET 483


>gi|310287963|ref|YP_003939222.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum S17]
 gi|309251900|gb|ADO53648.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum S17]
          Length = 482

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/477 (39%), Positives = 293/477 (61%), Gaps = 7/477 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG++L+ N+   G ++AV+N+ +  T+  I +  G   +    K +E+ 
Sbjct: 4   EANVGVVGLAAMGASLARNLARHGNKVAVFNRHYSRTEKLITE-HGSEGEFFPAKTMEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ KPR  ++MV  G+P D +ID+L  L+ P DI++D GN+HF DT  R   +S +G+
Sbjct: 63  VASLKKPRTAIIMVKAGEPTDAMIDQLADLMEPGDIIVDAGNAHFPDTIRREKAISARGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 123 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGENGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLI++ Y ++R +L   P EI  +F +W+  +L SYLI+ITA++L  
Sbjct: 183 VKMVHNGIEYSDMQLISESYDLMRRALGMTPAEIGDVFEEWNKTELESYLIEITADVLHQ 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDESK 299
            D  TG P++DVI D A  KGTG  ++     L+  +T    A+FAR LS     R E++
Sbjct: 243 VDKKTGKPLVDVIVDHAGMKGTGTWTVQSALDLAVPVTGIAEAVFARGLSGQAELRAEAQ 302

Query: 300 KMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           K Q F  PS   P+   D  +F+ D+  ALYAS I+++ QGF  I ++++ Y W + LA 
Sbjct: 303 K-QDFEGPSGVVPMAEEDKVAFINDIREALYASKIVAYAQGFNEITEAAKVYDWKIDLAA 361

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIWR GCIIR++ LN I  +     ++ +LL  P   + ++    S RR+V      G
Sbjct: 362 VARIWRGGCIIRAKFLNRISDAFENGEANVSLLFAPYFKDAIETAERSWRRVVSRAITFG 421

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            PVP  +++L YFD     R  A LIQ QRD+FG+H + R D     H  W +   E
Sbjct: 422 IPVPVFASSLEYFDGLRSPRLPAALIQGQRDYFGAHTYQRTDMPGAFHTLWAEPGRE 478


>gi|172062833|ref|YP_001810484.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria MC40-6]
 gi|171995350|gb|ACB66268.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           ambifaria MC40-6]
          Length = 470

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 294/473 (62%), Gaps = 12/473 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG+IGL  MG NL+LNI  +G  ++VYN+    TD  I +  G  + ++ T  LE+
Sbjct: 3   KQA-IGVIGLAVMGRNLALNIESRGHAVSVYNRSRAKTDELIAEFPG--RNLVPTYTLEE 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+ILMMV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTHFTDTIRRNQELAQSG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPSDGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+D       E+  ++++W+ G+L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKDVAGLTNDELGAVYTEWNQGELDSYLIEITSKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  T   ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + E  
Sbjct: 240 FGKKDDATSKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTERV 299

Query: 300 KMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                 +  +  P   FD    +F++ +  ALY S ++S+ QGF  +  +SE+Y WSL L
Sbjct: 300 AASKILSGPAAAP---FDGDRAAFIEAVRRALYLSKVISYAQGFAQLRTASEEYGWSLDL 356

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+I+RAGCIIR++ L  I  +  +DP+  NLL  P   +       SLR +VV   +
Sbjct: 357 GTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDIAANYQASLRDVVVAAVK 416

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVP+ ++A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 417 AGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|297243041|ref|ZP_06926979.1| 6-phosphogluconate dehydrogenase [Gardnerella vaginalis AMD]
 gi|296889252|gb|EFH27986.1| 6-phosphogluconate dehydrogenase [Gardnerella vaginalis AMD]
          Length = 484

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/472 (39%), Positives = 293/472 (62%), Gaps = 5/472 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA+IG++GL +MGSNL+ N+   G  +AVYN+ +  T+  + +  G     + +K +E+ 
Sbjct: 5   QANIGVVGLAAMGSNLARNLAHHGNTVAVYNRHYSRTETLMNE-HGSEGAFVPSKTVEEF 63

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ +PR  ++MV  G P D +I++L   + P DI++DGGNS+F DT  R   +  +G+
Sbjct: 64  VASLKRPRTAIIMVKAGAPTDAVIEELANAMEPGDIIVDGGNSYFEDTIRRERDIRARGL 123

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +++G GVSGG +GA  G S+M GG E+++  +  IL SI+A  +  PC   +G DG+GHF
Sbjct: 124 HYVGCGVSGGEEGALRGPSMMPGGTEESWKTLGPILKSIAAVAEGEPCVTHIGTDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++   L     EI+ +FS+W+ G+L SYLI+ITA++L  
Sbjct: 184 VKMVHNGIEYSDMQLIAESYDLMLRGLGMKSDEIADVFSEWNKGELDSYLIEITADVLRQ 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--LYRDESKK 300
            D  TG P+++++ D A  KGTG  ++     L   +T    A+FAR LS  +   E+ +
Sbjct: 244 KDAKTGKPLVEMMVDHAGMKGTGTWTVQSALSLGIPVTGIAEAVFARGLSSQVALREAAE 303

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q    P  HF L   +  +F++D+  ALYAS I+S+ QGF  I  ++ ++ W +  A +
Sbjct: 304 SQGLTGPDVHFDLSDAERKAFIEDIRQALYASKIVSYAQGFDEIAAAAIEHDWKIDQAAV 363

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR+Q LN + ++     +S +LL  P   + ++K+  + RR++    E+G 
Sbjct: 364 ARIWRGGCIIRAQFLNRVSEAFESGEASVSLLFAPYFKDAIEKSQAAWRRVIARAVEHGV 423

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ S+ L+Y+D     R  A+LIQAQRDFFG+H + R D+    H  W +
Sbjct: 424 PVPAFSSLLAYYDGLRSKRLPASLIQAQRDFFGAHTYGRIDEPGVFHTLWAE 475


>gi|160940001|ref|ZP_02087346.1| hypothetical protein CLOBOL_04890 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436581|gb|EDP14348.1| hypothetical protein CLOBOL_04890 [Clostridium bolteae ATCC
           BAA-613]
          Length = 474

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/471 (42%), Positives = 295/471 (62%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + DIGI+GL  MG +L+LN+ D GF++  YN+   +T+  ++      + +I   +L+
Sbjct: 1   MIKLDIGIVGLSVMGRSLALNMADHGFKVGGYNRSAAVTEQVMRDHP--HENLIPFYDLK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            M +A+ +PRK+++M+  G PVD +I++L PLL   D++LDGGNS F DT+ R+  L+EK
Sbjct: 59  DMTDALARPRKVMLMIQAGKPVDAVIEQLVPLLEKGDMILDGGNSFFEDTRRRAALLAEK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+++G+G+SGG +GAR G S+M GGN  AY  V  IL +I+A+  + PCCA +GPDG+G
Sbjct: 119 GIHYLGVGISGGEEGARFGPSVMPGGNADAYESVRPILEAIAARAMDEPCCAYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLIA+ Y +L+     N  E++H+F  W+ G+L SYLI ITA I 
Sbjct: 179 HYVKMVHNGIEYADMQLIAESYLLLKYVGGFNNQELAHIFKSWNDGELHSYLIGITAGIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
             +D +    +ID I D A QKGTG  + IE  K    +++  +A  AR +S + DE +K
Sbjct: 239 READDLGDGELIDRIKDSAKQKGTGRWASIEALKQGVDISMITSACTARIMSNHLDEREK 298

Query: 301 M-QSFFNPSSHF-PLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
             Q   +P+    P K  +SF   +  ALY   I+++ QGF ++  +S  Y W+L L  I
Sbjct: 299 AWQLIHSPAVGLSPDK--ESFAAMVREALYTGKIIAYAQGFSLMQDASRLYGWNLDLGKI 356

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A I+RAGCII++  LNDI  +   +P   NL+       ++ +   SLR+ V T   NG 
Sbjct: 357 ASIFRAGCIIQAVFLNDITHAFEAEPKPENLIFDGFFLSRINEHQDSLRQAVSTGVMNGL 416

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           P+P+L  A+SY D F      ANLIQAQRD FG+H ++R D+    H  W+
Sbjct: 417 PIPALCNAVSYLDEFRAKAAGANLIQAQRDCFGAHTYERTDREGVFHHEWR 467


>gi|297569207|ref|YP_003690551.1| 6-phosphogluconate dehydrogenase, decarboxylating [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925122|gb|ADH85932.1| 6-phosphogluconate dehydrogenase, decarboxylating [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 485

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/459 (41%), Positives = 291/459 (63%), Gaps = 4/459 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QADIG+IGL  MG NL LN+ D G+++AVYN+     D F+   +     +I T +LE++
Sbjct: 6   QADIGLIGLAVMGQNLVLNMHDHGYKVAVYNRTTARVDEFLAGPAA-GTGIIGTHSLEEL 64

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
              + +PRK+++MV  G  VD  I++L P L P D+++DGGNS + D+  R+  L+ KGI
Sbjct: 65  SVVLQRPRKVMLMVKAGAVVDSFIEQLLPHLEPGDVIIDGGNSLYTDSNRRTRDLAAKGI 124

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G G+SGG +GAR G S+M GGN  A+  V++I  +I+A+    PCC  +G +G+GHF
Sbjct: 125 LFVGTGISGGEEGARRGPSIMPGGNPAAWPLVKDIFQNIAARVGGEPCCDWVGEEGAGHF 184

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM HNGIEY +MQLI + Y  LR  L     EI+ +FS W+ G L SYL++I++EIL  
Sbjct: 185 VKMAHNGIEYGDMQLICEAYDFLRRGLGLPAGEIADVFSAWNRGVLESYLMEISSEILGY 244

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D+  G P++D I D A QKGTG  + I   ++   +++   A+FAR LS  ++E ++  
Sbjct: 245 QDS-DGAPLVDRILDAAGQKGTGKWTGINALEMGVPLSLITEAVFARFLSAMKEERERAA 303

Query: 303 SFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           +    P + F  +    +V+ L++ALYA+ I+S+ QG+ ++  ++ ++ W L+   IAR+
Sbjct: 304 AVLRGPEAVFAGE-IQQYVQALQDALYAAKIVSYAQGYLLMRAAAREHGWHLNYGGIARM 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIRS  L++I ++   DP   NLL     ++ + +     RR+V    E G PVP
Sbjct: 363 WRGGCIIRSVFLDNIAQAFDADPDLDNLLLADFFADALAQAQAGWRRVVARAAELGLPVP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           +LS+ALS++D +     +ANL+QAQRD+FG+H ++R D+
Sbjct: 423 ALSSALSFYDGYRSAVLSANLLQAQRDYFGAHTYERVDR 461


>gi|171743259|ref|ZP_02919066.1| hypothetical protein BIFDEN_02388 [Bifidobacterium dentium ATCC
           27678]
 gi|283455765|ref|YP_003360329.1| 6-phosphogluconate dehydrogenase [Bifidobacterium dentium Bd1]
 gi|171278873|gb|EDT46534.1| hypothetical protein BIFDEN_02388 [Bifidobacterium dentium ATCC
           27678]
 gi|283102399|gb|ADB09505.1| Gnt 6-phosphogluconate dehydrogenase [Bifidobacterium dentium Bd1]
          Length = 482

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/470 (39%), Positives = 290/470 (61%), Gaps = 5/470 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G   +    K LE+ 
Sbjct: 4   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRSYGRTEKLMNE-HGTEGEFYPAKTLEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 63  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 123 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 183 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E  +
Sbjct: 243 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAQ 302

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P+    L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 303 KQGFAGPNGELDLNDEEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYDWDIDLAAV 362

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 363 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIEAAECSWRNVVAEAARNGL 422

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W
Sbjct: 423 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLW 472


>gi|289706134|ref|ZP_06502505.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micrococcus
           luteus SK58]
 gi|289557167|gb|EFD50487.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micrococcus
           luteus SK58]
          Length = 520

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/488 (40%), Positives = 302/488 (61%), Gaps = 18/488 (3%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GL  MG+NL+ N    G+ +A++N+    TD  + +  G     + T+ L ++V
Sbjct: 13  ADIGVTGLAVMGANLARNFARHGYTVALHNRSRARTDQLVAE-HGDEGAFVATETLAELV 71

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++  PR++L+MV  G PVD +ID+L PLL   DI++D GNSH+ DT+ R   L+EKG++
Sbjct: 72  QSLAVPRRVLIMVKAGAPVDAVIDQLVPLLEEGDIVIDAGNSHYEDTRRREAALAEKGLH 131

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG +GA  G ++M GG EK+Y  +  +L  ISA+++  PCCA +G DG+GH+V
Sbjct: 132 FVGVGVSGGEEGALHGPAIMPGGPEKSYEALGPMLEKISAQFEGEPCCAWVGTDGAGHYV 191

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P E + +F+ W+   L+SYLI+ITAE+L+  
Sbjct: 192 KMVHNGIEYADMQVIGEAYDLLRRVGGLEPAEQAEVFTAWNQTDLASYLIEITAEVLAQV 251

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD----ESK 299
           D  TG P++DVI D+A QKGTG  + I G  + S +     ++FAR+LS  R       +
Sbjct: 252 DAATGRPLVDVIVDEAGQKGTGRWTAISGLDVGSPVAAIAESVFARSLSSQRAVREVARE 311

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            + +  +  +    +  D+FV+D+  AL+AS ++++ QG  ++  ++E+Y WSL L TIA
Sbjct: 312 TLAAGVDEEAQRAPQDTDTFVEDVRQALFASKLVAYAQGMDMLAAAAEEYGWSLDLGTIA 371

Query: 360 RIWRAGCIIRSQILNDIVKSL------------TEDPSST-NLLNIPSISEKVKKTIPSL 406
            +WR GCIIR+ +L+ I+++             T  P    NLL  P  ++ + + +P+ 
Sbjct: 372 SLWRDGCIIRADLLDVIMQAFGGRDTSRHPAPGTRAPGQPLNLLFAPEFAQAIAEALPAW 431

Query: 407 RRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           RR+V T    G PVP  S+AL+Y+D    DR  A L+Q QRDFFG+H + R D+    H 
Sbjct: 432 RRVVGTAVAAGVPVPVFSSALAYYDGLRADRLPAALVQGQRDFFGAHTYLRVDREGSFHT 491

Query: 467 PWQKVSTE 474
            W    TE
Sbjct: 492 LWSGDRTE 499


>gi|119512001|ref|ZP_01631097.1| 6-phosphogluconate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119463352|gb|EAW44293.1| 6-phosphogluconate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 476

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/475 (41%), Positives = 293/475 (61%), Gaps = 6/475 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-KKISGLSQKVIVTKNL 59
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+ ++  G + K   T  L
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMAQRAPGRNVKAAFT--L 58

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E+ V ++ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DT+ R+ +L  
Sbjct: 59  EEFVASLERPRKILVMVQAGKPVDAVIAQLKPLLDEGDIIIDGGNSWFEDTERRTQELEP 118

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGS 179
            G+ F+G+GVSGG +GA +G SLM GG   +Y  +  I   I+A+  + PC   +GP GS
Sbjct: 119 AGLRFLGMGVSGGEEGALNGPSLMPGGTPSSYEYLSPIFNKIAAQVDDGPCVTYIGPGGS 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAE 238
           GH+VKM+HNGIEY +MQLIA+ Y +L++    N  ++  +F++W+ T +L+S+LI+IT+ 
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAEAYDLLKNVAGLNATQLHEVFTQWNTTDELNSFLIEITSN 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  T  P++D+I D A QKGTG  ++    +L  ++     A+ AR +S  +DE 
Sbjct: 239 IFPYVDPETKKPLVDLIVDAAGQKGTGRWTVQTALELGVAIPTITAAVNARIMSSIKDER 298

Query: 299 -KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
               QS   PS+ F     D F+  + +ALY S I S+ QG  ++  +S+ Y+W L+L+ 
Sbjct: 299 VAASQSLTGPSAKFDGDVKD-FINKVRDALYCSKICSYAQGMALLYTASKTYNWDLNLSE 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIW+ GCIIR+  LN I K+  E+P+  NLL  P   + +     + R +++T  + G
Sbjct: 358 MARIWKGGCIIRAGFLNKIKKAFNENPALPNLLLAPEFKQTILDRQDAWREVIMTAAKVG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
            PVP+ SA+L YFD++  DR   NL QAQRD+FG+H + R DK    H  W  ++
Sbjct: 418 IPVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYKRLDKEGTFHTEWVPIA 472


>gi|306823195|ref|ZP_07456571.1| 6-phosphogluconate dehydrogenase [Bifidobacterium dentium ATCC
           27679]
 gi|309801600|ref|ZP_07695721.1| phosphogluconate dehydrogenase (decarboxylating) [Bifidobacterium
           dentium JCVIHMP022]
 gi|304553827|gb|EFM41738.1| 6-phosphogluconate dehydrogenase [Bifidobacterium dentium ATCC
           27679]
 gi|308221732|gb|EFO78023.1| phosphogluconate dehydrogenase (decarboxylating) [Bifidobacterium
           dentium JCVIHMP022]
          Length = 482

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/470 (39%), Positives = 290/470 (61%), Gaps = 5/470 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G   +    K LE+ 
Sbjct: 4   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRSYGRTEKLMNE-HGTEGEFYPAKTLEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 63  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 123 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 183 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E  +
Sbjct: 243 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAQ 302

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P+    L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 303 KQGFAGPNGELDLNDEEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYDWDIDLAAV 362

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 363 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIEAAECSWRNVVAEAARNGL 422

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W
Sbjct: 423 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQSGAFHTLW 472


>gi|302869283|ref|YP_003837920.1| 6-phosphogluconate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315504242|ref|YP_004083129.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micromonospora
           sp. L5]
 gi|302572142|gb|ADL48344.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micromonospora
           aurantiaca ATCC 27029]
 gi|315410861|gb|ADU08978.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micromonospora
           sp. L5]
          Length = 480

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/472 (39%), Positives = 283/472 (59%), Gaps = 2/472 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N+   GF +AV+N+  E T   + +  G     + +++L   V
Sbjct: 7   AQIGVTGLAVMGRNLARNLARNGFAVAVHNRSPERTRSLVAE-HGDEGTFVPSESLADFV 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PR +++MV  G P D +ID+L PLL   DI++D GN+HF DT+ R   L   G++
Sbjct: 66  GSLERPRAVIVMVKAGAPTDAVIDELVPLLEEGDIVVDCGNAHFADTRRREEALRAHGLH 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG+ ++Y ++  I   I+A+    PCC  +GPDG+GHFV
Sbjct: 126 FVGTGVSGGEEGALLGPSIMPGGSAESYRKLGPIFEKIAAQVDGEPCCRHIGPDGAGHFV 185

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR  L+ +P EI+ +F +W+ G+L S+LI+ITA++L  +
Sbjct: 186 KMVHNGIEYADMQLIAEAYDLLRAGLSASPAEIAEIFREWNGGELGSFLIEITADVLGHT 245

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG   +D++ D+A QKGTG  ++     L   +T    A FAR+LS + D+ +  + 
Sbjct: 246 DAATGQAFVDIVLDQAEQKGTGRWTVQSALDLGIPITGIAEATFARSLSGHADQREAARR 305

Query: 304 FF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
            F +    + +   D+FV+D+  AL AS I+++ QGF  I   S +Y W + L   A IW
Sbjct: 306 VFADAGEKWQVDDRDAFVEDVRRALLASKIVAYAQGFDHIRAGSREYDWDIDLGGTATIW 365

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR+  L+ I ++   +P  + LL  P  +E+V   +P+ RR+V      G P P+
Sbjct: 366 RGGCIIRAGFLDRIREAYDAEPDLSTLLVAPWFAERVSDGVPAWRRVVADAARAGVPAPA 425

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             ++L+YFD     R  A LIQ  RD FG+H + R D+    H  W    +E
Sbjct: 426 FGSSLAYFDALRAQRLPAALIQGLRDDFGAHTYHRVDRAGSFHTLWAGDRSE 477


>gi|229544109|ref|ZP_04433168.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus
           coagulans 36D1]
 gi|229325248|gb|EEN90924.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus
           coagulans 36D1]
          Length = 470

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 288/470 (61%), Gaps = 5/470 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++  IG+IGL  MG NL+ NI  KG+ ++V+N+    T+  +K+  G  + +     +E
Sbjct: 1   MEKQQIGVIGLAVMGKNLAWNIESKGYTVSVFNRSRSKTEQMLKESEG--KNIFGYFTME 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPRKIL+MV  G+  D  I++LKP L   DIL+DGGN+ F DTQ R+ +LS  
Sbjct: 59  EFVHSLEKPRKILLMVKAGEATDATIEQLKPFLDKGDILIDGGNTFFKDTQRRNKELSAL 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++AY+ V  IL  I+AK    PC   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAYDLVAPILKDIAAKVNGDPCTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +M+LI++ Y +L++ L     E+  +F+ W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMELISESYNLLKNILGLTADELHEVFADWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI D A QKGTG  +      L   + +   ++FAR +S  ++E K 
Sbjct: 239 TKKDPETGKPLVDVILDTAGQKGTGKWTSQSALDLGVPLPLITESVFARFISAMKEERKA 298

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                      P    D  +F++ +  ALY S I S+ QGF  +  +SE+Y+W L+   I
Sbjct: 299 ASKLLKGPEK-PAFSGDKKAFIEAVRKALYMSKICSYAQGFAQMRAASEEYNWDLNYGEI 357

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A I+R GCIIR+Q L  I  +   D +  NLL  P   E V+    +LR ++ T    G 
Sbjct: 358 AMIFRGGCIIRAQFLQKIKDAYDRDRNLKNLLLDPYFKEIVESYQDALREVIATAVRFGV 417

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+LSAAL+Y+D++  +   ANL+QAQRD+FG+H + R DK    H  W
Sbjct: 418 PVPALSAALAYYDSYRSEVLPANLLQAQRDYFGAHTYQRVDKEGIFHTEW 467


>gi|332799691|ref|YP_004461190.1| 6-phosphogluconate dehydrogenase [Tepidanaerobacter sp. Re1]
 gi|332697426|gb|AEE91883.1| 6-phosphogluconate dehydrogenase, decarboxylating
           [Tepidanaerobacter sp. Re1]
          Length = 470

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/471 (43%), Positives = 311/471 (66%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M ++DIG+IGL  MG NL+LNI   G++++VYN+  E T  F++  +    ++    +LE
Sbjct: 1   MNKSDIGLIGLAVMGQNLALNIERNGYQISVYNRTAEKTKEFLETSAKGRSRIKGVFSLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V ++ KPRKI++MV  G  VD +I +L PL+   DIL+DGGNS+F DT  R+ +L +K
Sbjct: 61  ELVASLKKPRKIMLMVKAGTAVDAVIHQLVPLMEKGDILIDGGNSYFKDTVRRARELEQK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQ-NSPCCALLGPDGS 179
           GI+++G+GVSGG +GA  G S+M GG+++A+ ++ +I + ISAK    + CC  +GPDG+
Sbjct: 121 GIHYMGVGVSGGEEGALKGPSIMPGGSKEAWEQISDIFIKISAKTPGGAACCDYVGPDGA 180

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM HNGIEY++MQLI++ Y ++++ L    LE+  +F++W+ G+L+SYLI+ITA+I
Sbjct: 181 GHFVKMTHNGIEYSDMQLISEAYFLMKELLGMTALEMKEIFAEWNQGELNSYLIEITADI 240

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSM-TITETAIFARNLSLYRDES 298
           L   D  TG P++DVI DKA QKGTG  +  E   +   + TITE A+FAR +S  ++E 
Sbjct: 241 LGKVDDKTGKPLVDVILDKAGQKGTGKWTSQEALDIGVCIPTITE-AVFARYMSSAKEER 299

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +       PS+ F       F++D+  ALYAS I S+ QGF ++ K+S+ Y+W L+L  
Sbjct: 300 VEASKILKGPSTSFKGD-RKQFLEDIRKALYASKICSYAQGFDLMAKASDIYNWDLNLGN 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA +WR GCIIR+Q L  I ++  E+    NL+  P  ++ ++    + R +V T   NG
Sbjct: 359 IALLWRGGCIIRAQFLEKIKQTYDENLQLKNLMLAPYFNQSIENCQAAWRSVVSTAALNG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R D+    H  W
Sbjct: 419 IPVPSFSSALAYYDSYRRHTLPANLIQAQRDYFGAHTYERIDEEGIFHTIW 469


>gi|222151404|ref|YP_002560560.1| 6-phosphogluconate dehydrogenase [Macrococcus caseolyticus
           JCSC5402]
 gi|222120529|dbj|BAH17864.1| 6-phosphogluconate dehydrogenase [Macrococcus caseolyticus
           JCSC5402]
          Length = 467

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 206/471 (43%), Positives = 296/471 (62%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+ NI  +G  ++VYN+  + TD+ +K+ +G  + +  T  LE
Sbjct: 1   MSKQQIGVIGLAVMGKNLAWNIESRGNSVSVYNRSSDKTDLMMKESAG--KNIHPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKI+MMV  G   D  I+ L PLL   DIL+DGGN+++ DT  R++ LSEK
Sbjct: 59  EFVNSLETPRKIMMMVKAGQATDATIESLLPLLDKGDILIDGGNTNYNDTIRRNVYLSEK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V+ IL SI+AK ++  PC A +GPDG+
Sbjct: 119 GINFIGTGVSGGEEGALHGPSIMPGGQKEAYELVKPILESIAAKAKDGKPCVAYIGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEYA+MQLIA+ Y ++++ LN +  EI+  F  W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYADMQLIAESYDLMKNVLNMSHQEIAETFKTWNEGELDSYLIEITADI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            +  D   G P+++ + DKA QKGTG  + I    L   +TI   ++FAR +S  +DE  
Sbjct: 239 FNKLDE-DGTPLVEKVLDKAGQKGTGKWTSINALDLGVPLTIITESVFARTISSQKDERV 297

Query: 300 -KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              ++  N  ++F     D F++ +  ALY S I  + QGF  + ++S  Y+W L L  +
Sbjct: 298 IAHEAIQNEKNNFEGNK-DEFLEAIREALYMSKICCYAQGFAQMKEASASYNWDLQLGDL 356

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A IWR GCIIR+Q L  I  +   D    NLL  P     V+K   SLR++  T    G 
Sbjct: 357 AMIWREGCIIRAQFLQKIKDAYDLDNDLQNLLLDPYFKGIVEKYQQSLRKVASTAILTGT 416

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           PVP+ ++A++YFD++      ANLIQAQRD+FG+H ++RKDK    H  W+
Sbjct: 417 PVPTFASAINYFDSYTAKDLPANLIQAQRDYFGAHTYERKDKAGTFHTDWK 467


>gi|333031318|ref|ZP_08459379.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           coprosuis DSM 18011]
 gi|332741915|gb|EGJ72397.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           coprosuis DSM 18011]
          Length = 489

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/477 (42%), Positives = 300/477 (62%), Gaps = 23/477 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK-----DFELTDVFI------KKISGLS 50
           K+ DIG+IGL  MG NL+LN+  +G+ ++VYN+     +  + D F+      K I G +
Sbjct: 3   KKTDIGLIGLAVMGENLALNMESRGWNVSVYNRTVPGIEEGVVDRFVAGRAKGKNIQGYT 62

Query: 51  QKVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDT 110
           +       +   V ++  PRKI+MMV  G PVDQL+++L P LS  DIL+DGGNS+F DT
Sbjct: 63  E-------IADFVASIKAPRKIMMMVRAGSPVDQLMEQLFPHLSTGDILIDGGNSNFEDT 115

Query: 111 QIRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-P 169
           + R      KG  F+G GVSGG +GA +GA++M GG + A+  V+ +L SI+AK ++  P
Sbjct: 116 ERRVKLAESKGFRFVGAGVSGGEEGALNGAAIMPGGTKSAWEEVKPVLQSIAAKAKDGMP 175

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLI++ Y +LR+ L  +  E+S +FSKW+ G+LS
Sbjct: 176 CCDWVGPGGSGHFVKMIHNGIEYGDMQLISESYWVLRNLLGLSNEELSKVFSKWNEGRLS 235

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D   G  +ID I D A QKGTG  S+I   +L   + +  +A+F R
Sbjct: 236 SYLIEITANILKHKDK-DGEYLIDKILDTAGQKGTGKWSVINAMELGMPLGLIASAVFER 294

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  ++   +    F+      L      ++D+E+ALYAS ++S+ QGF V+ K+S+++
Sbjct: 295 SLSSNKEVRVEASKLFHEDKEKSLYNKADMIEDVESALYASKLVSYAQGFAVLQKASDEF 354

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
           +W L+LA+IAR+WR GCIIRS  LNDI  +   +    +LL  P    ++++ +   + +
Sbjct: 355 NWDLNLASIARMWREGCIIRSVFLNDIAAAFEAEDKPKHLLFAPYFKAEIEQMLFGWKHL 414

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           V    +   P+P+ S+AL+YF +       AN+IQAQRD+FG+H F+R D   +P G
Sbjct: 415 VSHALKEEMPIPAFSSALNYFYSLTSSSLPANMIQAQRDYFGAHTFERVD---QPRG 468


>gi|86605650|ref|YP_474413.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. JA-3-3Ab]
 gi|86554192|gb|ABC99150.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. JA-3-3Ab]
          Length = 469

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 288/469 (61%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +    +IGL  MG NL+LN+   GF + VYN+    T+ FI+      +++    +L 
Sbjct: 1   MSKPSFAVIGLAVMGENLALNVERNGFPVVVYNRTRAKTEQFIQG-RAQGKQITPAYSLP 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V+ + +PRKIL+MV  G PVD +ID+LKPLL P DIL+DGGNS + DT  R+  L   
Sbjct: 60  ELVQLMERPRKILIMVKAGPPVDAIIDELKPLLEPGDILIDGGNSLYSDTDRRAEVLEAS 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+F+G+GVSGG +GA +G SLM GG+ +AY ++E IL  I+A+  + PC   LGP G G
Sbjct: 120 GIHFVGMGVSGGEEGALNGPSLMPGGSLEAYRQLEPILTKIAAQVPDGPCVTYLGPKGGG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y ++R  L  +  ++  +F  W+  +L S+LI+ITA+IL
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLMRRGLKLSAPQMQEIFQAWNETELESFLIEITAKIL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-K 299
            + D  TG P++D+I DKA QKGTG+ ++ +   L   +   E A+ AR LS  ++E   
Sbjct: 240 GTLDPETGKPLVDLILDKAGQKGTGLWTVKDALDLGVPVPTIEAAVQARILSSMKEERVA 299

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             Q    P +       DSF++DL  ALY S I S+ QG  ++ +++  + +  + + I 
Sbjct: 300 ASQQLPGPGTTLEGDP-DSFLQDLRAALYCSKICSYAQGMALLRQATVAHGYVYTFSEIP 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIW+ GCIIR+++L  I  +   DP   NLL        +++   S RR+V T    G P
Sbjct: 359 RIWKGGCIIRARLLGKIQSAYQRDPELVNLLLDEEFKRAIQERQGSWRRVVATAAALGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P++SA+L+Y+D++       NL QAQRDFFG+H F+R D+    H  W
Sbjct: 419 IPAISASLAYYDSYRTAELPQNLTQAQRDFFGAHTFERIDRPGVFHHAW 467


>gi|227488977|ref|ZP_03919293.1| phosphogluconate dehydrogenase (decarboxylating) [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227542030|ref|ZP_03972079.1| phosphogluconate dehydrogenase (decarboxylating) [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227091053|gb|EEI26365.1| phosphogluconate dehydrogenase (decarboxylating) [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227182178|gb|EEI63150.1| phosphogluconate dehydrogenase (decarboxylating) [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 483

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/475 (41%), Positives = 287/475 (60%), Gaps = 4/475 (0%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG++GL  MGSNL+ N   KG+ +AVYN+ F  T   ++   G     + ++ +E 
Sbjct: 8   KKAQIGVVGLAIMGSNLARNFASKGYTVAVYNRTFAKTQALMEN-HGSEGDFLPSETIED 66

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ ++MV  G   D +I++L   +   DI++DGGNS F DT  R   +  +G
Sbjct: 67  FVASLEKPRRAMIMVQAGAATDAVIEQLADAMEEGDIIIDGGNSLFTDTIRREKAIRARG 126

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++++G GVSGG +GA  G S+M GG EKAY  +  +L SISA     PCC  +G DG+GH
Sbjct: 127 LHYVGTGVSGGEEGALHGPSIMPGGTEKAYESLGPLLESISAHVDGEPCCTHVGSDGAGH 186

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQ+I + Y +LR     +  EIS +F +W+ G L+SYL++ITAE+L+
Sbjct: 187 FVKMVHNGIEYADMQVIGEAYDLLRRVGGLDTDEISEIFGEWNKGDLNSYLVEITAEVLA 246

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++DVI D A QKGTG  +  E   L   +T    A+FAR LS   D+    
Sbjct: 247 HKDAETGKPLVDVIVDAAGQKGTGRWTAKEALDLGIPVTGIGEAVFARALSSSLDQRAAA 306

Query: 302 QSFFNPSSHFPLKCF--DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           Q    PS     +    D FV+D+  ALYAS ++++ QGF  I   +++Y+W++    +A
Sbjct: 307 QDKL-PSGTLSEEAVDKDQFVEDVRRALYASKLVAYAQGFDEILAGAKEYNWTIKPGELA 365

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWR GCIIR+  LN I  +  ++P   +LL  P  + ++   + S RR+VV  T+ G P
Sbjct: 366 KIWRGGCIIRATFLNRITDAFEKNPELPSLLLDPYFNGELDGLVDSWRRVVVEATKRGVP 425

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP  +++LSY+D    +R  A LIQ QRDFFG+H + R DK    H  W +  +E
Sbjct: 426 VPVFASSLSYYDGLRSNRLPAALIQGQRDFFGAHTYKRVDKEGTFHTLWSEDRSE 480


>gi|254883788|ref|ZP_05256498.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           4_3_47FAA]
 gi|319643516|ref|ZP_07998139.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 3_1_40A]
 gi|254836581|gb|EET16890.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           4_3_47FAA]
 gi|317384921|gb|EFV65877.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 3_1_40A]
          Length = 478

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 297/465 (63%), Gaps = 8/465 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYN-----KDFELTDVFIKKISGLSQKVIV 55
           M++ADIG+IGLG MG NL+LN+ +KG+++ V+N     K+  + + FI       + +I 
Sbjct: 1   MEKADIGLIGLGVMGQNLALNLANKGWKVVVWNRTVPGKEENVVEHFIAN-RAKGKGIIG 59

Query: 56  TKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL 115
           +  L   VEA+  PR IL+MV  G  VD+L  KL PL+   DIL+DGGNS++ DT+ R  
Sbjct: 60  SNELTDFVEALKTPRVILLMVQAGPAVDELTGKLFPLMEKGDILIDGGNSYYEDTERRVK 119

Query: 116 QLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALL 174
           +L +KG+YF+G G+SGG +GA  GAS+M GG ++A+  ++ +L SI+AK ++ +PCC  +
Sbjct: 120 ELYDKGMYFVGCGISGGEEGALHGASIMPGGAQEAWPVIQPMLKSIAAKAEDGTPCCEWV 179

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           GP G+GH+VKM+HNGIEY +MQLIA+ Y  ++  L     +++ +F +WD G+L SYLI+
Sbjct: 180 GPGGAGHYVKMVHNGIEYGDMQLIAETYFSMKHLLALKNEQMADIFEQWDKGRLHSYLIE 239

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           IT+ IL   +   G  ++D I D A QKGTG  S+I   +L++ + +   A+FARNLS  
Sbjct: 240 ITSAILRHKEE-GGDYLLDNILDAAGQKGTGRWSVINSLQLNTPLDVIAEAVFARNLSAE 298

Query: 295 RDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           ++    M   +    + P+  +   V  LE+ LYA+ +  + QGF ++  +SE+Y W L+
Sbjct: 299 KNLRVLMSKHYMHVENHPVYNYQDTVIGLESILYAARLTGYAQGFALMCTASEQYGWKLN 358

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L+TIA +WRAGCIIRS  LNDI ++    P  ++LL       +V + +P+ ++ +    
Sbjct: 359 LSTIALLWRAGCIIRSAFLNDIAEAYHRAPGLSHLLLDEHFGREVMEALPAWKKYIGVML 418

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
             G PVP LSAAL+YF     +R  AN+IQA RD+FG+H F+R D
Sbjct: 419 REGLPVPVLSAALNYFLGLTTNRSPANMIQAMRDYFGAHTFERVD 463


>gi|283782690|ref|YP_003373444.1| 6-phosphogluconate dehydrogenase, decarboxylating [Gardnerella
           vaginalis 409-05]
 gi|298253141|ref|ZP_06976933.1| 6-phosphogluconate dehydrogenase [Gardnerella vaginalis 5-1]
 gi|283441447|gb|ADB13913.1| 6-phosphogluconate dehydrogenase, decarboxylating [Gardnerella
           vaginalis 409-05]
 gi|297532536|gb|EFH71422.1| 6-phosphogluconate dehydrogenase [Gardnerella vaginalis 5-1]
          Length = 484

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/470 (39%), Positives = 291/470 (61%), Gaps = 5/470 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA+IG++GL +MGSNL+ N+   G  +AVYN+ +  T+  + +  G     + +K +E+ 
Sbjct: 5   QANIGVVGLAAMGSNLARNLAHHGNTVAVYNRHYSRTETLMNE-HGSEGAFVPSKTVEEF 63

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ +PR  ++MV  G P D +I++L   + P DI++DGGNS+F DT  R   +  +G+
Sbjct: 64  VASLKRPRTAIIMVKAGAPTDAVIEELANAMEPGDIIVDGGNSYFEDTIRRERDIRARGL 123

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +++G GVSGG +GA  G S+M GG E+++  +  IL SI+A  +  PC   +G DG+GHF
Sbjct: 124 HYVGCGVSGGEEGALRGPSMMPGGTEESWKTLGPILKSIAAVAEGEPCVTHIGTDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++   L     EI+ +FS+W+ G+L SYLI+ITA++L  
Sbjct: 184 VKMVHNGIEYSDMQLIAESYDLMLRGLGMKSDEIADVFSEWNKGELDSYLIEITADVLRQ 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--LYRDESKK 300
            D  TG P+++++ D A  KGTG  ++     L   +T    A+FAR LS  +   E+ +
Sbjct: 244 KDAKTGKPLVEMMVDHAGMKGTGTWTVQSALSLGIPVTGIAEAVFARGLSSQVALREAAE 303

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q    P  HF L   +  +F++D+  ALYAS I+S+ QGF  I  ++ ++ W +  A +
Sbjct: 304 SQGLTGPDVHFDLNDAERKAFIEDIRQALYASKIVSYAQGFDEIAAAAIEHDWKIDQAAV 363

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR+Q LN + ++     +S +LL  P     ++K+  + RR++    E+G 
Sbjct: 364 ARIWRGGCIIRAQFLNRVSEAFESGEASVSLLFAPYFKAAIEKSQAAWRRVIARAVEHGV 423

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ S+ L+Y+D     R  A+LIQAQRDFFG+H + R D+    H  W
Sbjct: 424 PVPAFSSLLAYYDGLRSKRLPASLIQAQRDFFGAHTYGRIDEPGVFHTLW 473


>gi|282862737|ref|ZP_06271798.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces sp.
           ACTE]
 gi|282562423|gb|EFB67964.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces sp.
           ACTE]
          Length = 480

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/475 (40%), Positives = 284/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +AV+N+    TD  + +  G     +     E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVAVHNRTTAKTDALVDEF-GDEGTFVAAHTPEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  GDP D +I +  PLL   D+++DGGN+HF DT+ R  +L E GI+
Sbjct: 64  AALERPRRLVIMVKAGDPTDAVIREFAPLLEEGDVVIDGGNAHFEDTRRREKELREHGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G+G+SGG +GA  G S+M GG++++Y  +  +L  I+AK ++ +PC   +GPD +GHF
Sbjct: 124 FVGVGISGGEEGALEGPSIMPGGSKESYESLGPMLEKIAAKAKDGTPCTTHIGPDAAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR     +P +I+  F  W+TG+L SYLI+ITAE+L+ 
Sbjct: 184 VKMVHNGIEYADMQLIAEAYDLLRRVAGYSPAKIAETFRGWNTGRLDSYLIEITAEVLAH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +D++ D+A QKGTG  ++     L   ++    A+FAR+LS + D  +  +
Sbjct: 244 TDAATGKPFVDIVQDRAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHADLREAAR 303

Query: 303 SFFNPSSHFPLKCFDSFVKD--LENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               PS+  PL   ++      +E ALYAS I+S+TQGF  I   SE Y W + L  +A 
Sbjct: 304 ELPGPSA-TPLAEAEAAAFADRVEQALYASKIVSYTQGFHQIRAGSEAYDWDIDLGAVAS 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+ I  +    P   +LL+    ++++       R +V      G P 
Sbjct: 363 IWRAGCIIRAAFLDRIRAAYDNRPGLVSLLSDDEFAQEIGAAQDDWRAVVAEAARQGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           P  +AALSY+D    DR  A L Q QRD+FG+H + R D+    H  W    +E+
Sbjct: 423 PGFAAALSYYDGLRADRLPAALTQGQRDYFGAHTYRRTDREGTFHTLWGGDRSET 477


>gi|154487151|ref|ZP_02028558.1| hypothetical protein BIFADO_00991 [Bifidobacterium adolescentis
           L2-32]
 gi|154085014|gb|EDN84059.1| hypothetical protein BIFADO_00991 [Bifidobacterium adolescentis
           L2-32]
          Length = 487

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/476 (39%), Positives = 291/476 (61%), Gaps = 5/476 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G  +     K LE+ 
Sbjct: 9   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRTYARTEKLMNEHGGEGE-FYPAKTLEEF 67

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F DT  R  ++S +G+
Sbjct: 68  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDTIRREKEISARGL 127

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 128 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 187

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 188 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 247

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E  +
Sbjct: 248 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAQ 307

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P     L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 308 KQGFAGPDGKLNLNDDEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYGWDIDLAAV 367

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 368 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIENAEKSWRNVVAQAAINGL 427

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W +   E
Sbjct: 428 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLWAEPGRE 483


>gi|269956677|ref|YP_003326466.1| 6-phosphogluconate dehydrogenase [Xylanimonas cellulosilytica DSM
           15894]
 gi|269305358|gb|ACZ30908.1| 6-phosphogluconate dehydrogenase, decarboxylating [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 483

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/474 (40%), Positives = 287/474 (60%), Gaps = 4/474 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +AV+N+ +  T   I++ +G     + ++++   V
Sbjct: 10  AQIGVTGLAVMGRNLARNFARHGYTVAVHNRSYAKTQSLIEE-AGHEGTFVPSESMADFV 68

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRK+++MV  G P D +I++L PLL   DI++D GN+HF DT  R   L  KG++
Sbjct: 69  ASLERPRKVVVMVKAGGPTDAVIEELVPLLEEGDIVIDAGNAHFPDTVRREKALRAKGLH 128

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG  ++Y  +  IL  ISAK    PCC  +GPDG+GHFV
Sbjct: 129 FVGTGVSGGEEGALNGPSIMPGGTAESYQWLGPILEDISAKVDGVPCCTYVGPDGAGHFV 188

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y ++R +   +  EI   F +W+ G L S+LI+ITA++L   
Sbjct: 189 KMVHNGIEYADMQLIAEAYDLIRQATGASAAEIGTTFEQWNAGDLESFLIEITADVLQHV 248

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG   +DV+ D+A QKGTG  ++  G  L   +T    A FAR LS    + +  ++
Sbjct: 249 DAETGNAFVDVVLDQAEQKGTGRWTVQNGLDLGVPITGIAEATFARALSGSVPQREAGRA 308

Query: 304 FFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               ++  P    D  +FV+D+  ALYAS +++++QGF  I  +S +  W +    +ARI
Sbjct: 309 ALTAAAE-PWAVADKEAFVEDVRLALYASKVVAYSQGFDQIAAASAENDWKIDRGAMARI 367

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++   +P    LL  P  ++ V + + + RRIV     +G PVP
Sbjct: 368 WRGGCIIRARFLNRITEAYERNPELPLLLADPYFADAVAQGVAAWRRIVAAAATHGVPVP 427

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           + S++L+Y+D    +R  A LIQAQRDFFG+H + R DK    H  W    TES
Sbjct: 428 AFSSSLAYYDGVRAERLPAALIQAQRDFFGAHTYRRVDKDGTFHTEWSGDRTES 481


>gi|294501922|ref|YP_003565622.1| 6-phosphogluconate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351859|gb|ADE72188.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus
           megaterium QM B1551]
          Length = 470

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 287/471 (60%), Gaps = 2/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ ++VYN+  E T+ F+K      +    T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGYSVSVYNRSPEKTEEFLK-TEAEGKNFAGTYSVE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + + ++ KPRKIL+MV  G   D  ID LKP L   DIL+DGGN+ F DT  R+ +L E 
Sbjct: 60  EFINSLEKPRKILLMVKAGAATDATIDSLKPYLEKGDILIDGGNTFFQDTIRRNKELEEL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++AY  V+ IL +ISAK +   CC  +GP+G+G
Sbjct: 120 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAYELVKPILTAISAKVEGDDCCTYIGPNGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y I+++ L     E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 180 HYVKMVHNGIEYGDMQLICEAYFIMKNVLGLETDELHEVFAEWNKGELDSYLIEITADIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG  ++DVI D A QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 240 TKKDEETGKALVDVILDTAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 299

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                + P++          V+ +  ALY S I S+ QGF  +  +SE+Y W+L    IA
Sbjct: 300 ASKVLSGPNAAAFEGDKTELVEAIRKALYMSKICSYAQGFAQMKAASEEYDWNLQYGDIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   D   TNLL  P   + V+    +LR ++    + G P
Sbjct: 360 MIFRGGCIIRAQFLQKIKEAYDRDADLTNLLLDPYFKDIVEGYQSALREVISIAVKQGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++  +   ANL+QAQRD+FG+H + R DK    H  W K
Sbjct: 420 VPSFSSALAYYDSYRTETLPANLLQAQRDYFGAHTYQRVDKEGVFHTEWLK 470


>gi|295707271|ref|YP_003600346.1| 6-phosphogluconate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804930|gb|ADF41996.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus
           megaterium DSM 319]
          Length = 470

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 287/471 (60%), Gaps = 2/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +G+ ++VYN+  E T+ F+K      +    T ++E
Sbjct: 1   MAKQQIGVIGLAVMGKNLALNIESRGYSVSVYNRSPEKTEEFLK-TEAEGKNFAGTYSVE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + + ++ KPRKIL+MV  G   D  ID LKP L   DIL+DGGN+ F DT  R+ +L E 
Sbjct: 60  EFINSLEKPRKILLMVKAGAATDATIDSLKPYLEKGDILIDGGNTFFQDTIRRNKELEEL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++AY  V+ IL +ISAK +   CC  +GP+G+G
Sbjct: 120 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAYELVKPILTAISAKVEGDDCCTYIGPNGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y I+++ L     E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 180 HYVKMVHNGIEYGDMQLICEAYFIMKNVLGLETDELHEVFAEWNKGELDSYLIEITADIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG  ++DVI D A QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 240 TKKDEETGKALVDVILDTAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 299

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                + P++          V+ +  ALY S I S+ QGF  +  +SE+Y W+L    IA
Sbjct: 300 ASKVLSGPNTAAFEGDKTELVEAIRKALYMSKICSYAQGFAQMKAASEEYDWNLQYGDIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+Q L  I ++   D   TNLL  P   + V+    +LR ++    + G P
Sbjct: 360 MIFRGGCIIRAQFLQKIKEAYDRDADLTNLLLDPYFKDIVEGYQSALREVISIAVKQGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++  +   ANL+QAQRD+FG+H + R DK    H  W K
Sbjct: 420 VPSFSSALAYYDSYRTETLPANLLQAQRDYFGAHTYQRVDKEGVFHTEWLK 470


>gi|254581582|ref|XP_002496776.1| ZYRO0D07876p [Zygosaccharomyces rouxii]
 gi|186703929|emb|CAQ43614.1| 6-phosphogluconate dehydrogenase,decarboxylating 1 and
           6-phosphogluconate dehydrogenase,decarboxylating 2
           [Zygosaccharomyces rouxii]
 gi|238939668|emb|CAR27843.1| ZYRO0D07876p [Zygosaccharomyces rouxii]
          Length = 489

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 277/455 (60%), Gaps = 6/455 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           AD G++GL  MG NL LN++D GF   VYN+     D F+       + +    ++++ V
Sbjct: 3   ADFGLVGLAVMGQNLILNVVDHGFSAVVYNRTTSRVDEFLAN-EAKGKNIQGAHSIKEFV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           + + +PRK++++V  G PVD LI  L P L   DI++DGGNSHF DT  R  +L +KGI+
Sbjct: 62  DKLKRPRKLMLLVKAGKPVDYLIGDLLPYLEEGDIIIDGGNSHFPDTNRRYEELKQKGIH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+E A+  +++I  S+SAK    PCC  +GP G+GHFV
Sbjct: 122 FVGSGVSGGEDGARWGPSLMPGGDEAAWPAIKSIFQSVSAKSDGEPCCDWVGPAGAGHFV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI ++Y IL+        EI  +F KW+ G L S+LI+IT +IL  +
Sbjct: 182 KMVHNGIEYGDMQLICEVYDILKRVGKFEDKEIGEIFEKWNKGVLDSFLIEITTDILKKN 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D   G+P+++ I D A QKGTG  + +    L   +T+   A+F+R LS  + E  +   
Sbjct: 242 DK-DGVPLVEKILDTAGQKGTGKWTAVNALDLGQPVTLIGEAVFSRCLSAIKPERTRASK 300

Query: 304 FFNPSSHFP---LKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
              P    P   +K    FV DLE ALYAS I+S+ QGF +I ++ ++Y W L+   IA 
Sbjct: 301 IL-PGPEIPDGVVKDKKQFVDDLEQALYASKIISYAQGFMLIREAGKEYGWKLNNPAIAL 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  +DP   NLL     ++ V K     RRI+   T  G P 
Sbjct: 360 MWRGGCIIRSAFLGEITKAYRQDPDLENLLFHDFFTQAVTKAQGGWRRILGISTTYGVPT 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF 455
           P+L+ AL+++D +   R  ANL+QAQRD+FG+H F
Sbjct: 420 PALATALAFYDGYRSARLPANLLQAQRDYFGAHTF 454


>gi|86609914|ref|YP_478676.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. JA-2-3B'a(2-13)]
 gi|86558456|gb|ABD03413.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. JA-2-3B'a(2-13)]
          Length = 472

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 291/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +    +IGL  MG NL+LN+   GF +AVYN+    TD F+++     +++    +L 
Sbjct: 1   MSKPSFAVIGLAVMGENLALNVERNGFPVAVYNRTSSKTDQFMRE-RAQGKRITPAYSLP 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V+ + +PRK L+MV  G PVD +ID+LKPLL P DI++DGGNS + DT  R+  L+  
Sbjct: 60  ELVQLMERPRKFLIMVKAGAPVDAVIDELKPLLDPGDIIIDGGNSLYTDTDRRAEALAPT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+F+G+GVSGG +GA +G SLM G + +AY ++E IL  I+A+  + PC   LGP G G
Sbjct: 120 GIHFVGMGVSGGEEGALNGPSLMPGCSPEAYQQLEPILAKIAAQVPDGPCVTYLGPKGGG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA++Y ++R +L  +  ++  +F  W+  +L S+LI+ITA+I 
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEVYDLMRRALKLSASQMQEIFQAWNETELESFLIEITAKIF 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
            + D  TG P++D+I DKA QKGTG+ ++ +   L   +   E A+ AR LS  ++E   
Sbjct: 240 QTLDPETGKPLVDLILDKAGQKGTGLWTVKDALDLGVPVPTIEAAVQARILSSMKEERVA 299

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +    P + F     D F++DL  ALY S I S+ QG  ++ +++  + +  + + I 
Sbjct: 300 ASAQLKGPDATFAGDP-DCFIQDLRAALYCSKICSYAQGMALLKRATVAHGYVYTFSEIP 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIW+ GCIIR++ L +I  +   DP   NLL      + +++   S RR+V T    G P
Sbjct: 359 RIWKGGCIIRARFLGEIQSAYKRDPELVNLLLDEEFEQAIRERQGSWRRVVSTAAALGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P++SA+L+Y+D++       NL QAQRDFFG+H F+R D+    H  W
Sbjct: 419 IPAISASLAYYDSYRTANLPQNLTQAQRDFFGAHTFERIDRPGVFHHEW 467


>gi|28211502|ref|NP_782446.1| 6-phosphogluconate dehydrogenase [Clostridium tetani E88]
 gi|28203943|gb|AAO36383.1| 6-phosphogluconate dehydrogenase, decarboxylating [Clostridium
           tetani E88]
          Length = 473

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 296/469 (63%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + DIG+IGL  MGSNL+LN+ DKG+++A++N+   + D  ++K       +    +L+
Sbjct: 1   MNKQDIGLIGLSVMGSNLALNMADKGYKVAIFNRTTTVIDEVLEKYK--HSNLFGKYSLK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           Q+++++ +PRKI+MM+  G+PVD LI+++ P L  EDIL+DGGNS+F DTQ RS  L EK
Sbjct: 59  QLMDSLERPRKIIMMIKSGEPVDMLIEQILPYLDEEDILIDGGNSYFKDTQRRSKYLKEK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI F+G+G+SGG +GAR G ++M GG+  +Y +V+ I   I+AK    PCC  +G +G+G
Sbjct: 119 GIKFLGVGISGGEEGARFGPAIMPGGDFGSYEKVKCIFEDIAAKVNGEPCCNYVGENGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLI++ Y +L+     N  E+  +F+KW+ G+L SYLIKIT+ I 
Sbjct: 179 HYVKMVHNGIEYADMQLISEAYMLLKHLGKFNNKELHGIFAKWNEGELESYLIKITSNIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  T   ++D+I DKASQKGTG  + +E   L   ++I  +A+  R +S  ++E  +
Sbjct: 239 TVKDRETNNYLLDMILDKASQKGTGKWTNMEAIDLGVDVSIITSALNGRFMSNLKEERLR 298

Query: 301 MQSFFNPSSHFPLKCF-DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                N      +    + F + +  +LY S I  + QGF ++  +S+ Y+W L    IA
Sbjct: 299 ASKILNGKVESSINIEKEEFAELVRRSLYLSKIACYAQGFQLLKVASKTYNWDLQYGNIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RI+R GCII+++ L DI+ +  E+ ++ NL+     S+ + +   SLR+ +      G P
Sbjct: 359 RIFRGGCIIQARFLKDIISAYEENNNACNLMITKVFSKVINEYDKSLRKTISIAINQGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V ++S+AL Y DT+      ANLIQAQRD+FG+H F R DK    H  W
Sbjct: 419 VTAMSSALGYMDTYRSYNLGANLIQAQRDYFGAHTFQRIDKEGNFHYDW 467


>gi|239917459|ref|YP_002957017.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Micrococcus
           luteus NCTC 2665]
 gi|281414050|ref|ZP_06245792.1| 6-phosphogluconate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|239838666|gb|ACS30463.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Micrococcus
           luteus NCTC 2665]
          Length = 520

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/488 (40%), Positives = 302/488 (61%), Gaps = 18/488 (3%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GL  MG+NL+ N    G+ +A++N+    TD  + +  G     + T+ L ++V
Sbjct: 13  ADIGVTGLAVMGANLARNFARHGYTVALHNRSRARTDQLVAE-HGDEGAFVATETLAELV 71

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++  PR++L+MV  G PVD +ID+L PLL   DI++D GNSH+ DT+ R   L+EKG++
Sbjct: 72  QSLAVPRRVLIMVKAGAPVDAVIDQLVPLLDEGDIVIDAGNSHYEDTRRREAALAEKGLH 131

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G+GVSGG +GA  G ++M GG EK+Y  +  +L  ISA+++  PCCA +G DG+GH+V
Sbjct: 132 FVGVGVSGGEEGALHGPAIMPGGPEKSYEALGPMLEKISAQFEGEPCCAWVGTDGAGHYV 191

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P E + +F+ W+   L+SYLI+ITAE+L+  
Sbjct: 192 KMVHNGIEYADMQVIGEAYDLLRRVGGLEPAEQAEVFTAWNQTDLASYLIEITAEVLAQV 251

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD----ESK 299
           D  TG P++DVI D+A QKGTG  + I G  + S +     ++FAR+LS  R       +
Sbjct: 252 DAATGRPLVDVIVDEAGQKGTGRWTAISGLDVGSPVAAIAESVFARSLSSQRAVREVARE 311

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
            + +  +  +    +  D+FV+D+  AL+AS ++++ QG  ++  ++E+Y WSL L TIA
Sbjct: 312 TLAAGVDEEAQRAPQDTDTFVEDVRQALFASKLVAYAQGMDMLAAAAEEYGWSLDLGTIA 371

Query: 360 RIWRAGCIIRSQILNDIVKSL------------TEDPSST-NLLNIPSISEKVKKTIPSL 406
            +WR GCIIR+ +L+ I+++             T  P    NLL  P  ++ + + +P+ 
Sbjct: 372 SLWRDGCIIRADLLDVIMQAFGGRDTSRHPAPGTRAPGQPLNLLFAPEFAQAIAEALPAW 431

Query: 407 RRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           RR+V T    G PVP  S+AL+Y+D    DR  A L+Q QRD+FG+H + R D+    H 
Sbjct: 432 RRVVGTAVAAGVPVPVFSSALAYYDGLRADRLPAALVQGQRDYFGAHTYLRVDREGSFHT 491

Query: 467 PWQKVSTE 474
            W    TE
Sbjct: 492 LWSGDRTE 499


>gi|284053422|ref|ZP_06383632.1| 6-phosphogluconate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291568927|dbj|BAI91199.1| 6-phosphogluconate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 474

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 294/462 (63%), Gaps = 4/462 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G+IGL  MG NL+LN+   GF +AVYN+    TD F++K     + V     LE
Sbjct: 1   MSEQKFGVIGLAVMGENLALNVERNGFPVAVYNRTSAKTDEFMQK-RAPGKNVKPAYTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ +PR+IL+MV  G PVD +I++LKPLL  +D+++DGGNS + DT+ R+ +L   
Sbjct: 60  EFVASLERPRRILVMVKAGKPVDAVINQLKPLLDHDDMIIDGGNSLYEDTERRTKELEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA  G SLM GG + +Y  +E IL  I+A+  + PC   +G  G+G
Sbjct: 120 GLGFMGMGVSGGEEGALWGPSLMPGGTQNSYQALEPILTKIAAQVDDGPCVTYIGAGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +LR+ +  N  ++  +F++W+ T +L+S+LI+ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLRNVIGLNEQQLYEVFAEWNTTDELNSFLIEITADI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  TG P++D++ D A QKGTG  +++   +L  S+     A+ +R +S Y+DE  
Sbjct: 240 FKQKDPETGKPLVDLVLDSAGQKGTGRWTVVSALELGVSIPTITAAVNSRIISSYKDERV 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              Q    PS++F      SF+  + +ALY S I S+ QG  ++GK+S++++++L+L  I
Sbjct: 300 AASQELPGPSANFDGDV-TSFINKVRDALYCSKICSYAQGMALMGKASQEFNYNLNLGEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  LN I ++  ++P   NLL  P     +     + R ++VT    G 
Sbjct: 359 ARIWKGGCIIRAGFLNKIKQAYDQNPQLPNLLLAPEFKHTILDRQSAWREVLVTANTMGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           PVP+ SA+L YFD++       NL QAQRD+FG+H ++R DK
Sbjct: 419 PVPAFSASLDYFDSYRRVSLPQNLTQAQRDYFGAHTYERIDK 460


>gi|284007095|emb|CBA72370.1| 6-phosphogluconate dehydrogenase, decarboxylating [Arsenophonus
           nasoniae]
          Length = 472

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/469 (41%), Positives = 291/469 (62%), Gaps = 3/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  E TD  I +  G  +K+I    ++
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSKEKTDEVIDENPG--RKLIPCHTIK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN++F DT  R+ +LS +
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIASLTPYLDKGDILIDGGNTYFQDTIRRNQELSAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY+ V  IL  I AK    PC + +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKQAYDLVAPILQQIVAKADGEPCVSYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA++Y IL+++L     E++ +F++W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEVYSILKNALKLTNEELADIFTEWNKGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              +  T   +IDVI D+A+ KGTG  +      L   +T+   ++FAR LS  + +   
Sbjct: 239 RKKEDKTNNYLIDVILDEAANKGTGKWTSQSALDLGVPVTLITESVFARYLSFLKAQRVT 298

Query: 301 MQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                      P K     F++ +  ALY   I+S+ QGF  +  +S++Y W L+   IA
Sbjct: 299 AAKILTGPVVNPFKGDKQEFIEKVRQALYLGKIVSYAQGFQQLTAASDEYQWQLNYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RI+RAGCIIR+Q L  I  + +++PS  NL+  P       +   SLR IV    +NG P
Sbjct: 359 RIFRAGCIIRAQFLQKITDAYSQNPSLANLMLAPYFKSITDEYQQSLRDIVCFGVQNGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +P+L+AA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 419 LPTLTAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRIDKEGIFHTEW 467


>gi|81298850|ref|YP_399058.1| 6-phosphogluconate dehydrogenase [Synechococcus elongatus PCC 7942]
 gi|93141227|sp|P21577|6PGD_SYNE7 RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|81167731|gb|ABB56071.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Synechococcus
           elongatus PCC 7942]
          Length = 471

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 287/471 (60%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG NL+LNI   GF L VYN+  E T+ F+       + ++   +LE
Sbjct: 1   MALQQFGLIGLAVMGENLALNIERNGFSLTVYNRTAEKTEAFMAD-RAQGKNIVPAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++ +PR+IL+MV  G PVD ++++LKPLL P D+++DGGNS F DT+ R   L   
Sbjct: 60  DFVASLERPRRILVMVKAGGPVDAVVEQLKPLLDPGDLIIDGGNSLFTDTERRVKDLEAL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG + AY  VE I+ SI+A+  + PC   +GP GSG
Sbjct: 120 GLGFMGMGVSGGEEGALNGPSLMPGGTQAAYEAVEPIVRSIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L+     N  E+  +F+ W+ T +L S+LI+ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKSVAGLNASELHDVFAAWNKTPELDSFLIEITADI 239

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
            +  D + TG P++++I D A QKGTG  ++    ++  ++     A+ AR LS  + E 
Sbjct: 240 FTKVDDLGTGQPLVELILDAAGQKGTGRWTVETALEIGVAIPTIIAAVNARILSSIKAER 299

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           +      +     P      +F+  + +ALY S I S+ QG  ++ K+S+ Y++ L+L  
Sbjct: 300 QAASEILSGPITEPFSGDRQAFIDSVRDALYCSKICSYAQGMALLAKASQVYNYGLNLGE 359

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIW+ GCIIR+  LN I ++   DP+  NLL  P   + +     + RR++    E G
Sbjct: 360 LARIWKGGCIIRAGFLNKIKQAYDADPTLANLLLAPEFRQTILDRQLAWRRVIAIAAERG 419

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ SA+L YFD++  DR   NL QAQRD+FG+H ++R D+    H  W
Sbjct: 420 IPVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYERTDRSGSFHAQW 470


>gi|254449864|ref|ZP_05063301.1| 6-phosphogluconate dehydrogenase, decarboxylating [Octadecabacter
           antarcticus 238]
 gi|198264270|gb|EDY88540.1| 6-phosphogluconate dehydrogenase, decarboxylating [Octadecabacter
           antarcticus 238]
          Length = 446

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/449 (41%), Positives = 275/449 (61%), Gaps = 8/449 (1%)

Query: 23  LDKGFRLAVYNKDFELTDVFIKKIS--GLSQKVIVTKNLEQMVEAVCKPRKILMMVTDGD 80
           +D GF L V N+  +   +F+++    GL+ K+  + +L+ MV A+  PR I++MV  G 
Sbjct: 1   MDNGFALHVSNRSSDAVPLFVEEAGADGLADKLTGSDSLDAMVNAMPAPRAIILMVPSGK 60

Query: 81  PVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGVKGARSGA 140
           PVD  I  L  LL+  D ++D GNS F DT  R+  + ++G+ FIG+GVSGG  GAR G 
Sbjct: 61  PVDATIQTLILLLAKGDTIIDAGNSDFRDTIRRTKDIEQQGLTFIGMGVSGGEDGARHGP 120

Query: 141 SLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYANMQLIAD 200
           S+MVGG+  A+N V  ++ +I+AK+   PC   LGPDG+GHFVK +HNGIEYA+MQLIA+
Sbjct: 121 SIMVGGSPAAWNAVREVIEAIAAKFNGEPCADHLGPDGAGHFVKTVHNGIEYADMQLIAE 180

Query: 201 IYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIIDVICDKAS 260
           +YG++R    ++P +I  +F +W+ G L SYL++ITA++L ++D+ T  P +DVI D A 
Sbjct: 181 VYGLMRYGRGQSPGDIGAVFDRWNKGALESYLVEITAKVLQATDSETDQPAVDVILDAAG 240

Query: 261 QKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFN-PSSHFPLKCFDSF 319
           QKGTG  + IE  ++  S  + E A+ AR  S            ++ P     L      
Sbjct: 241 QKGTGRWTAIEAIRMGQSANVIEAAVAARAWSSEGAARTVGADIYDTPRGELALSDV--- 297

Query: 320 VKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQILNDIVKS 379
             DLE+AL    I+S+ QGF ++  +S+++ WS+  A  A +WRAGCIIRS +L+DI  +
Sbjct: 298 --DLESALLVGRIVSYAQGFRILTAASDEFDWSIDSARAAEVWRAGCIIRSALLDDIASA 355

Query: 380 LTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGT 439
              D     L+        ++  +P+LRR+V   T  G+ VP+L++AL + DT    RGT
Sbjct: 356 FRSDLPEGQLIFADHFVVLIRDALPALRRVVSGATAAGHAVPALASALGFLDTLRTARGT 415

Query: 440 ANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            +LIQAQRDFFG HGF R D   + HGPW
Sbjct: 416 TDLIQAQRDFFGRHGFVRLDGRKDQHGPW 444


>gi|145595957|ref|YP_001160254.1| 6-phosphogluconate dehydrogenase [Salinispora tropica CNB-440]
 gi|145305294|gb|ABP55876.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Salinispora
           tropica CNB-440]
          Length = 478

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 284/473 (60%), Gaps = 2/473 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA IG+ GL  MG NL+ N+   GF +AV+N+  E T   I +  G   + + T +L   
Sbjct: 4   QAQIGVTGLAVMGRNLARNLARNGFVVAVHNRSPERTRRLIAE-HGAEGRFVPTDSLADF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V A+ +PR ++ MV  G P D +ID+L PLL   DI++D GN+HF DT+ R   L ++G+
Sbjct: 63  VAALERPRAVITMVKAGAPTDAVIDELVPLLDAGDIIVDCGNAHFADTRRREEALRKQGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG++++Y ++  I   I+A+    PCC  +GPDG+GHF
Sbjct: 123 HFVGTGVSGGEEGALWGPSIMPGGSDESYQKLGPIFEQIAAQVDGEPCCRHIGPDGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR  L   P E++ +F +W++G+L S+LI+ITAE+L  
Sbjct: 183 VKMVHNGIEYADMQLIAEAYDLLRAGLEATPAELAEIFREWNSGELESFLIEITAEVLGH 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE-SKKM 301
           +D  TG   +D++ D+A QKGTG  ++     L   +T    A FAR+LS +  + +   
Sbjct: 243 TDASTGQAFVDIVLDQAEQKGTGRWTVQNALDLGIPITGIAEATFARSLSGHAGQRAATR 302

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           ++F      + ++   +FV+D+  AL AS I+++ QGF  I   S++Y W + L   A I
Sbjct: 303 RAFAGTEPTWRVEDRGAFVEDVRRALLASKIVAYAQGFDHIRAGSQEYDWDIDLGGTATI 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+  L+ I ++  + P    LL  P  ++ V+  +   RR+V      G P P
Sbjct: 363 WRGGCIIRANFLDRIRQAYDDQPDLPTLLVAPWFADAVRAGLSGWRRVVAEAAHAGVPTP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           + +++LSYFD    +R  A LIQ  RD FG+H + R D+    H  W    +E
Sbjct: 423 AFASSLSYFDALRANRLPAALIQGLRDNFGAHTYRRVDRDGSFHTLWAGDRSE 475


>gi|254784704|ref|YP_003072132.1| 6-phosphogluconate dehydrogenase [Teredinibacter turnerae T7901]
 gi|237683556|gb|ACR10820.1| 6-phosphogluconate dehydrogenase, decarboxylating [Teredinibacter
           turnerae T7901]
          Length = 484

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/463 (41%), Positives = 297/463 (64%), Gaps = 6/463 (1%)

Query: 1   MKQ-ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNL 59
           MK+ +DIG++GL  MG NL LN+ + G+ +  YN+  E  D F+       + +    ++
Sbjct: 1   MKELSDIGLVGLAVMGENLILNMANNGYTVTAYNRSTEKVDAFLAG-RAKGKSIRGAHSV 59

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E++V ++ KPRKI++MV  G PVD  I+++ P L   DIL+DGGN+HF DT  R    + 
Sbjct: 60  EELVASLAKPRKIMLMVKAGAPVDAFIEQILPHLEEGDILIDGGNTHFPDTNRRVDYCAS 119

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDG 178
           KGI F+G GVSGG +GA +G S+M GG + A++ V+ I  SI+AK ++ +PCC  +G +G
Sbjct: 120 KGILFVGAGVSGGEEGALTGPSIMPGGAKDAWHHVKPIFQSIAAKVEDGTPCCDWVGENG 179

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GHFVKM+HNGIEY +MQLI + Y I++D L  +  E+  +F++W+ G+L SYL +IT +
Sbjct: 180 AGHFVKMVHNGIEYGDMQLICEAYQIMKDLLGMSADEMHEVFAEWNEGELDSYLTEITRD 239

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           IL + D   G P++D I D A QKGTG  + +   ++   +T+   A+FAR LS  ++E 
Sbjct: 240 ILKTKDE-DGEPLVDKILDTAGQKGTGKWTGVAALEMGVPLTLIGEAVFARCLSAQKEER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + P+  F      +F++DL NAL+A+ I+S+ QG+ ++ ++++++ W L+   
Sbjct: 299 VEAAKIISGPTPKFEGDK-KAFIEDLRNALFAAKIVSYAQGYVLMREAAKEFGWELNNGG 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA +WR GCIIRS  L +I ++   +P+ TNLL  P   ++V       R +V + T NG
Sbjct: 358 IALMWRGGCIIRSVFLGNIKEAFDTNPALTNLLLDPYFQQRVDAAQAGWRNVVASATLNG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            P P+L++ALSYFD +   R  ANL+QAQRDFFG+H ++R DK
Sbjct: 418 IPAPTLTSALSYFDGYRTARLPANLLQAQRDFFGAHTYERTDK 460


>gi|254424441|ref|ZP_05038159.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. PCC 7335]
 gi|196191930|gb|EDX86894.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. PCC 7335]
          Length = 472

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 292/470 (62%), Gaps = 4/470 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
            G+IGL  MG N++LN+   GF +AVYN+    TD F++  +G  + V+ T +LE+ V A
Sbjct: 5   FGVIGLAVMGENIALNVERNGFPIAVYNRSRSKTDAFMENRAG-GKNVVPTFSLEEFVGA 63

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + +PR+IL+MV  G PVD +I+ LKPLL PED+++DGGNS + DT+ R   L   G  FI
Sbjct: 64  LERPRRILLMVQAGKPVDMVIESLKPLLDPEDMIIDGGNSLYEDTERRVKDLESAGFNFI 123

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+GVSGG +GA +G SLM GG++ AY+ +E I+  I+A+  + PC   +G  GSGHFVKM
Sbjct: 124 GMGVSGGEEGALNGPSLMPGGSKAAYDSIEPIVTKIAAQVDDGPCVTYIGQGGSGHFVKM 183

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEILSSSD 244
           +HNGIEY +MQLIA+ Y +L+++L     E+  +F++W+ T +L S+LI+ITA+I +  D
Sbjct: 184 VHNGIEYGDMQLIAEAYDLLKNTLGLGHKELHEIFAEWNKTEELDSFLIEITADIFTKMD 243

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK-KMQS 303
             TG P++++I DKA QKGTG  +++   ++  S+     A+ AR +S  ++E     + 
Sbjct: 244 EETGKPLVELIMDKAGQKGTGRWTVMSALEIGVSIPTITAAVNARIMSAIKEERMIAAEQ 303

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
              P++ F      +FV  + +ALY S I S+ QG  ++ K+S    ++L L   ARIW+
Sbjct: 304 LTGPTASFEGDK-KAFVNKIRDALYCSKICSYAQGMDLLSKASALNDYNLDLGETARIWK 362

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+  LN I  +  +D    NLL  P   + +     + R +V T  + G PVP+ 
Sbjct: 363 GGCIIRAAFLNKIKAAYDQDAKLPNLLLAPEFKQTILDRQDAWREVVATAAKVGIPVPAF 422

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVST 473
           SA+L YFD++   R   NL QAQRD+FG+H + R DK    H  W + +T
Sbjct: 423 SASLDYFDSYRRGRLPQNLTQAQRDYFGAHTYQRTDKEGIFHTEWPESAT 472


>gi|331698838|ref|YP_004335077.1| 6-phosphogluconate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326953527|gb|AEA27224.1| 6-phosphogluconate dehydrogenase, decarboxylating [Pseudonocardia
           dioxanivorans CB1190]
          Length = 478

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/475 (42%), Positives = 295/475 (62%), Gaps = 7/475 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           Q+ IG+ GL  MG+NL+ NI   G  +AV+N+    T  FI+   G   +   T++L++ 
Sbjct: 4   QSRIGVTGLAVMGANLARNIARHGVPVAVHNRTGARTTEFIEAY-GDEGEFTGTQSLQEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+A+ +PR+I++MV  G PVD +I +L PLL   DI++D GNSHF DT  R+ + +  GI
Sbjct: 63  VDALERPRRIIVMVKAGKPVDGVITELTPLLDEGDIIIDAGNSHFPDTVRRTAECAANGI 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G+GVSGG +GA  G S+M GG+ +AY  V+++  +I+A+   +PC   +GP G+GH+
Sbjct: 123 RFMGVGVSGGEEGALLGPSIMPGGDPEAYAEVKDVFEAIAAQVDGTPCVVHVGPGGAGHY 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +L      +   I  +F +W++G L S+LI+IT ++L+ 
Sbjct: 183 VKMVHNGIEYADMQLIVEAYDLLTHVAGLDAPAIGKIFEEWNSGDLESFLIEITGKVLAK 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D+A QKGTG  + I+   L   +T    A+FAR LS  RDE KK  
Sbjct: 243 VDEKTGGPLVDVIVDRAGQKGTGTWTAIDALGLGIPLTGITEAVFARGLSALRDERKKAS 302

Query: 303 SFF---NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           +     NPS+    +     V D+  ALYAS ++++ QGF  +  +S +  W+L L  +A
Sbjct: 303 TTLAGPNPSA---AEDRTDLVDDIRQALYASKVVAYAQGFAQMRAASLQNDWNLDLGAMA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR+Q LN I  +  E P   NLL +P  +E V     + RR+VVT TE G  
Sbjct: 360 TIWRGGCIIRAQFLNRIRDAYAEHPDLDNLLMVPYFTEAVANAQDAWRRVVVTATEQGVA 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           +P+ S++LSY+D +  +RG ANLIQ  RDFFG+H ++R D     H  W +  TE
Sbjct: 420 IPAFSSSLSYYDGYRRERGPANLIQGLRDFFGAHTYERIDAEGSFHTRWAQDGTE 474


>gi|302555663|ref|ZP_07308005.1| 6-phosphogluconate dehydrogenase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302473281|gb|EFL36374.1| 6-phosphogluconate dehydrogenase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 479

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/477 (40%), Positives = 291/477 (61%), Gaps = 11/477 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +AV+N+    T   +++  G     +  +  ++ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVAVHNRTPARTRTLVEEF-GDEGDFVACETAKEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+P D +I +  PLL P D+++DGGN+HF DT+ R   L E+GI+
Sbjct: 64  AALERPRRLVVMVKAGEPTDAVIQEFAPLLEPGDMIIDGGNAHFADTRRRERDLREQGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G+GVSGG +GA +G S+M GG +++Y+ +  +L  ISAK  + SPC + +GPDG+GHF
Sbjct: 124 FVGMGVSGGEEGALNGPSIMPGGPKESYDSLGPMLEKISAKAADGSPCVSHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P +I+ +F  W+ G+L SYLI+ITAE+LS 
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPAQIAEIFRTWNQGRLDSYLIEITAEVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY---RDESK 299
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS +   RD S+
Sbjct: 244 VDAETGKPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAALRDASR 303

Query: 300 KMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     P +  PL   +  +F   +E ALYAS I+S+TQGF  I  +  +Y W + L  
Sbjct: 304 GLA---GPQAK-PLGEAEARAFADRVEQALYASKIVSYTQGFHEIDAARGEYGWDIDLGA 359

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           ++ +WR GCIIR+  L+ I  +    P   +LL+  + ++++       R ++V  T  G
Sbjct: 360 VSALWRGGCIIRAAFLDRIRSAYDTRPDLPSLLSDATFAQEIADAQDDWREVLVAATRQG 419

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            P P  SAAL+Y+D    +R  A L Q QRD+FG+H + R DK    H  W +  +E
Sbjct: 420 VPTPGFSAALAYYDALRAERLPAALTQGQRDYFGAHTYRRVDKDGSFHTLWGQDRSE 476


>gi|224476619|ref|YP_002634225.1| 6-phosphogluconate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421226|emb|CAL28040.1| 6-phosphogluconate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 469

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/465 (42%), Positives = 297/465 (63%), Gaps = 6/465 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG++GL  MG NL+ NI  +G+ ++VYN+  E T+  +++  G  + +  T +LE+ V +
Sbjct: 5   IGVVGLAVMGKNLAWNIESRGYSVSVYNRSKEKTEQMVEESKG--KNIHPTYSLEEFVNS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + +PRKIL+MV  G   D  I+ L PLL   DIL+DGGN+++ DT  R+  L+E GI FI
Sbjct: 63  LERPRKILLMVKAGPATDATIEGLLPLLDDGDILIDGGNTNYQDTIRRNKALAESGINFI 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHFVK 184
           G GVSGG  GA +G S+M GG ++AY++V +IL +ISAK  + +PC   +GPDG+GH+VK
Sbjct: 123 GTGVSGGEVGALTGPSIMPGGQKEAYDKVSDILEAISAKADDGAPCVTYIGPDGAGHYVK 182

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEYA+MQLIA+ Y +++D+L+ +  EI+  F +W+ G+L SYLI+IT EI +  D
Sbjct: 183 MVHNGIEYADMQLIAESYSLMKDALHMSHTEIAKTFKEWNKGELDSYLIEITGEIFNKLD 242

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES-KKMQS 303
              G P+++ + DKA QKGTG  + I   +L   +TI   ++FAR +S  ++E  +  + 
Sbjct: 243 E-DGTPLVEKVMDKAGQKGTGKWTSINALELGVPLTIITESVFARFISSMKEERIEASKH 301

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
              PS  F     + F++ +  ALY S I S+ QGF  + K+SE+++W+L L  +A IWR
Sbjct: 302 LEGPSPKFNGNK-EEFLEKIRKALYMSKICSYAQGFAQMRKASEEHNWNLQLGDLAMIWR 360

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
           AGCIIR++ L  I  +   +    NLL  P  ++ V     +LR +V     NG P P  
Sbjct: 361 AGCIIRARFLQKIKDAYDNNSELQNLLLDPYFTDVVTNYQSALRDVVAESVANGIPTPGF 420

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           +A+++Y+D++  +   ANLIQAQRD+FG+H + RKD+    H  W
Sbjct: 421 AASINYYDSYRSENLPANLIQAQRDYFGAHTYQRKDQEGTFHTHW 465


>gi|154686648|ref|YP_001421809.1| 6-phosphogluconate dehydrogenase [Bacillus amyloliquefaciens FZB42]
 gi|154352499|gb|ABS74578.1| YqjI [Bacillus amyloliquefaciens FZB42]
          Length = 469

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 290/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLEEAKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK     C   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEACTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSAEELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  ++E  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKEERVK 298

Query: 301 MQSFFNPSSHFPL-KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             S  +     P+ +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASSLLSGPDVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I  +   +P   NLL         +    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKDAYDREPELDNLLLDSYFKNIAESYQGALRQVISLAVAQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|183982724|ref|YP_001851015.1| 6-phosphogluconate dehydrogenase Gnd1 [Mycobacterium marinum M]
 gi|183176050|gb|ACC41160.1| 6-phosphogluconate dehydrogenase Gnd1 [Mycobacterium marinum M]
          Length = 483

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/473 (39%), Positives = 287/473 (60%), Gaps = 5/473 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKE-HGAEGKFVRSETISEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR++L+MV  G+P D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 70  AALETPRRVLIMVKAGEPTDAVINELADAMEPGDIIIDGGNALYTDTIRREKAVRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPAESYTSLGPLLEEISAHVDGVPCCTHIGPDGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L  +  +I+ +FS+W+ G L SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFSEWNKGDLDSYLVEITAEVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS      ++  +
Sbjct: 250 DAKTGKPLVDVILDQAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALS--GSVQQRAAA 307

Query: 304 FFNPSSHFPLKCF--DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              PS     K    D+F +++  ALYAS I+++ QGF  I   S ++ W ++   +A I
Sbjct: 308 VGLPSGRLGDKPADPDTFTENVRRALYASKIVAYAQGFNQIQAGSAEFGWDITPGDLATI 367

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++   +P+  +LL  P     ++  + S RR+V T  + G P P
Sbjct: 368 WRGGCIIRAKFLNRIKEAFDAEPALASLLVAPYFRSAIESAVDSWRRVVSTAAQLGIPTP 427

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             S+AL+Y+D    +R  A L QAQRDFFG+H + R D   + H  W    +E
Sbjct: 428 GFSSALAYYDALRTERLPAALTQAQRDFFGAHTYGRIDAAGKFHTLWSADRSE 480


>gi|297623752|ref|YP_003705186.1| 6-phosphogluconate dehydrogenase [Truepera radiovictrix DSM 17093]
 gi|297164932|gb|ADI14643.1| 6-phosphogluconate dehydrogenase, decarboxylating [Truepera
           radiovictrix DSM 17093]
          Length = 489

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/458 (41%), Positives = 284/458 (62%), Gaps = 4/458 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-LTDVFIKKISGLSQKVIVTKNLEQ 61
           QA++G+IGL  MG NL LN+ D G+ +AV+N+  + +TD    +  G S  V+  + LE 
Sbjct: 11  QAELGLIGLAVMGRNLVLNLADHGYTVAVFNRTTQRMTDFLEGEAKGRS--VVGYERLED 68

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V A+ +PRK+++MV  G  VD +I  L PLL P D+++DGGNS+F DT+ R   L E+G
Sbjct: 69  FVGALERPRKVMLMVEAGRGVDAVIGALLPLLEPGDVIIDGGNSNFLDTRRRERDLRERG 128

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I+F+G+G+SGG +GAR G S+M GG+ +A+  V  IL  ++A    +PCC  +G DG+GH
Sbjct: 129 IHFLGVGISGGEEGARHGPSIMPGGSREAWELVRPILQRVAAHVGGAPCCDYVGEDGAGH 188

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEY +MQLI + Y ++R  L  N  E++  F++W+ G L+SYLI ITA I  
Sbjct: 189 FVKMVHNGIEYGDMQLIGEAYDLMRSVLGMNADELAETFARWNEGPLNSYLIDITATIFR 248

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D   G P+++ I D A QKGTG  +++   +    +T+   A+FAR+LS  + E    
Sbjct: 249 VRDR-DGTPLVENILDVAGQKGTGRWTVVAALEEGVPLTLIAEAVFARSLSALKSERVAA 307

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
            +     +       ++ + DLE ALYA+ I S+ QG+ ++  +++ Y WSL+   +A++
Sbjct: 308 AAHLTGPAPSAAPEREAVLADLEAALYAAKITSYAQGYMLLRAAAKTYGWSLNYGGVAQM 367

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIRS  L+ I  +   DP   NLL  P   + V +   + RR V    ++G P+P
Sbjct: 368 WRGGCIIRSAFLDHIKAAYDADPELPNLLLAPYFRDAVTRAQGAWRRTVAFGVQHGVPLP 427

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +  AAL++FD      G ANL+QAQRDFFG+H F+R D
Sbjct: 428 AFGAALAFFDGLRRATGPANLLQAQRDFFGAHTFERVD 465


>gi|224283770|ref|ZP_03647092.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum NCIMB
           41171]
 gi|311064839|ref|YP_003971565.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum PRL2010]
 gi|313140924|ref|ZP_07803117.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum NCIMB
           41171]
 gi|310867159|gb|ADP36528.1| Gnt 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum
           PRL2010]
 gi|313133434|gb|EFR51051.1| 6-phosphogluconate dehydrogenase [Bifidobacterium bifidum NCIMB
           41171]
          Length = 482

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/477 (39%), Positives = 292/477 (61%), Gaps = 7/477 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG++L+ N+   G ++AV+N+ +  T+  I +  G   +    K +E+ 
Sbjct: 4   EANVGVVGLAAMGASLARNLARHGNKVAVFNRHYSRTEKLITE-HGSEGEFFPAKTMEEF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ KPR  ++MV  G+P D +I +L  L+ P DI++D GN+HF DT  R   +S +G+
Sbjct: 63  VASLKKPRTAIIMVKAGEPTDAMIGQLADLMEPGDIIVDAGNAHFPDTIRREKAISARGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 123 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGENGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLI++ Y ++R +L   P EI  +F +W+  +L SYLI+ITA++L  
Sbjct: 183 VKMVHNGIEYSDMQLISESYDLMRRALGMTPAEIGDVFEEWNKTELESYLIEITADVLHQ 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDESK 299
            D  TG P++DVI D A  KGTG  ++     L+  +T    A+FAR LS     R E++
Sbjct: 243 VDKKTGKPLVDVIVDHAGMKGTGTWTVQSALDLAVPVTGIAEAVFARGLSGQAELRAEAQ 302

Query: 300 KMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           K Q F  PS   P+   D  +F+ D+  ALYAS I+++ QGF  I ++++ Y W + LA 
Sbjct: 303 K-QDFEGPSGVVPMAEEDKVAFINDIREALYASKIVAYAQGFNEITEAAKVYDWKIDLAA 361

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIWR GCIIR++ LN I  +     ++ +LL  P   + ++    S RR+V      G
Sbjct: 362 VARIWRGGCIIRAKFLNRISDAFENGEANVSLLFAPYFKDAIETAERSWRRVVSRAITFG 421

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            PVP  +++L YFD     R  A LIQ QRD+FG+H + R D     H  W +   E
Sbjct: 422 IPVPVFASSLEYFDGLRSPRLPAALIQGQRDYFGAHTYQRTDMPGAFHTLWAEPGRE 478


>gi|311068987|ref|YP_003973910.1| 6-phosphogluconate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869504|gb|ADP32979.1| 6-phosphogluconate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 469

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/471 (41%), Positives = 289/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQEAQG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLEAPRKILLMVKAGAATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +I+AK     C   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAIAAKVDGEACTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSAEELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKDERVK 298

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P +    +     ++ +  AL+ S I S+ QGF  +  +S++Y+W L    IA
Sbjct: 299 ASGLLAGPEAKPVTENKAELIEAVRKALFMSKICSYAQGFAQMKAASDEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I ++   +P   NLL        V+    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQQIKEAYDREPELDNLLLDNYFKNIVESYQGALRQVISLAVSQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGVFHTEWMK 469


>gi|308174177|ref|YP_003920882.1| NADP-dependent phosphogluconate dehydrogenase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307607041|emb|CBI43412.1| NADP-dependent phosphogluconate dehydrogenase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554121|gb|AEB24613.1| 6-phosphogluconate dehydrogenase [Bacillus amyloliquefaciens TA208]
 gi|328912512|gb|AEB64108.1| NADP-dependent phosphogluconate dehydrogenase [Bacillus
           amyloliquefaciens LL3]
          Length = 469

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 289/471 (61%), Gaps = 3/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG+IGL  MG NL+LNI  +GF ++VYN+    T+ F+++  G  + V+ T ++E
Sbjct: 1   MSKQQIGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLEEAKG--KNVVGTYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PRKIL+MV  G   D  I  L P L  +DIL+DGGN+++ DTQ R+ +L+E 
Sbjct: 59  EFVQSLETPRKILLMVKAGTATDATIQSLLPHLEKDDILIDGGNTYYKDTQRRNKELAES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI+FIG GVSGG +GA  G S+M GG ++A+  V+ IL +ISAK     C   +GPDG+G
Sbjct: 119 GIHFIGTGVSGGEEGALKGPSIMPGGQKEAHELVKPILEAISAKVDGEACTTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y IL+  L  +  E+  +F++W+ G+L SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLISESYFILKQVLGLSAEELHEVFAEWNKGELDSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D  TG P++DVI DKA QKGTG  +      L   + I   ++FAR +S  +DE  K
Sbjct: 239 TKKDEETGKPLVDVILDKAGQKGTGKWTSQSALDLGVPLPIITESVFARFISAMKDERVK 298

Query: 301 MQSFFNPSSHFPL-KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P+ +  +  ++ +  AL+ S I S+ QGF  +  +SE+Y+W L    IA
Sbjct: 299 ASGLLSGPDVKPVTENKEELIEAVRKALFMSKICSYAQGFAQMKAASEEYNWDLKYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+R GCIIR+  L  I  +   +P   NLL         +    +LR+++      G P
Sbjct: 359 MIFRGGCIIRAAFLQKIKDAYDREPELDNLLLDSYFKNIAESYQGALRQVISLAVAQGVP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VPS S+AL+Y+D++      ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 419 VPSFSSALAYYDSYRTAVLPANLIQAQRDYFGAHTYERTDKEGIFHTEWMK 469


>gi|307330819|ref|ZP_07609954.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           violaceusniger Tu 4113]
 gi|306883532|gb|EFN14583.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           violaceusniger Tu 4113]
          Length = 479

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 280/473 (59%), Gaps = 10/473 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA IG+ GL  MG NL+ N    G+ +AV+N+    T   +++  G     +  K   + 
Sbjct: 4   QAHIGVTGLAVMGRNLARNFARHGYTVAVHNRTAARTRSLVEEF-GDEGTFVPAKTAREF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+A+ +PR++++MV  G   D ++D+   LL P D+++DGGN+HF DT+ R   L E+GI
Sbjct: 63  VDALQRPRRLMIMVQAGVATDAVLDEFALLLEPGDMIIDGGNAHFADTRRREAALQERGI 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG +GA +G S+M GG++++Y  +  +  +ISA     PC   +G DG+GHF
Sbjct: 123 HFVGAGISGGEEGALNGPSIMPGGSKESYAVLGPMFETISAHVDGEPCSTHIGSDGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR     +P EI+ +F  W+ G+L+SYLI+ITAE+LS 
Sbjct: 183 VKMVHNGIEYADMQLIAEAYDLLRQVAQYSPAEIAGIFRTWNKGRLNSYLIEITAEVLSH 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P  DVI D A +KGTG  ++     L S +T    A FAR  S        ++
Sbjct: 243 TDAGTGRPFADVIADAAGEKGTGRLTVQTALDLGSPVTAIAQATFARAAS----SQPALR 298

Query: 303 SFFNP---SSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           + + P    +  PL   ++  F   +E ALYAS ++++ QGF +I  ++  Y W +    
Sbjct: 299 AAYRPLPGGTPIPLTRSEAERFTAQVEQALYASKVIAYDQGFKMIQDAALAYRWDIDFGA 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +A IWR GCIIR+  L+ I  +   DP   +LL  P+ ++++       R +V T    G
Sbjct: 359 VAGIWRGGCIIRAAFLDRIRTAHAADPHLVSLLAEPAFAQEITAAQVPWREVVATTARRG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P P+ +AALSY+DT   +R  A LIQ QRD+FG+H + R DK    H  W +
Sbjct: 419 VPTPAFTAALSYYDTLRAERLPAALIQGQRDYFGAHTYQRTDKEGSFHTHWAR 471


>gi|159899144|ref|YP_001545391.1| 6-phosphogluconate dehydrogenase, decarboxylating [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892183|gb|ABX05263.1| 6-phosphogluconate dehydrogenase, decarboxylating [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 483

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/457 (42%), Positives = 288/457 (63%), Gaps = 4/457 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN+ D GF +AVYN+     D F+         V+   +LE++V
Sbjct: 5   ADIGLIGLAVMGQNLVLNMNDHGFVVAVYNRTTSKVDQFLAN-EAQGTNVVGAHSLEELV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PR++++M+  G  VD  ID+L PLL P DI++DGGNS F D+  R+  L  KG+ 
Sbjct: 64  GKLKRPRRVMLMIQAGSAVDATIDQLVPLLEPGDIIIDGGNSLFTDSNRRTADLEAKGLL 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           FIG GVSGG +GAR G S+M GG+  A+  V+ I  +I+AK  + SPCC  +G  G+GHF
Sbjct: 124 FIGTGVSGGEEGARHGPSIMPGGSPAAWPHVQPIFQAIAAKVDDGSPCCDWVGEGGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + Y ++R SL  +  E+S +F +W+ GKL SYLI+IT +IL+ 
Sbjct: 184 VKMVHNGIEYGDMQLIGETYDVMR-SLGLSADEMSSVFGEWNAGKLDSYLIEITRDILAF 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D+  G P++D I D A QKGTG  +++        +T+   A+F+R LS  +DE     
Sbjct: 243 RDS-DGAPLVDKILDSAGQKGTGKWTVVSALDNGIPLTLIGEAVFSRFLSALKDERVHAA 301

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
           S  +  +  P     + V DL +ALYA+ I+S+TQG+ ++  ++++  W+L+   IA +W
Sbjct: 302 SAISGPADQPNVDRAALVNDLRDALYAAKIVSYTQGYMLMRAAAKEQGWNLNYGGIALMW 361

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIRS  L  I ++   +P   NLL  P  S +V+++  + RR++      G PVP+
Sbjct: 362 RGGCIIRSAFLGKIEEAYRNNPELVNLLLDPYFSNEVQQSQAAWRRVIAHAVLAGIPVPA 421

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           LS+AL++FD +      ANL+QAQRD+FG+H ++R D
Sbjct: 422 LSSALAFFDGYRTGNLPANLLQAQRDYFGAHTYERID 458


>gi|310824266|ref|YP_003956624.1| 6-phosphogluconate dehydrogenase, decarboxylating [Stigmatella
           aurantiaca DW4/3-1]
 gi|309397338|gb|ADO74797.1| 6-phosphogluconate dehydrogenase, decarboxylating [Stigmatella
           aurantiaca DW4/3-1]
          Length = 473

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/463 (40%), Positives = 288/463 (62%), Gaps = 9/463 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K +  G+ GLG MG NL+LNI D GF +A +  +F    +   +     +++  T +LE+
Sbjct: 5   KPSQFGVAGLGVMGVNLALNIADHGFSVAGW--EFSPKRLAAVQAEKPYERLKTTGSLEE 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V  + +PR+IL+MVT GDPVDQ++D+L PLLSP D+L+DGGNS F DTQ R     EKG
Sbjct: 63  FVGMLERPRRILLMVTAGDPVDQMMDRLAPLLSPGDVLIDGGNSWFQDTQRREKAYREKG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           + FIG+GVSGG +GAR G SLM GG  +AY  +  ++ +I+AK     C   +GP G+GH
Sbjct: 123 LRFIGMGVSGGEEGARHGPSLMPGGPAEAYEHIRPVVEAIAAKTDQGACVTHVGPGGAGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQL+A+ Y +LR  L  +P  + +  ++W+ G   S+L++ T ++L 
Sbjct: 183 FVKMVHNGIEYADMQLLAETYDVLRRGLGLSPDALVNTLAEWNEGISGSFLLETTLQVLR 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE---- 297
             D  TG P++D++ DKA QKGTG  ++     L   +    +A+ ARNLS  +DE    
Sbjct: 243 KKDPETGKPLVDLVLDKAGQKGTGKWTVQVSLDLGVPVPSIASALDARNLSAMKDERVAA 302

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           S K+ +   P +    +          +ALYA+ ++++ QG  +I  +S++Y W++SLA 
Sbjct: 303 SAKLPA---PQAALTDEEKQHLAAWTHDALYAARVVTYAQGMRLIQAASKEYQWNVSLAE 359

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIWR GCIIR+++L  + ++ T+ P   NL+   + +  + +  P+ RR+V T T  G
Sbjct: 360 LARIWRGGCIIRAKLLTPLREAFTQQPDLPNLVVSEAFAPVLTRMAPAWRRVVGTATRLG 419

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            PVP  S++L+Y D++       NL QAQRD FG+H + R+D+
Sbjct: 420 IPVPVFSSSLAYLDSYRSAELPQNLTQAQRDAFGAHTYQRRDR 462


>gi|261337262|ref|ZP_05965146.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bifidobacterium
           gallicum DSM 20093]
 gi|270277624|gb|EFA23478.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bifidobacterium
           gallicum DSM 20093]
          Length = 489

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/475 (39%), Positives = 302/475 (63%), Gaps = 8/475 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A++G++GL +MG++L+ N+   G R+AVYN+ ++ T+ F+++  G     I ++ +++
Sbjct: 7   QEANVGVVGLAAMGASLARNLAHHGNRVAVYNRTYKRTEAFMQEY-GSEGVFIPSQTVKE 65

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            VE++  PR  ++MV  G+P DQ+I +L   +   DI++DGGN++F DT  R  ++++ G
Sbjct: 66  FVESLSVPRTAIIMVKAGEPTDQVIKELAEYMEQGDIIVDGGNAYFEDTIRREKEMAKLG 125

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           I+F+G+GVSGG +GA +G S+M GG++ ++N ++ IL SI+AK  +  PC A +GP+G+G
Sbjct: 126 IHFVGMGVSGGEEGALNGPSMMPGGSDWSWNTLKPILESIAAKAPDGEPCVAHIGPNGAG 185

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEYA+MQLIA+ Y ++R  L   P +I  +F++W+  +L SYL++ITAE+L
Sbjct: 186 HFVKMVHNGIEYADMQLIAESYDLMRRGLGMAPEQIGDVFAQWNETELDSYLVEITAEVL 245

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDE 297
              D  TG P++DVI D A  KGTG  ++     L   +T    A+FAR LS     R++
Sbjct: 246 RKRDEKTGKPLVDVIVDHAGMKGTGTWTVQTALSLGVPVTGIAEAVFARGLSDQTQLREQ 305

Query: 298 SKKMQSFFNPSSHFPL--KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           ++K   F  P +   L  +   +F++ +  ALYAS I+++ QGF  I ++ + Y W + +
Sbjct: 306 AQK-DPFNGPDASLALDDEAKQAFIELIRQALYASKIVAYAQGFNEIAEAGKVYGWDIDM 364

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
           A +ARIWRAGCIIR++ LN I  +     +  +LL  P   + ++    + R+++ T  E
Sbjct: 365 AQLARIWRAGCIIRAKFLNRISDAFESGAADVSLLFAPYFKQALENCEAAWRKVIATAVE 424

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           +G P P  S++L+YFD     R  A LIQ QRD FG+H + R D+    H  W +
Sbjct: 425 HGIPTPVFSSSLAYFDGLRAKRLPAALIQGQRDLFGAHTYQRVDEPGAFHTLWAE 479


>gi|255325966|ref|ZP_05367056.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rothia
           mucilaginosa ATCC 25296]
 gi|255296981|gb|EET76308.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rothia
           mucilaginosa ATCC 25296]
          Length = 490

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/479 (41%), Positives = 302/479 (63%), Gaps = 8/479 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG+ GL  MG+NL+ N+   G+ +A++N+  E TD  + +  G     I T++L++
Sbjct: 5   KKAQIGVTGLAVMGANLARNLARNGYTVALHNRSVEKTDALLAE-HGADGDFIRTESLQE 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V+++  PR+IL+MV  G PVD +I++L P+L   DI++DGGNSHF DT  R   L+EKG
Sbjct: 64  LVDSLESPRRILIMVKAGAPVDAVIEQLTPMLDEGDIIIDGGNSHFPDTIRREHALAEKG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++F+G+GVSGG +GA  G S+M GG+ ++Y  +  +L  I+AK     +PCCA +  DG+
Sbjct: 124 LHFVGVGVSGGEEGALWGPSMMPGGSAESYKHLGPLLEKIAAKAPQDGAPCCAWISTDGA 183

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEYA+MQ+I + Y ILR      P + + +F  W+ G LSSYLI+ITAE+
Sbjct: 184 GHFVKMVHNGIEYADMQVIGEAYDILRSIAGIEPAQQAEIFKTWNEGDLSSYLIEITAEV 243

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D  TG P++DVI D A QKGTG+ +   G  L S ++    ++FAR LS    E +
Sbjct: 244 LAQVDAKTGKPLVDVIVDAAGQKGTGLWTAKAGLDLGSPVSAIAESVFARALSSSEREQR 303

Query: 300 KMQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +      P+         +    FV+D+  AL+AS ++++ QG  ++ ++ ++Y W L L
Sbjct: 304 EQAQRELPAGLIATTGIGAGDPEFVEDVRRALFASKLVAYAQGMDLLTRAGKEYGWDLKL 363

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA +WRAGCIIR+++L DI+ +   + +  N+L  P+    +++ +PS RR+V   T 
Sbjct: 364 DTIASLWRAGCIIRAELLGDIMAAYAGE-APANMLLAPAFKNLMEELVPSWRRVVAKATA 422

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            G PVP  ++ALSY+D    DR  A+LIQ QRDFFG+H + R D+    H  W    +E
Sbjct: 423 LGIPVPVFASALSYYDGLRRDRLPASLIQGQRDFFGAHTYGRIDEEGAFHTMWSGDRSE 481


>gi|311115213|ref|YP_003986434.1| phosphogluconate dehydrogenase [Gardnerella vaginalis ATCC 14019]
 gi|310946707|gb|ADP39411.1| phosphogluconate dehydrogenase (decarboxylating) [Gardnerella
           vaginalis ATCC 14019]
          Length = 486

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 292/472 (61%), Gaps = 5/472 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A+IG++GL +MGSNL+ N+   G  +AVYN+ +  T+  + +  G     +  K +E+ 
Sbjct: 7   RANIGVVGLAAMGSNLARNLAHHGNTVAVYNRHYSRTETLMNE-HGSEGAFVPAKTVEEF 65

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ +PR  ++MV  G P D +I++L   + P DI++DGGNS+F DT  R   +  +G+
Sbjct: 66  VASLKRPRTAIIMVKAGAPTDAVIEELANAMEPGDIIVDGGNSYFEDTIRRERNIRARGL 125

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +++G GVSGG +GA  G S+M GG E+++  +  IL SI+A  +  PC   +G DG+GHF
Sbjct: 126 HYVGCGVSGGEEGALRGPSMMPGGTEESWKTLGPILKSIAAVAEGEPCVTHIGTDGAGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++   L     EI+ +FS+W+ G+L SYLI+ITA++L  
Sbjct: 186 VKMVHNGIEYSDMQLIAESYDLMLRGLGMKSDEIADVFSEWNKGELDSYLIEITADVLRQ 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--LYRDESKK 300
            D  TG P+++++ D A  KGTG  ++     L   +T    A+FAR LS  +   E+ +
Sbjct: 246 KDAKTGKPLVEMMVDHAGMKGTGTWTVQSALSLGIPVTGIAEAVFARGLSSQVALREAAE 305

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q    P  HF L   +  +F++D+  ALYAS I+S+ QGF  I  ++ ++ W +  A +
Sbjct: 306 SQGLTGPDMHFDLNDAERKAFIEDIRQALYASKIVSYAQGFDEIAAAAIEHDWKIDQAAV 365

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR+Q LN + ++     +S +L+  P   + ++K+  + RR++    E+G 
Sbjct: 366 ARIWRGGCIIRAQFLNRVSEAFESGQASVSLIFAPYFKDAIEKSQAAWRRVIARAVEHGV 425

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           PVP+ S+ L+Y+D     R  A+LIQAQRDFFG+H + R D+    H  W +
Sbjct: 426 PVPAFSSLLAYYDGLRSKRLPASLIQAQRDFFGAHTYGRIDEPGVFHTLWAE 477


>gi|240171764|ref|ZP_04750423.1| 6-phosphogluconate dehydrogenase [Mycobacterium kansasii ATCC
           12478]
          Length = 483

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 281/465 (60%), Gaps = 1/465 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   + + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKE-HGSEGRFVRSETIPEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR++L+MV  GDP D +I++L   + P DI++DGGN+ + DT  R   +  +G++
Sbjct: 70  AALQTPRRVLIMVKAGDPTDAVINELADAMEPGDIIIDGGNALYTDTIRREKAMRGRGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA  G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHFV
Sbjct: 130 FVGAGISGGEEGALHGPSIMPGGPAESYESLGPLLEEISAHVDGVPCCTHIGPDGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L  +  +I+ +F++W+ G L SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLLRDGLGLSAPQIAEVFTEWNKGDLDSYLVEITAEVLRHN 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS   ++    + 
Sbjct: 250 DAKTGKPLVDVILDQAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVEQRTAARG 309

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +          D+F +++  ALYAS I+++ QGF  I   S +Y W +S   +A IWR
Sbjct: 310 LASGRLGDQPADPDTFTENVRRALYASKIVAYAQGFNQIQAGSTEYGWDISPGDLATIWR 369

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I ++   DP+  +LL  P     V+  I S RR+V T  + G P P  
Sbjct: 370 GGCIIRAKFLNRIKEAFDADPNLASLLVAPYFRSAVESAIDSWRRVVSTAVQLGIPTPGF 429

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           S+ALSY+D    +R  A L QAQRDFFG+H + R D   + H  W
Sbjct: 430 SSALSYYDALRTERLPAALTQAQRDFFGAHTYGRIDGPGKFHTLW 474


>gi|320159553|ref|YP_004172777.1| 6-phosphogluconate dehydrogenase [Anaerolinea thermophila UNI-1]
 gi|319993406|dbj|BAJ62177.1| 6-phosphogluconate dehydrogenase [Anaerolinea thermophila UNI-1]
          Length = 470

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 296/471 (62%), Gaps = 2/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M  A+IG+IGLG MG NL LN+   GF +AV+NK       FI+      ++++  + L 
Sbjct: 1   MTLANIGVIGLGVMGRNLVLNMERNGFTVAVFNKTTAKMHEFIQG-DAAGKRIVGYETLA 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +V+ + +PR+IL+MVT G  VD +I +LKPLL P DIL+DGGNS+F DT+ RS +L   
Sbjct: 60  DLVKGLERPRRILLMVTAGAAVDAVIAELKPLLEPGDILIDGGNSYFLDTERRSRELEAS 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++F+G+GVSGG +GA  G S+M GG+ +A+  +  IL +I+A+ ++ +PC   +GP G+
Sbjct: 120 GLWFVGMGVSGGEEGALWGPSIMPGGSPEAWQALAPILQAIAARAEDGAPCVTHIGPGGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEYA+MQLIA+IY +L      +  +++ +F++W+ G+L SYLI+IT+ +
Sbjct: 180 GHYVKMVHNGIEYADMQLIAEIYDLLSRGAGMSADQLADVFAEWNEGELKSYLIEITSHV 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L   D +TG P++DVI D+A QKGTG  +      L + +   + A+ +R+LS  ++   
Sbjct: 240 LRRKDDLTGKPLVDVILDEAQQKGTGKWTGQNALDLGAPVPTIQAAVESRSLSAMKERRV 299

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                               V+    ALYA+ I+++ QGF ++  +S++Y ++L LA +A
Sbjct: 300 LASRVLGGPKPMYQGEVKPLVEAARQALYAAKIIAYAQGFELMSMASQEYQYNLQLAELA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIWRAGCIIR+ +L +I  +   DP+  NLL  P+ ++ V +   + R ++ T    G P
Sbjct: 360 RIWRAGCIIRAALLEEITAAYRRDPALPNLLLDPAFAQAVAERQTNWRWLMQTAIGMGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
             +LS+AL+Y+D +  +R  ANLIQ  RD+FG+H + R D+    H  W +
Sbjct: 420 TLALSSALAYYDAYRSERLPANLIQGLRDYFGAHTYRRLDREGVFHTRWNE 470


>gi|269794955|ref|YP_003314410.1| 6-phosphogluconate dehydrogenase [Sanguibacter keddieii DSM 10542]
 gi|269097140|gb|ACZ21576.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Sanguibacter
           keddieii DSM 10542]
          Length = 479

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/474 (39%), Positives = 284/474 (59%), Gaps = 2/474 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GL  MG NL+ N    G+ +AV+N+ +  T+  I    G     + ++++E  
Sbjct: 4   RAQIGVTGLAVMGRNLARNFARHGYTVAVHNRSYAKTESLIAD-HGTDGDFVPSESMEDF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ +PRK+++MV  G P D +I +L PLL   DI++D GN+HF DT+ R  +L E G+
Sbjct: 63  VASLAQPRKVVIMVKAGGPTDAVIAELIPLLDEGDIVIDAGNAHFPDTRRREAELKEHGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA +G S+M GG++++Y  +  IL  ISAK    PCC  +G DG+GHF
Sbjct: 123 HFVGTGVSGGEEGALNGPSIMPGGSKESYEWLGPILEDISAKVDGVPCCTYVGSDGAGHF 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +L+  L  +  EI  +F++W+ G L S+LI+ITA++L  
Sbjct: 183 VKMVHNGIEYADMQLIAEAYDLLKQGLGASAKEIGEIFAEWNKGDLESFLIEITADVLQH 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG   +D+I D+A QKGTG  ++     L   +T    A FAR LS    +     
Sbjct: 243 VDAETGSAFVDIILDRAEQKGTGRWTVQNALDLGVPITGIAEATFARALSGSVPQRTAAN 302

Query: 303 SFFNP-SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                 +  + +   ++F++D+  ALYAS +++++QGF  I  +SE++ W +    +ARI
Sbjct: 303 GVLEAHAGAWDITDREAFIEDVRLALYASKVVAYSQGFDQIAAASEEFGWDIDRGAMARI 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++   +     LL        V   + + RR+V     NG P P
Sbjct: 363 WRGGCIIRARFLNRITEAYERNAELPLLLADEYFVSAVGHGVSAWRRVVSQAALNGVPTP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           + +++LSY+D    DR  ANLIQAQRDFFG+H + R DK    H  W    +ES
Sbjct: 423 AFASSLSYYDGVRADRLPANLIQAQRDFFGAHTYQRTDKAGVFHTEWSLDRSES 476


>gi|145223945|ref|YP_001134623.1| 6-phosphogluconate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|145216431|gb|ABP45835.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           gilvum PYR-GCK]
          Length = 484

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/473 (39%), Positives = 282/473 (59%), Gaps = 3/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G     + ++ + + +
Sbjct: 10  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSVAKTDALLAE-HGSDGNFVRSETIAEFL 68

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   +   DI++DGGN+ + DT  R   + E+G++
Sbjct: 69  DALEKPRRVLIMVKAGDPTDAVINELADAMEEGDIIIDGGNALYTDTIRREKAIRERGLH 128

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 129 FVGAGISGGEEGALNGPSIMPGGPAESYASLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 188

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L K+  EI+ +F +W+ G L S+L++ITA++L  +
Sbjct: 189 KMVHNGIEYSDMQLIGEAYQLLRDGLGKSAPEIADVFDEWNAGDLDSFLVEITAQVLRQT 248

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 249 DATTGTPLVDVILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVAQRKATTG 308

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +          + FV+D+  ALYAS I+++ QGF  I   S++Y W +    +ARIWR
Sbjct: 309 LASGDLGEKPGDAEQFVEDIRQALYASKIIAYAQGFNQIQAGSDEYDWDIKPGDMARIWR 368

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I  +   DP    L+  P   + ++  I S RR+VV  TE G P+P  
Sbjct: 369 GGCIIRAKFLNRITDAFDNDPGLPTLIVDPYFRDAIEAAIDSWRRVVVKATELGIPIPGF 428

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVSTE 474
           S+ALSY+D    +R  A L Q  RDFFG+H + R D   E   H  W    TE
Sbjct: 429 SSALSYYDGLRTERLPAALTQGLRDFFGAHTYGRIDTDRERRFHTLWSGDRTE 481


>gi|229822076|ref|YP_002883602.1| 6-phosphogluconate dehydrogenase, decarboxylating [Beutenbergia
           cavernae DSM 12333]
 gi|229567989|gb|ACQ81840.1| 6-phosphogluconate dehydrogenase, decarboxylating [Beutenbergia
           cavernae DSM 12333]
          Length = 486

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 284/473 (60%), Gaps = 2/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GL  MG NL+ N+    + +A++N+    T   +++  G     + ++ LE  V
Sbjct: 12  ADIGVTGLAVMGRNLARNLARHSYTVALHNRTHARTVSLVEE-HGDDGTFVPSERLEDFV 70

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PR +++MV  G   D +ID+L PLL   DI++D GN+HF DT  R   L  +G++
Sbjct: 71  ASLKRPRTVIIMVKAGAATDAVIDELVPLLEEGDIVVDAGNAHFPDTIRREEALRAQGLH 130

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA +G S+M GG  ++Y  +  +L  ISAK    PCC  +GP G+GHFV
Sbjct: 131 FVGTGVSGGEEGALNGPSIMPGGTRESYATLGPMLEDISAKVDGVPCCTYVGPGGAGHFV 190

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR  L  +  EI  +F++W+TG L S+LI+ITA++L   
Sbjct: 191 KMVHNGIEYADMQLIAEAYDLLRQGLGASAAEIGDIFAEWNTGDLESFLIEITADVLHHV 250

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG   +DV+ D+A QKGTG  ++  G  L   +T    A FAR LS    + +  + 
Sbjct: 251 DAATGSAFVDVVLDQAEQKGTGRWTVQNGLDLGVPITGIAEATFARALSGSVPQREAARG 310

Query: 304 FFNP-SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
                ++ + +K  D FV+D+  ALYAS +++++QGF  I  +S +Y W +    +ARIW
Sbjct: 311 TLPAHTAAWEVKDRDVFVEDVRRALYASKVVAYSQGFDQIAAASAEYGWDIDRGAMARIW 370

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ LN I ++   D     LL  P  ++ V   + S RRIV    +NG P P+
Sbjct: 371 RGGCIIRARFLNRITEAYERDAGLPLLLADPYFTDAVADGLQSWRRIVAGAAQNGVPTPA 430

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
            S++L+Y+D    +R  A LIQAQRDFFG+H + R D     H  W    +E+
Sbjct: 431 FSSSLAYYDGVRAERLPAALIQAQRDFFGAHTYRRVDSGGVFHTEWSGDRSET 483


>gi|258646865|ref|ZP_05734334.1| 6-phosphogluconate dehydrogenase, decarboxylating [Dialister
           invisus DSM 15470]
 gi|260404304|gb|EEW97851.1| 6-phosphogluconate dehydrogenase, decarboxylating [Dialister
           invisus DSM 15470]
          Length = 471

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/469 (41%), Positives = 296/469 (63%), Gaps = 6/469 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +  IG+IGL  MG+NL+ N+   G    VYN+  + T+ F+K+  G    +     LE++
Sbjct: 4   KGKIGLIGLAVMGANLARNLAGHGISTVVYNRSHDKTENFLKEF-GSDTNLSGAAALEEL 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ KPRKI++M+  G+ VD +I KL PLL  +DIL+DGGNS F DT+ RS ++   G+
Sbjct: 63  VNSLEKPRKIILMIKAGEAVDAMIAKLIPLLEKDDILIDGGNSFFEDTRRRSREMEALGV 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G+GVSGG +GA  G SLM GG  +AY+ +  IL ++SAK +   C   +GPDG+GH+
Sbjct: 123 HFVGMGVSGGEEGALHGPSLMPGGTREAYDALAPILKAVSAKAEGEACVDYMGPDGAGHY 182

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQ+IAD Y ++++ L     E++  +  W+  +LSSYL++ITA IL  
Sbjct: 183 VKMVHNGIEYADMQMIADTYFVMKNVLGMTVEEMADTWETWNKSELSSYLVEITARILRK 242

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLS-SSMTITETAIFARNLSLYRDESKKM 301
           +D +TG P++DVI D A QKGTG  + +    L   + TITE A+FAR +S  ++E   +
Sbjct: 243 ADEMTGKPLVDVILDVAKQKGTGRWTSMSALALGVPAPTITE-AVFARTMSSQKEERLVL 301

Query: 302 QSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
              +   + F     D  + ++DL  ALYAS I ++ QGF ++ ++ + Y W L +  IA
Sbjct: 302 SERYRDLA-FEGTEVDRPAVLEDLRQALYASKICAYAQGFNLLEEAGKVYGWDLQMGRIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWR+GCIIR++ L+ + +   ++   TNLL     S+ +        RI+    E G  
Sbjct: 361 KIWRSGCIIRARFLDTVSEIFEKENGMTNLLASGYFSQVLYGARAGWGRIISLAVERGAA 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+LS+AL+YFD++   RG+ANL+QAQRD FG+H ++R DK    H  W
Sbjct: 421 VPALSSALAYFDSYRTARGSANLLQAQRDCFGAHTYERIDKEGAFHTDW 469


>gi|323304757|gb|EGA58517.1| Gnd2p [Saccharomyces cerevisiae FostersB]
 gi|323308929|gb|EGA62161.1| Gnd2p [Saccharomyces cerevisiae FostersO]
          Length = 492

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 278/470 (59%), Gaps = 6/470 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
            D+G++GL  MG NL LN  D GF +  YN+     D F+       + +I   ++E +V
Sbjct: 6   GDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLAN-EAKGKSIIGATSIEDLV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + KPRKI++++  G PVD LI +L P L   DI++DGGNSHF DT  R  +L+++GI 
Sbjct: 65  AKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTKQGIL 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+ +A+  ++NI  SI+AK    PCC  +GP GSGH+V
Sbjct: 125 FVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGSGHYV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F KW+TG L S+LI+IT +IL   
Sbjct: 185 KMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFD 244

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D + G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  +DE K+   
Sbjct: 245 D-VDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRASK 303

Query: 304 FFNPSSHFPLKCF---DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                +  P       + FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA 
Sbjct: 304 LLAAPT-VPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIAL 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  +DP   NLL     +  V K     RR +      G P 
Sbjct: 363 MWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P+ S AL+++D +  +R  ANL+QAQRD+FG+H F    + +  H P  K
Sbjct: 423 PAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDK 472


>gi|119025646|ref|YP_909491.1| 6-phosphogluconate dehydrogenase [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765230|dbj|BAF39409.1| 6-phosphogluconate dehydrogenase [Bifidobacterium adolescentis ATCC
           15703]
          Length = 487

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/476 (38%), Positives = 290/476 (60%), Gaps = 5/476 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A++G++GL +MG +L+ N+   G ++AV+N+ +  T+  + +  G  +     K LE+ 
Sbjct: 9   EANVGVVGLAAMGGSLARNLAHHGNKVAVFNRTYARTEKLMNEHGGEGE-FYPAKTLEEF 67

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR  ++MV  G+P D +I+ L  L+ P DI++D GN++F D   R  ++S +G+
Sbjct: 68  VDSLVKPRTAIIMVKAGEPTDAMINALADLMEPGDIIVDAGNAYFPDIIRREKEISARGL 127

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G GVSGG +GA  G S+M GG+E+++  ++ I  SI+AK +  PC   +G +G+GHF
Sbjct: 128 HFVGCGVSGGEEGALLGPSMMPGGSEESWKTLKPIFESIAAKAEGEPCVTHIGLNGAGHF 187

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQLIA+ Y ++R  L   P EI  +F +W+  +L SYLI+ITAE+L  
Sbjct: 188 VKMVHNGIEYSDMQLIAESYDLMRRGLGMTPAEIGDVFEEWNKTELDSYLIEITAEVLHQ 247

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD--ESKK 300
            D  TG P++D+I D A  KGTG  ++     L+  +T    A+FAR LS   D  E  +
Sbjct: 248 VDKKTGKPLVDLIVDHAGMKGTGTWTVQTALSLAVPVTGIAEAVFARGLSSEADLREEAQ 307

Query: 301 MQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            Q F  P     L   +  +F++D+  ALYAS I+++ QGF  I  ++++Y W + LA +
Sbjct: 308 KQGFAGPDGKLNLNDDEKKAFIEDIRQALYASKIVAYAQGFNEITTAAKEYGWDIDLAAV 367

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIWR GCIIR++ LN I ++     ++ +LL  P     ++    S R +V     NG 
Sbjct: 368 ARIWRGGCIIRAKFLNRISEAFESGEANVSLLFAPYFKNAIENAEKSWRNVVAQAAINGL 427

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P P+ +++LSYFD     R  A LIQ QRD+FG+H + R D+    H  W +   E
Sbjct: 428 PTPAFASSLSYFDGLRSKRLPAALIQGQRDYFGAHTYQRVDQPGAFHTLWAEPGRE 483


>gi|190406738|gb|EDV10005.1| 6-phosphogluconate dehydrogenase [Saccharomyces cerevisiae RM11-1a]
 gi|256272654|gb|EEU07631.1| Gnd2p [Saccharomyces cerevisiae JAY291]
 gi|259146757|emb|CAY80014.1| Gnd2p [Saccharomyces cerevisiae EC1118]
 gi|323354901|gb|EGA86734.1| Gnd2p [Saccharomyces cerevisiae VL3]
          Length = 492

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/469 (42%), Positives = 278/469 (59%), Gaps = 6/469 (1%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE 64
           D+G++GL  MG NL LN  D GF +  YN+     D F+       + +I   ++E +V 
Sbjct: 7   DLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLAN-EAKGKSIIGATSIEDLVA 65

Query: 65  AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF 124
            + KPRKI++++  G PVD LI +L P L   DI++DGGNSHF DT  R  +L+++GI F
Sbjct: 66  KLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTKQGILF 125

Query: 125 IGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVK 184
           +G GVSGG  GAR G SLM GG+ +A+  ++NI  SI+AK    PCC  +GP GSGH+VK
Sbjct: 126 VGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGSGHYVK 185

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEY +MQLI + Y I++        EIS +F KW+TG L S+LI+IT +IL   D
Sbjct: 186 MVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFDD 245

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
            + G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  +DE K+    
Sbjct: 246 -VDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRASKL 304

Query: 305 FNPSSHFPLKCF---DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               +  P       + FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA +
Sbjct: 305 LAAPT-VPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIALM 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIRS  L +I K+  +DP   NLL     +  V K     RR +      G P P
Sbjct: 364 WRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIPTP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           + S AL+++D +  +R  ANL+QAQRD+FG+H F    + +  H P  K
Sbjct: 424 AFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDK 472


>gi|149179288|ref|ZP_01857850.1| 6-phosphogluconate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148841862|gb|EDL56263.1| 6-phosphogluconate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 478

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/472 (41%), Positives = 282/472 (59%), Gaps = 6/472 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + DIG++GL  MG NL LN+ + G+ + V+N+   +TD F+   +   Q +     L+
Sbjct: 1   MSKHDIGLVGLAVMGQNLVLNMANHGYSVGVFNRTTSVTDEFVSSKTD-EQNITGYHTLK 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V+ +  PRKI++MV  G  VD +ID LK +LSP DI++DGGN+HF DT  R+ ++ + 
Sbjct: 60  ELVDNLASPRKIMLMVKAGPAVDSIIDDLKGMLSPGDIIIDGGNTHFDDTNRRTKEVEDA 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS---PCCALLGPD 177
           G+ FIG GVSGG +GA  G S+M GG+   +  V++IL  ISAK   +   PCC  +G  
Sbjct: 120 GLLFIGTGVSGGEEGALKGPSIMPGGSPAGWPHVKSILQDISAKVGENNDIPCCEWVGEA 179

Query: 178 GSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA 237
           G+GH+VKM+HNGIEY +MQLI + Y IL+ +L     E+  +F +W+ G+L SYLI+IT 
Sbjct: 180 GAGHYVKMVHNGIEYGDMQLICESYYILKHALGLTNQELYKVFDEWNQGELESYLIEITR 239

Query: 238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +I +  D  TG  ++D I D A QKGTG         L    T+   A++AR LS  +D 
Sbjct: 240 DIFTVIDEETGEYLVDEILDTAKQKGTGKWMSQHALDLGVPTTLITEAVYARCLSAQKDA 299

Query: 298 SKKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +     + P   F     D F++D+  ALYAS + S+ QG+  +  ++E + W+L+  
Sbjct: 300 RVRASKILSGPDKKFEGD-RDQFIEDVRQALYASKLCSYAQGYVQLNSAAEHFGWNLNNG 358

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA +WR GCIIRS  L DI  +  ++P   NLL        V+K  PS RR V T  E 
Sbjct: 359 DIALLWRGGCIIRSTFLQDIKAAFDKNPQLENLLLDDFFRNAVEKAQPSWRRAVATAVEL 418

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G PVPS +AALSYFD +   R  ANL+QAQRD+FG+H + R DK    H  W
Sbjct: 419 GLPVPSFTAALSYFDGYRQARLPANLLQAQRDYFGAHTYQRTDKEGTFHTDW 470


>gi|297204033|ref|ZP_06921430.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           sviceus ATCC 29083]
 gi|297148564|gb|EDY58987.2| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           sviceus ATCC 29083]
          Length = 479

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 288/468 (61%), Gaps = 5/468 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   +++  G     I  +  ++ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVALHNRTASRTHALVEEF-GSEGDFIAAETAKEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+P D +I +  PLL P D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVIMVKAGEPTDAVIQEFAPLLEPGDMIIDGGNAHFADTRRRERELREQGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G+GVSGG +GA +G S+M GG +++Y+ +  +L  ISAK  + +PC   +GPDG+GHF
Sbjct: 124 FVGMGVSGGEEGALNGPSIMPGGPKESYDSLGPMLEKISAKAADGAPCVTHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P +I+ +F  W+TG+L SYLI+ITAE+LS 
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPAQIADIFRTWNTGRLDSYLIEITAEVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS + +  +  +
Sbjct: 244 VDAATGKPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAELREASR 303

Query: 303 SFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               P +  PL   +  +F   +E ALYAS I+S+TQGF  I  + E+Y W + L  ++ 
Sbjct: 304 GLAGPKAS-PLSKSEAGAFADRVEQALYASKIVSYTQGFHEIAAAREEYDWDIDLGAVSA 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+  L+ I  +        +LL+  + ++++       R +++  T  G PV
Sbjct: 363 IWRGGCIIRAAFLDRIRSAYDTRADLPSLLSDDTFAQEIASAQDDWRDVIIAATRQGVPV 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  SAAL+Y+D    +R  A L Q QRDFFG+H + R D+    H  W
Sbjct: 423 PGFSAALAYYDALRAERLPAALTQGQRDFFGAHTYRRTDRDGSFHTLW 470


>gi|329964396|ref|ZP_08301477.1| phosphogluconate dehydrogenase [Bacteroides fluxus YIT 12057]
 gi|328525445|gb|EGF52493.1| phosphogluconate dehydrogenase [Bacteroides fluxus YIT 12057]
          Length = 507

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 294/466 (63%), Gaps = 6/466 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT-- 56
           + + DIG+IGL  MG NL+LN+ DKG+ ++VYN+     +  V  + I+G ++   +   
Sbjct: 20  LNKTDIGLIGLAVMGENLALNMADKGWNVSVYNRTVPGVEEGVVERFINGRAKGKSIQGY 79

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++   V ++  PRKI+MMV  G  VD+L+++L P LS  DIL+DGGNS++ DT  R   
Sbjct: 80  TDISDFVSSIKAPRKIMMMVRAGSAVDELMEQLFPYLSAGDILIDGGNSNYEDTNRRVAL 139

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
             +KG  F+G GVSGG +GA +GAS+M GG+E A+  +  +L SI+AK  + +PCC  +G
Sbjct: 140 AEKKGFRFVGAGVSGGEEGALNGASIMPGGSESAWEEIRPVLQSIAAKSSDGTPCCGWIG 199

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+ N  +++ +FS W+ GKL SYLI+I
Sbjct: 200 PAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKQLLDLNNEQMAEVFSHWNEGKLRSYLIEI 259

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA IL   D   G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  +
Sbjct: 260 TANILRHKDKAGGC-LIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQK 318

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
              +     F       +      VKD+ +ALYAS ++S+ QGF V+ ++S+ + W L L
Sbjct: 319 GLRETAAKQFVCQRSQAVYNKTELVKDIYSALYASKLVSYAQGFAVLQRASDAFGWKLDL 378

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
           A+IAR+WR GCIIRS  LNDI  +     +  +LL  P   +++++ +   + +V    +
Sbjct: 379 ASIARMWRGGCIIRSVFLNDIAAAFEAKDNPRHLLLAPYFKKEMQQLLSGWKHLVAQSMK 438

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
              PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 439 EELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 484


>gi|229100966|ref|ZP_04231767.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus cereus
           Rock3-28]
 gi|228682463|gb|EEL36539.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacillus cereus
           Rock3-28]
          Length = 469

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 291/470 (61%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++  IGI+G+G MG +L+LN   KG+ +A+Y+   E  D  I++  G  + ++ T  +E
Sbjct: 1   MEKLQIGIVGVGVMGKSLALNFESKGYSVALYDISKEKVDEIIEENRG--KNLVGTHIVE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G+  D+ ID L P L   DIL+DGGN++F DT  R+ +L+E+
Sbjct: 59  EFVNSLESPRKILLMVNAGEITDKAIDSLVPHLDKGDILIDGGNTYFVDTIRRNKRLAEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG GVSGG +GA  G S+M GG + AY +V+++L +ISAK  N PCC+ +GP+G+G
Sbjct: 119 GINFIGAGVSGGEEGALKGPSIMPGGQKDAYEKVKDMLENISAKVNNEPCCSYIGPNGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI + Y  L+ +L+    E   +F++W+ G+L+SYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWNKGELNSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG P++DVI D A QKGTG  +      L  S+ I   ++FAR +S  ++E   
Sbjct: 239 KKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGISLPIITESVFARCISALKEERVN 298

Query: 301 MQSFFN-PSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                + P     +    +  ++ +  ALY S I S+ QGF  +  +SE+Y W L   +I
Sbjct: 299 ASKILSGPKDKTAIGVEKAELIEAVRQALYMSKICSYAQGFTQLKAASEEYDWDLDFGSI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           + +WR GCIIR+  L +I ++   +    NLL  P   E V+     LR+I+    + G 
Sbjct: 359 SMLWRGGCIIRAAFLQNIKEAYETNTDLPNLLLDPYFKEIVESYQGGLRQIISMAVQQGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P+P+ SAA+SY+D++   +  ANL+QAQRD+FG+H + R DK    H  W
Sbjct: 419 PIPAFSAAISYYDSYRTAKLPANLLQAQRDYFGAHTYKRVDKEGTFHTKW 468


>gi|282889751|ref|ZP_06298290.1| hypothetical protein pah_c004o119 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500325|gb|EFB42605.1| hypothetical protein pah_c004o119 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 483

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/467 (41%), Positives = 288/467 (61%), Gaps = 6/467 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +ADIG+IGL  MG NL+LN+ D GF++AV+N+     D F++  +  +Q +    +LE
Sbjct: 1   MSEADIGLIGLAVMGQNLALNMNDHGFKVAVFNRTVSKVDEFLEGPAKGTQ-IYGAHSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
                + +PRKI++MV  GD VD  ID   P +   DI++DGGNS F D+  R+  L EK
Sbjct: 60  DFFAHLKRPRKIMLMVKAGDAVDHFIDLCLPHMEKGDIIIDGGNSLFTDSTRRTKALKEK 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGS 179
           GI FIG G+SGG +GAR G S+M GGN   +  ++NI  SISAK  N+ PCC  +G DG+
Sbjct: 120 GIIFIGAGISGGEEGARHGPSIMPGGNPDGWPHLKNIFQSISAKVDNNEPCCDWVGEDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLI + Y +L++ L  N  ++  +FS+W+  +L SYLI+IT++I
Sbjct: 180 GHYVKMVHNGIEYGDMQLICEAYTLLKNVLGLNADQLHEVFSEWNKQELDSYLIEITSQI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            +  D   G P+++ I D A QKGTG  ++I    L   +T+   A+FAR LS  ++E  
Sbjct: 240 FTYKDK-DGSPLVEKILDVAGQKGTGKWTVINALDLGMPLTLISEAVFARCLSAIKEERV 298

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           +        +         F++++ +ALYAS I+S+ QGF ++ ++++ Y W+L+   IA
Sbjct: 299 EASKVLKGPNTTYKGDRKEFIQNIRHALYASKIISYAQGFMLMHQAAQDYKWNLNYGGIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L  I ++ T+ P   NLL  P     +++     R+ V T  E G P
Sbjct: 359 LMWRGGCIIRSLFLGKIKEAYTKTPQLKNLLLDPFFYTAIEQAQTGWRKAVATAAELGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           VP  S ALS++D +   R  ANL+QAQRDFFG+H ++R   I +P G
Sbjct: 419 VPCFSTALSFYDGYRTARLPANLLQAQRDFFGAHTYER---IDQPRG 462


>gi|320095131|ref|ZP_08026840.1| 6-phosphogluconate dehydrogenase [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|319977998|gb|EFW09632.1| 6-phosphogluconate dehydrogenase [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 488

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 282/470 (60%), Gaps = 4/470 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG MG+NL+ N+   G+  AV+N+    T+  I +  G     + +  LE  V
Sbjct: 11  ADIGVYGLGVMGANLARNLARNGYTTAVFNRTQARTEKLISEHGG-EATFVPSSTLEDFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR  ++MV  G   D ++++L  L+   DI++D GNS F DT  R    +E+G++
Sbjct: 70  ASLRAPRVAIIMVQAGPATDAVMEQLAALMDEGDIIVDCGNSLFADTIRREKWAAERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG   +Y R+  +  +ISA Y   PCC  +G +G+GHFV
Sbjct: 130 FVGAGVSGGEEGALWGPSIMPGGTRASYERLGPMFEAISATYDGVPCCTYIGANGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+IA+ Y +LR+ L   P +I+ +F+ W+ G+L+SYLI+ITAE+L   
Sbjct: 190 KMVHNGIEYADMQVIAEAYTLLREGLGAAPAQIADIFAAWNEGELNSYLIEITAEVLRQV 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSL---YRDESKK 300
           D  TG+P++D+I D ASQKGTG  ++     L+  +T    A FAR  S     R   +K
Sbjct: 250 DASTGVPLVDLIVDAASQKGTGKWTVQTALDLAVPVTAIGEATFARGASCEPAQRAAGQK 309

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +     P      +   +FV+D+  AL+AS I++++QGF  IG  + +Y W +    +AR
Sbjct: 310 LAGNATPLVIETDEARAAFVEDVRRALFASKIVAYSQGFDEIGAGAAEYGWDIDKGALAR 369

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+DI ++   DP+   LL     + + ++  P+LRRIV      G P+
Sbjct: 370 IWRAGCIIRAAFLDDITRAYEADPALPLLLAAEPFATRFQECTPALRRIVSQAALAGVPI 429

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P  +++L+YFD     R  A LIQ QRDFFGSH + R D+    H  W +
Sbjct: 430 PVFASSLAYFDQIRAARLPAALIQGQRDFFGSHTYRRVDREGIFHTLWAE 479


>gi|116618032|ref|YP_818403.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
 gi|116096879|gb|ABJ62030.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
          Length = 475

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 204/477 (42%), Positives = 292/477 (61%), Gaps = 15/477 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M+QAD G++GL  MG NL+LNI  +G+R+AVYN+  E TD  ++K     +  I +   E
Sbjct: 1   MEQADFGVVGLAVMGRNLALNIESRGYRVAVYNRSRERTDDLVQKHE--DKAFIPSYTTE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE + KPR+IL+MV  G   D +ID+L P L   D+L+DGGN++F DT  RS +L+++
Sbjct: 59  EFVETIKKPRRILLMVKAGKGTDAVIDELLPHLEKGDMLIDGGNTYFEDTIRRSDKLAQE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDG 178
           GI FIG+GVSGG  GA  G SLM GG  +AY+ V  IL  I+AK      P    +GP+G
Sbjct: 119 GINFIGMGVSGGELGALQGPSLMPGGQREAYDLVAPILTQIAAKAPEDGKPTVTYIGPNG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y IL+  L+ N  ++S  FS W+ G+L+SYL++ITA+
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDILKRVLHLNQEQLSQTFSGWNEGELNSYLVEITAD 238

Query: 239 ILSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           IL+  D + T  PI+DVI D+A  KGTG  S     ++ +  ++   +++AR +S  +D+
Sbjct: 239 ILTRKDDLGTDKPIVDVILDRAGNKGTGKWSSQSALEVGAPQSLITESVYARYISAMKDD 298

Query: 298 ----SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSL 353
               SK +Q    P   F      S V+D+  ALY   I+S+ QGF  +  +SE Y W L
Sbjct: 299 RVAASKTLQ---GPDYSFSGDE-QSTVEDIRKALYFGKIMSYAQGFDQLRMASEHYDWHL 354

Query: 354 SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTC 413
               +A++WRAG IIR+Q L  I  + T      NLL  P      ++   + RR+V   
Sbjct: 355 PFGELAQLWRAGAIIRAQFLQRITDAFTTQADLHNLLLDPYFQHIAEEYQNAARRVVALA 414

Query: 414 TENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPW 468
              G P PSLSAA++Y+D++      ANL QAQRD+FG+H ++R DK +    H PW
Sbjct: 415 VTAGVPTPSLSAAVAYYDSYRSAVLPANLTQAQRDYFGAHTYERTDKPAGEMYHYPW 471


>gi|151943530|gb|EDN61841.1| 6-phosphogluconate dehydrogenase [Saccharomyces cerevisiae YJM789]
          Length = 492

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 278/470 (59%), Gaps = 6/470 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
            D+G++GL  MG NL LN  D GF +  YN+     D F+       + +I   ++E +V
Sbjct: 6   GDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLAN-EAKGKSIIGATSIEDLV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + KPRKI++++  G PVD LI +L P L   DI++DGGNSHF DT  R  +L+++GI 
Sbjct: 65  AKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTKQGIL 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+ +A+  ++NI  SI+AK    PCC  +GP GSGH+V
Sbjct: 125 FVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGSGHYV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F KW+TG L S+LI+IT +IL   
Sbjct: 185 KMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFD 244

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D + G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  +DE K+   
Sbjct: 245 D-VDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRASK 303

Query: 304 FFNPSSHFPLKCF---DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                +  P       + FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA 
Sbjct: 304 LLAGPT-VPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIAL 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  +DP   NLL     +  V K     RR +      G P 
Sbjct: 363 MWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P+ S AL+++D +  +R  ANL+QAQRD+FG+H F    + +  H P  K
Sbjct: 423 PAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDK 472


>gi|6321695|ref|NP_011772.1| Gnd2p [Saccharomyces cerevisiae S288c]
 gi|1703016|sp|P53319|6PGD2_YEAST RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 2
 gi|1323466|emb|CAA97285.1| GND2 [Saccharomyces cerevisiae]
 gi|1502359|emb|CAA67612.1| 6-phospho-gluconate dehydrogenase [Saccharomyces cerevisiae]
 gi|51013073|gb|AAT92830.1| YGR256W [Saccharomyces cerevisiae]
 gi|285812447|tpg|DAA08347.1| TPA: Gnd2p [Saccharomyces cerevisiae S288c]
          Length = 492

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 278/470 (59%), Gaps = 6/470 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
            D+G++GL  MG NL LN  D GF +  YN+     D F+       + +I   ++E +V
Sbjct: 6   GDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLAN-EAKGKSIIGATSIEDLV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + KPRKI++++  G PVD LI +L P L   DI++DGGNSHF DT  R  +L+++GI 
Sbjct: 65  AKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTKQGIL 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+ +A+  ++NI  SI+AK    PCC  +GP GSGH+V
Sbjct: 125 FVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGSGHYV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F KW+TG L S+LI+IT +IL   
Sbjct: 185 KMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFD 244

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D + G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  +DE K+   
Sbjct: 245 D-VDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRASK 303

Query: 304 FFNPSSHFPLKCF---DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
                +  P       + FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA 
Sbjct: 304 LLAGPT-VPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIAL 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  +DP   NLL     +  V K     RR +      G P 
Sbjct: 363 MWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P+ S AL+++D +  +R  ANL+QAQRD+FG+H F    + +  H P  K
Sbjct: 423 PAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDK 472


>gi|196228758|ref|ZP_03127624.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chthoniobacter
           flavus Ellin428]
 gi|196227039|gb|EDY21543.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chthoniobacter
           flavus Ellin428]
          Length = 484

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/458 (41%), Positives = 282/458 (61%), Gaps = 3/458 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADI +IGL  MG NL +N+ D GF +  YN+     D F+        KVI   ++E+MV
Sbjct: 5   ADIAVIGLAVMGQNLIMNMNDHGFTVVAYNRTTAKVDEFLAN-EAKGSKVIGVHSVEEMV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           + + +PR++++MV  G PVD+ ID + P L   DI++DGGNS + DT  R   +  KG+ 
Sbjct: 64  KNLKRPRRVMLMVKAGKPVDEFIDHILPYLEAGDIIIDGGNSLYEDTARRVKYVESKGLL 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           +IG GVSGG +GAR G S+M GG+  A+  V++I  SI+AK  + SPCC  +G  G+GH+
Sbjct: 124 YIGTGVSGGEEGARKGPSIMPGGSPAAWPHVKDIFQSIAAKVADGSPCCDWVGEGGAGHY 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + Y  ++D L   P E+S  F++W+  +L SYLI+IT +IL+ 
Sbjct: 184 VKMVHNGIEYGDMQLICEAYQFMKDGLGMTPDEMSEEFAEWNKAELDSYLIEITRDILAK 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D   G P++D I D A QKGTG  ++I    L   +T+   A+++R +S  +D   +  
Sbjct: 244 KDE-DGSPLVDKILDTAGQKGTGKWTVISSADLGIPITLMAEAVYSRCVSSMKDLRVEAS 302

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
             F P +         + KDL  ALYAS I+S+ QG+ ++  ++E+  W+L+   IA +W
Sbjct: 303 KAFKPGNPKITGDRKQWTKDLAQALYASKIVSYAQGYMLMRAAAEQNGWNLNYGGIALMW 362

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIRS  L DI  +  ++   +NLL  P   + +K    S R++V T  + G PVP+
Sbjct: 363 RGGCIIRSAFLGDIKDAFDKNKKLSNLLLAPFFKKAIKSAQRSWRKVVSTAVKKGIPVPA 422

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            S AL++FD F  +R  ANL+QAQRD+FG+H ++R DK
Sbjct: 423 FSTALAFFDGFRSERLPANLLQAQRDYFGAHTYERTDK 460


>gi|41407655|ref|NP_960491.1| 6-phosphogluconate dehydrogenase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41396008|gb|AAS03874.1| Gnd [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 489

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/459 (40%), Positives = 281/459 (61%), Gaps = 5/459 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   K +  + + + +
Sbjct: 15  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKE-HGDEGKFVRCETIAEFL 73

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 74  DALEKPRRVLIMVKAGDPTDAVINELADAMEPGDIIIDGGNALYTDTIRREQAMRERGLH 133

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 134 FVGAGISGGEEGALNGPSIMPGGPAESYRSLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 193

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD+L K   +I+ +F +W++G L S+L++ITA++L  +
Sbjct: 194 KMVHNGIEYSDMQLIGEAYQLLRDALGKTAEQIADVFDEWNSGDLDSFLVEITAQVLRQT 253

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++     L   +T    A+FAR LS    + +    
Sbjct: 254 DAKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVAQRRATTG 313

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               S  F  K  D+  F +D+  ALYAS I+++ QGF  I   S +Y W ++   +A I
Sbjct: 314 L--ASGRFGEKPSDAAQFTEDIRQALYASKIIAYAQGFNQIQAGSAEYGWDITPGDLATI 371

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I  +  E+P    L+  P     ++  I   RR+VVT T  G P+P
Sbjct: 372 WRGGCIIRAKFLNRIKDAFDENPDLPTLIVAPYFRSAIEAAIDGWRRVVVTATRLGIPIP 431

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
             S+ALSY+D    +R  A L Q  RDFFG+H + R D+
Sbjct: 432 GFSSALSYYDALRTERLPAALTQGLRDFFGAHTYGRIDE 470


>gi|317125591|ref|YP_004099703.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Intrasporangium
           calvum DSM 43043]
 gi|315589679|gb|ADU48976.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Intrasporangium
           calvum DSM 43043]
          Length = 478

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/474 (40%), Positives = 289/474 (60%), Gaps = 6/474 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIV-TKNLEQ 61
           QA+IG+IGL  MGSNL+ N+   G  +AV+N+    T   ++  S  ++   V  + LE+
Sbjct: 6   QANIGVIGLAVMGSNLARNLARHGHTVAVFNRTHARTLAHLE--SHRAEGAFVGAETLEE 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V A+ +PR++++MV  G   D +ID+L PLL   DI++DGGN+HF DT+ R  +L E G
Sbjct: 64  FVAALVRPRRVVIMVQAGPGTDAVIDQLAPLLEEGDIIVDGGNAHFEDTRRREARLREVG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++F+G G+SGG  GA  G S+M GG+ ++Y  +  IL SI+A+    PCCA LGPDG+GH
Sbjct: 124 LHFVGTGISGGEVGALEGPSIMPGGSPESYAALGPILESIAAQVDGEPCCAHLGPDGAGH 183

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQ IA+ Y +L  +    P E + +F +W+TG+L S+LI+ITAE+L 
Sbjct: 184 FVKMVHNGIEYADMQFIAEAYDVLTAAGLTAP-EAADVFREWNTGELDSFLIEITAEVLD 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++++I D A QKGTG+ ++    +L   ++    ++FAR+ S  R   +  
Sbjct: 243 QVDAATGRPLVELIVDAAEQKGTGLWTVQTALELGVPVSTIAESVFARSASGDRAVREAA 302

Query: 302 QSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +     P    P       V D+ +AL++S ++++ QG   I K+S++Y W + +AT+AR
Sbjct: 303 RGVLRGPDRELPAVERRQLVDDVRDALWSSKVVAYAQGLEQIRKASDEYHWGVDIATVAR 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIR+++L  I         +T LL  PSI   + +   + RR+V   T  G PV
Sbjct: 363 LWRGGCIIRARLLKQISDEYAVGRLAT-LLVAPSIRSGLAERQGAWRRVVAAATTAGVPV 421

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  S+AL+Y+DT   +R  A L+Q  RD FG+H + R D+    H  W    TE
Sbjct: 422 PGFSSALAYYDTVRAERLPAALVQGLRDNFGAHTYGRVDRAGAFHTLWSSDRTE 475


>gi|227545335|ref|ZP_03975384.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri CF48-3A]
 gi|300908585|ref|ZP_07126048.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri SD2112]
 gi|146345345|gb|ABQ23684.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri]
 gi|227184617|gb|EEI64688.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri CF48-3A]
 gi|300893992|gb|EFK87350.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri SD2112]
          Length = 478

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/479 (40%), Positives = 299/479 (62%), Gaps = 20/479 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A IG++GL  MG NL+LNI  +GF + VYN+    TD  ++  S   +K++ +  +++
Sbjct: 4   QKAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDDMMRDHS--DKKLVPSYTVKE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ KPR+ILMMV  G P D LID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVDSLEKPRRILMMVKAGKPTDALIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK +    PC A +GP+G+
Sbjct: 122 INFIGMGVSGGELGALHGPSLMPGGQKEAYDLVAPILTKIAAKAEEDGKPCVAYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADI 241

Query: 240 LSSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           L+  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +D
Sbjct: 242 LTRKDDLGDDKNKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKD 301

Query: 297 ESKKMQSFFNPSSHFPLKCF-------DSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           E  ++Q+    S   P++            ++ +  ALY   ++S+ QGF  +   SE+Y
Sbjct: 302 E--RVQA----SKELPVETEAISIDDKKEMIEKVRQALYFGKLMSYAQGFEQMRIDSERY 355

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L    +A+IWRAGCIIR+Q L +I  + T++P   NLL      +  KK   + R +
Sbjct: 356 DWNLKYGELAQIWRAGCIIRAQFLQNITDAFTKNPDLKNLLLDDYFKDIAKKYQKATRDV 415

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSLSAA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 416 VTLAVKAGIPVPSLSAAISYYDSYRSEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 474


>gi|186686329|ref|YP_001869525.1| 6-phosphogluconate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186468781|gb|ACC84582.1| 6-phosphogluconate dehydrogenase Gnd, decarboxylating [Nostoc
           punctiforme PCC 73102]
          Length = 476

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/475 (40%), Positives = 289/475 (60%), Gaps = 6/475 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-KKISGLSQKVIVTKNL 59
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+ ++ +G + K   T  L
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMAQRATGRNVKAAFT--L 58

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E+ V  + +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DT+ R+ +L  
Sbjct: 59  EEFVALLERPRKILVMVQAGKPVDAVIAQLKPLLEEGDIIIDGGNSWFEDTERRTQELEP 118

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGS 179
            G+ ++G+GVSGG +GA +G SLM GG   +Y  +  I   I+A+  + PC   +GP GS
Sbjct: 119 AGLRYLGMGVSGGEEGALNGPSLMPGGTTSSYEFLSPIFNKIAAQVDDGPCVTYIGPGGS 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAE 238
           GH+VKM+HNGIEY +MQLIA+ Y +L++    NP ++  +F++W+ T +L S+LI+IT  
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAEAYDLLKNVAGLNPSQLHDVFAEWNTTDELDSFLIEITKN 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  T  P++D+I D A QKGTG  ++    +L  ++     A+ AR +S  +DE 
Sbjct: 239 IFPYIDPETNKPLVDLIVDAAGQKGTGRWTVQTALELGVAIPTITAAVNARIISSIKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                    PS  +  +  D F+  + +ALY S I S+ QG  ++  +S+ Y+W+L L  
Sbjct: 299 VAASKVLTGPSGKYDGQTKD-FINKVRDALYCSKICSYAQGMALLSTASKTYNWNLDLGE 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIW+ GCIIR++ LN I K+ +E+P+  NLL  P   + +     + R ++ T    G
Sbjct: 358 MARIWKGGCIIRARFLNKIKKAFSENPALPNLLLAPEFKQTILDRQTAWREVIATAATVG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
            PVP+ SA+L YFD++  DR   NL QAQRD+FG+H + R DK    H  W  ++
Sbjct: 418 IPVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYLRLDKPGSFHTEWVPIA 472


>gi|94969838|ref|YP_591886.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Candidatus
           Koribacter versatilis Ellin345]
 gi|94551888|gb|ABF41812.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Candidatus
           Koribacter versatilis Ellin345]
          Length = 482

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/461 (41%), Positives = 293/461 (63%), Gaps = 10/461 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A  G++GLG MG NL+LN+ D G  ++V+N + +    F+ + S   +K+  + +L++ V
Sbjct: 12  AQFGVVGLGVMGQNLALNVSDHGQVVSVWNLEADWVTKFLTQHS--DRKMTGSGDLKEFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +++ +PR+ILMM+  G+PVDQ++DKL PLL P DI++DGGNS F DTQ R      K + 
Sbjct: 70  QSLARPRRILMMIMAGNPVDQMLDKLAPLLEPGDIVIDGGNSFFKDTQRREAAYRTKNLN 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F G+GVSGG +GAR G SLM GG+E +Y  ++  L +I+AK     C   +GP+G+GHFV
Sbjct: 130 FFGMGVSGGEEGARFGPSLMPGGDEASYEHLKPTLEAIAAKTDYGACVTYVGPNGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLIA+ Y +LR +L     EI+ +F +W+ GKL SYLI+IT+ +L   
Sbjct: 190 KMVHNGIEYGDMQLIAEAYDLLRKALGLGAKEIAAIFEEWNKGKLESYLIEITSHVLQVD 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE----SK 299
           D  TG P++D+I DKA QKGTG  +      L+  +     A+ AR LS  +DE    SK
Sbjct: 250 DPETGKPLVDMILDKAGQKGTGKWTQQIALDLAVPIPTIGAALDARVLSSMKDERVAASK 309

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           K+ +   PS  +       F+  +++ALYAS + S+ QG  +I   S++++W+++L  +A
Sbjct: 310 KLGA---PSRQYSGDK-KEFINAVQDALYASKVCSYAQGMSLIRAGSKEWNWNVNLREMA 365

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIW  GCIIR+++L DI+ +   D +  NLL     + +V ++  + R +V T    G P
Sbjct: 366 RIWTGGCIIRARLLADIMHAFDRDANVANLLVESEFTSRVLESEKNWRSVVQTAAGLGIP 425

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            P+ S++L+YFD++   +   NL QAQRDFFG+H + R D+
Sbjct: 426 TPAFSSSLAYFDSYRSMQLPQNLTQAQRDFFGAHTYQRADR 466


>gi|184154309|ref|YP_001842650.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri JCM 1112]
 gi|194467209|ref|ZP_03073196.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           reuteri 100-23]
 gi|227364113|ref|ZP_03848211.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri MM2-3]
 gi|325683317|ref|ZP_08162833.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri MM4-1A]
 gi|183225653|dbj|BAG26170.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri JCM 1112]
 gi|194454245|gb|EDX43142.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           reuteri 100-23]
 gi|227070838|gb|EEI09163.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri MM2-3]
 gi|324977667|gb|EGC14618.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri MM4-1A]
          Length = 478

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/479 (40%), Positives = 299/479 (62%), Gaps = 20/479 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A IG++GL  MG NL+LNI  +GF + VYN+    TD  ++  S   +K++ +  +++
Sbjct: 4   QKAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDDMMRDHS--DKKLVPSYTVKE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ KPR+ILMMV  G P D LID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVDSLEKPRRILMMVKAGKPTDALIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK +    PC A +GP+G+
Sbjct: 122 INFIGMGVSGGELGALHGPSLMPGGQKEAYDLVAPILTKIAAKAEEDGKPCVAYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADI 241

Query: 240 LSSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           L+  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +D
Sbjct: 242 LTRKDDLGDDKSKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKD 301

Query: 297 ESKKMQSFFNPSSHFPLKCF-------DSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           E  ++Q+    S   P++            ++ +  ALY   ++S+ QGF  +   SE+Y
Sbjct: 302 E--RVQA----SKELPVETEAISIDDKKEMIEKVRQALYFGKLMSYAQGFEQMRIDSERY 355

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L    +A+IWRAGCIIR+Q L +I  + T++P   NLL      +  KK   + R +
Sbjct: 356 DWNLKYGELAQIWRAGCIIRAQFLQNITDAFTKNPDLKNLLLDDYFKDIAKKYQKATRDV 415

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSLSAA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 416 VALAVKAGIPVPSLSAAISYYDSYRSEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 474


>gi|315444277|ref|YP_004077156.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           sp. Spyr1]
 gi|315262580|gb|ADT99321.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           sp. Spyr1]
          Length = 484

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 282/473 (59%), Gaps = 3/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G     + ++ + + +
Sbjct: 10  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSVAKTDALLAE-HGSDGNFVRSETIAEFL 68

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  G+P D +I++L   +   DI++DGGN+ + DT  R   + E+G++
Sbjct: 69  DALEKPRRVLIMVKAGEPTDAVINELADAMEEGDIIIDGGNALYTDTIRREKAIRERGLH 128

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 129 FVGAGISGGEEGALNGPSIMPGGPAESYASLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 188

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L K+  EI+ +F +W+ G L S+L++ITA++L  +
Sbjct: 189 KMVHNGIEYSDMQLIGEAYQLLRDGLGKSAPEIADVFDEWNAGDLDSFLVEITAQVLRQT 248

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 249 DATTGTPLVDVILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVAQRKATTG 308

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +          + FV+D+  ALYAS I+++ QGF  I   S++Y W +    +ARIWR
Sbjct: 309 LASGDLGEKPGDAEQFVEDIRQALYASKIIAYAQGFNQIQAGSDEYDWDIKPGDMARIWR 368

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I  +   DP    L+  P   + ++  I S RR+VV  TE G P+P  
Sbjct: 369 GGCIIRAKFLNRITDAFDNDPDLPTLIVDPYFRDAIEAAIDSWRRVVVKATELGIPIPGF 428

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVSTE 474
           S+ALSY+D    +R  A L Q  RDFFG+H + R D   E   H  W    TE
Sbjct: 429 SSALSYYDGLRTERLPAALTQGLRDFFGAHTYGRIDTDREKRFHTLWSGDRTE 481


>gi|306817933|ref|ZP_07451671.1| 6-phosphogluconate dehydrogenase [Mobiluncus mulieris ATCC 35239]
 gi|307701303|ref|ZP_07638324.1| phosphogluconate dehydrogenase (decarboxylating) [Mobiluncus
           mulieris FB024-16]
 gi|304649276|gb|EFM46563.1| 6-phosphogluconate dehydrogenase [Mobiluncus mulieris ATCC 35239]
 gi|307613464|gb|EFN92712.1| phosphogluconate dehydrogenase (decarboxylating) [Mobiluncus
           mulieris FB024-16]
          Length = 486

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 281/472 (59%), Gaps = 8/472 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IG+  MGSNL+ N    G+++A+YN+ +  T   ++   G +   I T+ L   V
Sbjct: 5   ADIGVIGMAVMGSNLAQNFARNGYKVAIYNRTYARTQDVMEHY-GATAGFIPTETLGDFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ KPR  ++MV  G P D  ID+L  L+ P DI++D GNS F DT  R   ++ KG+ 
Sbjct: 64  AALEKPRCAIVMVKAGTPTDSTIDQLCELMEPGDIIVDCGNSLFTDTIRRERTVTAKGLN 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGSGH 181
           F+G GVSGG +GA  G ++M GG  ++Y R+  +L  I+AK      PCC  +G DG+GH
Sbjct: 124 FVGCGVSGGEEGALKGPAIMPGGTAESYRRLGPMLEKIAAKAPEDGEPCCTHIGTDGAGH 183

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKMIHNGIEYA+MQ+I++ Y ILR SL  +  EI+ +F +W+ G L SYLI+IT E+L 
Sbjct: 184 FVKMIHNGIEYADMQVISEAYDILRKSLGLSAPEIADIFEEWNQGDLDSYLIEITVEVLR 243

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++D++ D+A QKGTG  ++     L    T    A FAR LS    + +  
Sbjct: 244 HLDQETGRPLVDLVLDQAKQKGTGTWTVQTALDLGVPTTGIAEATFARGLSSSLKQREMA 303

Query: 302 QSF-----FNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
           Q          ++H P+    +F++D+  ALYAS I+++TQG  +I   +++Y W + L 
Sbjct: 304 QLVCKALSLENATHEPVNDKAAFIEDVRQALYASKIVAYTQGLNLIQVGAKEYHWDIDLG 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
             ARIWRAGCIIR++ L D+ ++   +P    LL       K+++ +P  RR+V   T  
Sbjct: 364 ETARIWRAGCIIRARFLEDVTRAYRRNPELALLLADDYFFAKIREAMPHWRRLVTFATMR 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G P+P  S++LSY D        ANLIQ QRDFFG+H + R+DK    H  W
Sbjct: 424 GIPIPVFSSSLSYLDGIRDPELPANLIQIQRDFFGAHTYQRRDKTGVFHTLW 475


>gi|29346632|ref|NP_810135.1| 6-phosphogluconate dehydrogenase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338529|gb|AAO76329.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides
           thetaiotaomicron VPI-5482]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 305/472 (64%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  VE++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVESIATPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ +L SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPVLQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y ++++ ++    E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLIDLTNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+IT+ IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITSNILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  ++        F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKELRHLASKQFLCKHTLPIYNKAELVKEIFSALYASKLVSYAQGFAVLQRASDSF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 357 GWNLDLASIARMWRGGCIIRSIFLNDIAAAFEAADKPKHLLLAPYFREEIKSLLPGWKNL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +   D   ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSDNLPANLVQAQRDYFGAHTFERKDEL 468


>gi|254821993|ref|ZP_05226994.1| 6-phosphogluconate dehydrogenase [Mycobacterium intracellulare ATCC
           13950]
          Length = 489

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/475 (40%), Positives = 284/475 (59%), Gaps = 7/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   K + ++ + + +
Sbjct: 15  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKEHGG-DGKFVRSETIAEFL 73

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   +   DI++DGGN+ + DT  R   + E+G++
Sbjct: 74  DALEKPRRVLIMVKAGDPTDAVINELADAMEKGDIIIDGGNALYTDTIRREKAMRERGLH 133

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 134 FVGAGISGGEEGALNGPSIMPGGPAESYKSLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 193

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L K   EI+ +F +W++G L S+L++ITA++L  +
Sbjct: 194 KMVHNGIEYSDMQLIGEAYQLLRDGLGKTAGEIADVFDEWNSGDLDSFLVEITAQVLRQT 253

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 254 DAKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVTQRKATTG 313

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               S     K  D+  F +D+  ALYAS I+++ QGF  I   S +Y W ++   +A I
Sbjct: 314 L--ASGGLGTKPGDAKQFTEDIRQALYASKIIAYAQGFNQIQAGSAEYDWGITPGDLATI 371

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I  +  EDP    L+  P     ++  I   RR+VVT T+ G P+P
Sbjct: 372 WRGGCIIRAKFLNRIKDAFDEDPDLPTLIVAPYFRSAIEDAIDGWRRVVVTATQLGIPIP 431

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVSTE 474
             S+ALSY+D    +R  A L Q  RDFFG+H + R D   +   H  W    TE
Sbjct: 432 GFSSALSYYDALRTERLPAALTQGLRDFFGAHTYGRIDDDPDKRFHTLWSGDRTE 486


>gi|313203053|ref|YP_004041710.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paludibacter
           propionicigenes WB4]
 gi|312442369|gb|ADQ78725.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Paludibacter
           propionicigenes WB4]
          Length = 501

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 292/476 (61%), Gaps = 19/476 (3%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFIKKISGLSQKVIV 55
           MK+ADIG+IGL  MG NL+LN+  KGF +AVYN+        + D FI    G  +  I 
Sbjct: 14  MKKADIGLIGLAVMGENLALNMESKGFTVAVYNRTVPGIEEGVVDRFINA-RGAGKNFIG 72

Query: 56  TKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSL 115
           +  +   V+++  PRK+ MMV  G PVD+LI++L PLL P DI++DGGNSH+ DT  R+ 
Sbjct: 73  STEMRDFVQSIAAPRKVFMMVKAGKPVDELIEQLIPLLEPGDIIIDGGNSHYPDTIRRTG 132

Query: 116 QLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALL 174
            +  KG+ F+G GVSGG +GA  G S+M GG+  A+  V+ I  +ISAK ++ +PCC  +
Sbjct: 133 YVESKGLLFVGTGVSGGEEGALLGPSMMPGGSPAAWPAVKEIFQAISAKVEDGTPCCDWV 192

Query: 175 GPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIK 234
           G  G+GHFVKM+HNGIEY +MQ+I + Y +++D L  +  E+  +F +W+ G L SYLI+
Sbjct: 193 GEGGAGHFVKMVHNGIEYGDMQIITEAYQVMKDLLGMSADEMHEVFKEWNKGDLDSYLIE 252

Query: 235 ITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLY 294
           ITAEIL+  D   G P+++ I D A QKGTG  + +        +T+   ++FAR LS  
Sbjct: 253 ITAEILAYKDE-KGEPLVEKILDTAGQKGTGKWTAVTALDFGIPLTLIGESVFARCLS-- 309

Query: 295 RDESKKMQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYS 350
               K+++   + S   P   F       + DL++A++ + I+S+ QG+ ++ +++ +Y 
Sbjct: 310 --AQKELRVLASQSIQGPKASFTGDKVQLIADLKDAVFGAKIISYAQGYNLMKEAANEYK 367

Query: 351 WSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIV 410
           W+L+   IA +WR GCIIRS  L DI K+   +P+  NLL  P     V+K     RR+ 
Sbjct: 368 WNLNYGGIALMWRGGCIIRSIFLADIKKAFETNPALENLLLDPYFKGVVEKAQAGWRRVC 427

Query: 411 VTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
                NG PVP+L++AL YFD     +  ANL+QAQRD+FG+H ++R D   +P G
Sbjct: 428 AAALTNGIPVPALTSALCYFDGLRTAQLPANLLQAQRDYFGAHTYERTD---QPRG 480


>gi|255692076|ref|ZP_05415751.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           finegoldii DSM 17565]
 gi|260622227|gb|EEX45098.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides
           finegoldii DSM 17565]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 304/472 (64%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWNVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+++L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKDFVDSIATPRKIMMMVRAGSPVDELMEQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKASDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L+ N  E++  FS+W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLLDLNNEEMADAFSRWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITANILRHKDK-TGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  ++   +    F      P+      VKD+ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKELRHQASHHFPRQHTQPIYNKVELVKDIFSALYASKLVSYAQGFAVLQRASDTF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K ++   + +
Sbjct: 357 GWQLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLMAPYFREEMKASLSGWKSL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       AN++QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSADLPANMVQAQRDYFGAHTFERKDEL 468


>gi|134100929|ref|YP_001106590.1| 6-phosphogluconate dehydrogenase [Saccharopolyspora erythraea NRRL
           2338]
 gi|291003458|ref|ZP_06561431.1| 6-phosphogluconate dehydrogenase [Saccharopolyspora erythraea NRRL
           2338]
 gi|133913552|emb|CAM03665.1| 6-phosphogluconate dehydrogenase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 479

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/478 (41%), Positives = 286/478 (59%), Gaps = 13/478 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYN----KDFELTDVFIKKISGLSQKVIVTKNL 59
           A IG+ GL  MG NL+ N    G+ +AV+N    K  EL D F     G     +  ++ 
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYAVAVHNRTASKTRELMDEF-----GQEGDFVAAESA 59

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E  V A+ +PR++++MV  GDP D +I +  PLL   D+++DGGN+HF DT+ R  +L E
Sbjct: 60  EDFVAALERPRRLVVMVKAGDPTDAVIREFAPLLEHGDVIIDGGNAHFADTRRRERELRE 119

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDG 178
            GI+F+G G+SGG +GA  G S+M GG++++Y  +  +L  ISAK  + +PC   +GPDG
Sbjct: 120 HGIHFVGTGISGGEEGALHGPSIMPGGSDESYASLGPMLEKISAKAADGAPCVTHVGPDG 179

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GHFVKM+HNGIEYA+MQLIA+ Y +LR+    +P  I+ +F  W+TG+L SYLI+ITAE
Sbjct: 180 AGHFVKMVHNGIEYADMQLIAEAYHLLREVAGFSPARIAEIFRTWNTGRLDSYLIEITAE 239

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +LS  D  TG P +DV+ D+A QKGTG  ++    +L   ++    A+FAR+LS +    
Sbjct: 240 VLSHVDAATGEPFVDVVADQAEQKGTGRWTVQIALELGLPVSGIAEAVFARSLSGHTALR 299

Query: 299 KKMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
              +    P+   PL   +  +F   +E ALYAS I+S+TQGF  I   S +Y W++ L 
Sbjct: 300 AASRGLAGPTP-APLGESEAAAFADQVEQALYASKIVSYTQGFHEIATGSAEYGWNIDLG 358

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            +A IWRAGCIIR+  L+ +  +    P   +LL+  + + ++       R ++V  T  
Sbjct: 359 AVAAIWRAGCIIRAAFLDRVRAAYDARPDLPSLLSDEAFAREIAAAQDDWRAVLVAATRQ 418

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           G P P  SAAL+Y+DT   DR  A L Q QRD+FG+H + R D+    H  W    +E
Sbjct: 419 GVPTPGFSAALTYYDTLRADRLPAALTQGQRDYFGAHTYRRTDREGVFHTLWSGDRSE 476


>gi|253567922|ref|ZP_04845333.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           1_1_6]
 gi|298387642|ref|ZP_06997193.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           1_1_14]
 gi|251841995|gb|EES70075.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           1_1_6]
 gi|298259498|gb|EFI02371.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           1_1_14]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 305/472 (64%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  VE++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVESIATPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ +L SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPVLQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y ++++ ++    E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLIDLTNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+IT+ IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITSNILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  ++        F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKELRHLASKQFLCKHTLPVYNKAELVKEIFSALYASKLVSYAQGFAVLQRASDAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 357 GWNLDLASIARMWRGGCIIRSIFLNDIAAAFEAADKPKHLLLAPYFREEIKSLLPGWKNL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +   D   ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSDNLPANLVQAQRDYFGAHTFERKDEL 468


>gi|315605487|ref|ZP_07880524.1| 6-phosphogluconate dehydrogenase [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|315312754|gb|EFU60834.1| 6-phosphogluconate dehydrogenase [Actinomyces sp. oral taxon 180
           str. F0310]
          Length = 488

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 280/470 (59%), Gaps = 4/470 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG MG+NL+ N+   G+  AV+N+    TD  + +  G     + +  LE  V
Sbjct: 11  ADIGVYGLGVMGANLARNLARNGYATAVFNRTPARTDKLMAE-HGEEATFVPSSTLEDFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR  ++MV  G   D + ++L  L+   DI++D GNS F DT  R    +E+G++
Sbjct: 70  ASLRAPRVAIIMVQAGPATDAVTEQLAALMDEGDIIVDCGNSLFADTIRREKWAAERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG   +Y R+  +  +ISA Y   PCC  +G +G+GHFV
Sbjct: 130 FVGAGVSGGEEGALWGPSIMPGGTRASYERLGPMFEAISATYDGVPCCTYIGANGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+IA+ Y +LR+ L   P +I+ +F+ W+ G+L+SYLI+ITAE+L   
Sbjct: 190 KMVHNGIEYADMQVIAEAYTLLREGLGATPAQIADIFAAWNEGELNSYLIEITAEVLRQV 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSL---YRDESKK 300
           D  TG+P++D+I D ASQKGTG  ++     L+  +T    A FAR  S     R   +K
Sbjct: 250 DASTGVPLVDLIVDAASQKGTGKWTVQTALDLAVPVTAIGEATFARGASCEPAQRAAGQK 309

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +     P      +   +FV+D+  AL+AS I++++QGF  I   + +Y W +    +AR
Sbjct: 310 LAGNATPLVIETDEARAAFVEDVRRALFASKIVAYSQGFDEIEAGAAEYGWDIDKGALAR 369

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+DI ++   DPS   LL     + + ++  P+LRRIV      G P+
Sbjct: 370 IWRAGCIIRAAFLDDITRAYEADPSLPLLLAAEPFATRFQECTPALRRIVSQAALAGVPI 429

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           P  +++L+YFD     R  A LIQ QRDFFGSH + R D+    H  W +
Sbjct: 430 PVFASSLAYFDQIRATRLPAALIQGQRDFFGSHTYRRIDREGVFHTRWAE 479


>gi|261343403|ref|ZP_05971048.1| 6-phosphogluconate dehydrogenase, decarboxylating [Providencia
           rustigianii DSM 4541]
 gi|282568545|gb|EFB74080.1| 6-phosphogluconate dehydrogenase, decarboxylating [Providencia
           rustigianii DSM 4541]
          Length = 468

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 292/474 (61%), Gaps = 10/474 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +++YN+  + TD  I +  G  +K++    +E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIYNRSQDKTDEVIAENPG--KKLVPNYTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN+ + DT  R+ +LSE+
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIAALTPHLDKGDILIDGGNTLYKDTIRRNRELSEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+AK +  PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAKAEGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+ SLN N  E++ +F +W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKGSLNLNNEELAEIFGEWNQGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE--- 297
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR LS  +D+   
Sbjct: 239 KKKDE-EGTYLVDVILDEAANKGTGKWTSQSALDLGIPLTLITESVFARYLSFLKDQRVA 297

Query: 298 -SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
            SK +      S     K    F++ +  ALY   I+S+ QGF  +  +S++Y+W L+  
Sbjct: 298 ASKVLTGPVAKSVEGDKKV---FIEKVRRALYLGKIVSYAQGFQQLKAASDEYNWDLNYG 354

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA+I+RAGCIIR+Q L  I  +  ++    NLL  P   +   +   +LR +V    +N
Sbjct: 355 EIAKIFRAGCIIRAQFLQKITDAYNDNAKIANLLLAPYFKQIADEYQQALRDVVCYGVQN 414

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           G P P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 415 GIPTPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKDGVFHTEWME 468


>gi|256390344|ref|YP_003111908.1| 6-phosphogluconate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256356570|gb|ACU70067.1| 6-phosphogluconate dehydrogenase, decarboxylating [Catenulispora
           acidiphila DSM 44928]
          Length = 479

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 293/470 (62%), Gaps = 4/470 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   +++  G     + T+  E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARHGYTVALHNRTAARTHALVEEF-GSEGTFVPTETAEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +I++  PLL   D+++DGGN+HF DT+ R   L E+GI+
Sbjct: 64  AALERPRRLMIMVKAGEATDAVIEEFAPLLESGDMIIDGGNAHFLDTRRREKALRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG+ ++Y  +  +L +ISAK    PCC  +G DG+GHFV
Sbjct: 124 FVGSGVSGGEEGALHGPSVMPGGSAESYAVLGPMLEAISAKVDGEPCCTHIGTDGAGHFV 183

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR+  + +P +I+ +F  W+ G+L+SYLI+ITAEIL+ +
Sbjct: 184 KMVHNGIEYADMQLIAEAYDLLRNVADYSPAQIAEVFRGWNKGRLNSYLIEITAEILAHT 243

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P +D++ D A QKGTG  ++     + S  T    A FAR  S      +  ++
Sbjct: 244 DAATGKPFVDIVRDAAEQKGTGRWTVQTALDVGSPATAIAQATFARVASSRTALRETYRA 303

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               + H PL+  ++  +V  +E ALYAS ++++ QG+ +I  ++E++ W + LA +A I
Sbjct: 304 QAGGTEH-PLRAHETERYVATVEQALYASKVIAYDQGWTMIRDAAEEFGWDIDLADVAAI 362

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+  L+ I  + T D +  +LL+ P  ++++ K   S R ++ +    G PVP
Sbjct: 363 WRGGCIIRAAFLDRIRAAYTGDATLPSLLSEPEFADEIAKAQVSWREVIASAARRGIPVP 422

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
           + SAAL+YFDT   DR  A LIQ QRDFFG+H + R D+    H  W + 
Sbjct: 423 AFSAALAYFDTLSADRLPAALIQGQRDFFGAHTYHRTDRDGAFHTRWAET 472


>gi|118618426|ref|YP_906758.1| 6-phosphogluconate dehydrogenase [Mycobacterium ulcerans Agy99]
 gi|118570536|gb|ABL05287.1| 6-phosphogluconate dehydrogenase Gnd1 [Mycobacterium ulcerans
           Agy99]
          Length = 483

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 287/473 (60%), Gaps = 5/473 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKE-HGAEGKFVRSETISEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR++L+MV  G+P D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 70  AALETPRRVLIMVKAGEPTDAVINELADAMEPGDIIIDGGNALYTDTIRREKAVRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPAESYTSLGPLLEEISAHVDGVPCCTHIGPDGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L  +  +I+ +FS+W+ G L SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFSEWNKGDLDSYLVEITAEVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS      ++  +
Sbjct: 250 DAKTGKPLVDVILDQAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALS--GSVQQRAAA 307

Query: 304 FFNPSSHFPLKCF--DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              PS     K    D+F +++  AL+AS I+++ QGF  I   S ++ W ++   +A I
Sbjct: 308 VGLPSGRLGDKPADPDTFTENVRRALHASKIVAYAQGFNQIQAGSAEFGWDITPDDLATI 367

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++   +P+  +LL  P     ++  + S RR+V T  + G P P
Sbjct: 368 WRGGCIIRAKFLNRIKEAFDAEPALASLLVAPYFRSAIESAVDSWRRVVSTAAQLGIPTP 427

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             S+AL+Y+D    +R  A L QAQRDFFG+H + R D   + H  W    +E
Sbjct: 428 GFSSALAYYDALRTERLPAALTQAQRDFFGAHTYGRIDAAGKFHTLWSADRSE 480


>gi|218753549|ref|ZP_03532345.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis GM
           1503]
 gi|289761993|ref|ZP_06521371.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           GM 1503]
 gi|289709499|gb|EFD73515.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           GM 1503]
          Length = 482

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 284/474 (59%), Gaps = 8/474 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +AV+N+    TD  +K+ S    K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVAVHNRSVAKTDALLKEHSS-DGKFVRSETIPEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ KPR++L+MV  G+  D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 70  AALEKPRRVLIMVKAGEATDAVINELADAMEPGDIIIDGGNALYTDTMRREKAMRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPAESYQSLGPLLEEISAHVDGVPCCTHIGPDGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y ++RD L      I+ +F++W+ G L SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLMRDGLGLTAPAIADVFTEWNNGDLDSYLVEITAEVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS---LYRDESKK 300
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS     R  +  
Sbjct: 250 DAKTGKPLVDVIVDRAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVGQRSAASG 309

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           + S    SS  P     +F +D+  ALYAS I+++ QGF  I   S ++ W ++   +A 
Sbjct: 310 LASGKLGSSRRPA----TFTEDVRQALYASKIVAYAQGFNQIQAGSAEFGWDITPGDLAT 365

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ LN I ++    P+  +L+  P     V+  I S RR+V T  + G P 
Sbjct: 366 IWRGGCIIRAKFLNHIKEAFDASPNLASLIVAPYFRGAVESAIDSWRRVVSTAAQLGIPT 425

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  S+ALSY+D     R  A L QAQRDFFG+H + R D+  + H  W    TE
Sbjct: 426 PGFSSALSYYDALRTARLPAALTQAQRDFFGAHTYGRIDEPGKFHTLWSSDRTE 479


>gi|325263944|ref|ZP_08130677.1| 6-phosphogluconate dehydrogenase, decarboxylating [Clostridium sp.
           D5]
 gi|324030982|gb|EGB92264.1| 6-phosphogluconate dehydrogenase, decarboxylating [Clostridium sp.
           D5]
          Length = 468

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/471 (41%), Positives = 292/471 (61%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MK+ +IG+IGL  MG +L+LN+ D GF +  YN+  E+T+  +++     +  I   +++
Sbjct: 1   MKRTEIGVIGLAVMGRSLALNMADHGFMVGGYNRSREVTEELLREHP--HENFIPFYDMK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++VE+  +PRK L+MV  G PVD +I++L P L   D++LDGGNS F DT+ R   L EK
Sbjct: 59  ELVESQERPRKFLIMVKAGKPVDMVIEQLLPFLEEGDMILDGGNSFFEDTRGREKSLREK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI++ G GVSGG KGAR G ++M GG+ +AY  +  IL +I+AK Q  PCCA +GPDG+G
Sbjct: 119 GIFYFGTGVSGGEKGARFGPAIMPGGDREAYRHIAPILEAIAAKAQGEPCCAYMGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLIA+ Y +L+ +      E++  F++W+ G+L SYLI+ITA I 
Sbjct: 179 HYVKMVHNGIEYADMQLIAESYLLLKYAGGFTNEELADTFAEWNEGELRSYLIEITAGIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D +T   ++D I D A QKGTG  + +E  K   ++++   A  AR +S + DE K 
Sbjct: 239 REKDDLTDGELVDYILDSAGQKGTGRWTSLESLKQGVNVSMITAACNARIMSNHIDERKT 298

Query: 301 MQSFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            +  F      P    D   F +++   LY + I ++ QGF ++  +S++Y W L    I
Sbjct: 299 AKELFESPE--PTLAPDKAVFKENVREGLYTAKIAAYAQGFDLLSHASKEYGWDLDYGRI 356

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A I+RAGCII++Q L+DI ++  ++    NL+      E V +   SLR I+    +NG 
Sbjct: 357 AAIFRAGCIIQAQFLDDITRAFEKNGELKNLMMDSFFMEGVNRGQKSLRDIMSMGIQNGI 416

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           P+P++S A+SY D F      ANLIQAQRD FG+H ++R D+    H  W+
Sbjct: 417 PLPAMSQAVSYIDAFRGMPVGANLIQAQRDCFGAHTYERTDRGGIFHHDWR 467


>gi|297155341|gb|ADI05053.1| 6-phosphogluconate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 482

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 280/465 (60%), Gaps = 4/465 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           +G+ GLG MG NL+ N    G+ +AV+N+    T   I++  G     +  K  E+ V A
Sbjct: 10  LGVTGLGVMGRNLARNFARHGYPVAVHNRTVNRTHALIEEF-GHEGTFVPAKTAEEFVAA 68

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + +PR++++MV  G   D +ID+  PLL P D+++DGGN+HF DT+ R   L E+G++F+
Sbjct: 69  LERPRRLVIMVQAGAATDAVIDEFAPLLEPGDMIIDGGNAHFSDTRRREAALRERGLHFV 128

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G G+SGG +GA +G S+MVGG+ ++Y  +  +  +ISAK    PC   +G DG+GHFVKM
Sbjct: 129 GAGISGGEEGALNGPSIMVGGSAESYGVLGPMFEAISAKIDGEPCATHIGTDGAGHFVKM 188

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y +LR      P EI+ +F  W+ G+L SYLI+ITAE+L+ +D 
Sbjct: 189 VHNGIEYADMQLIAEAYDLLRQVAGYTPAEIADIFRTWNEGRLGSYLIEITAEVLAHTDA 248

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P +DV+ D A QKGTG  ++     L+S +T    A FAR  S  + E +      
Sbjct: 249 DTGGPFVDVVVDAAGQKGTGRWTVQTALDLASPVTAIAQATFARAAS-GQAELRAAYRGL 307

Query: 306 NPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
              +  PL   ++  F   +E+ALYAS ++++ QG+ +I  ++ +Y W + L  +ARIWR
Sbjct: 308 PGGTTPPLSRSEATRFTGQVEHALYASKVIAYDQGWKMIQDAAAEYGWKIDLGAVARIWR 367

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+  L+ I  +   DP   +L+   + + ++       R IV +    G PVP+ 
Sbjct: 368 GGCIIRASFLDRIRAAYAADPELVSLVGEKTFAAEITDAQVPWREIVASAARRGIPVPAF 427

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           S AL+Y+DT   DR  A L+Q QRDFFG+H + R D+    H  W
Sbjct: 428 STALAYYDTLRADRLPAALLQGQRDFFGAHTYRRTDRPGTFHTHW 472


>gi|37525507|ref|NP_928851.1| 6-phosphogluconate dehydrogenase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784935|emb|CAE13853.1| 6-phosphogluconate dehydrogenase, decarboxylating [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 468

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/471 (40%), Positives = 292/471 (61%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++ +  +E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVIAENPG--KKLVPSYTVE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN++F DT  R+ +LS +
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYFQDTIRRNRELSAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+AK +  PC A +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYKLVAPILQEIAAKAEGEPCVAYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+++LN +  E+S +F+ W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKNALNLSNEELSEIFTDWNNGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 239 HKKDE-AGQYLVDVILDEAANKGTGKWTSQSSLDLGIPVTLITESVFARYISSLKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P K   + F++ +  ALY   I+S+ QGF  +  +S++Y W L+   IA
Sbjct: 298 AAQVLSGPDVQPFKGDKAEFIEKVRRALYLGKIVSYAQGFQQLKAASDEYQWDLNYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+RAGCIIR+Q L  I  +  E+    NLL  P   +   +   +LR +V    +NG P
Sbjct: 358 GIFRAGCIIRAQFLQKITDAYNENVDIANLLLAPYFKKIADEYQQALRDVVSYGVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 418 TPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWME 468


>gi|330820932|ref|YP_004349794.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           gladioli BSR3]
 gi|327372927|gb|AEA64282.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           gladioli BSR3]
          Length = 470

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 290/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G  ++VYN+  + TD  I +     +K++ T  LE
Sbjct: 1   MGKQAIGVVGMAVMGRNLALNIESRGHAVSVYNRSRDKTDELIAEFP--DRKLVPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVASLETPRRILLMVKAGEATDATIAALKPLLGKGDVLIDGGNTHFTDTIRRNQELAQS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDG 178
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG
Sbjct: 119 GLHFIGTGVSGGEEGALHGPSIMPGGQRDAYDLVEPILKQIAAKAPGDGEPCVAYMGPDG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+     +  E+  ++++W+ G+L SYLI+IT++
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLSNEELGKVYTEWNQGELDSYLIEITSK 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           I    D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + + 
Sbjct: 239 IFDKKDEETGQHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTQR 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                    PS   P     +FV+ +  ALY S ++S+ QGF  +  +S++Y W L+L  
Sbjct: 299 VAASKVLKGPSPAKPEGDRAAFVEAVRRALYLSKVISYAQGFAQLDTASKEYGWKLNLGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IARI+RAGCIIR++ L  I  + T  P   NLL  P   E       +LR +VV   + G
Sbjct: 359 IARIFRAGCIIRARFLQKITDAYTASPELANLLLDPYFQEISTNYQQALRDVVVAAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 VPVPAFSSAVAYFDSYRSERLPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|323485336|ref|ZP_08090685.1| 6-phosphogluconate dehydrogenase [Clostridium symbiosum WAL-14163]
 gi|323694096|ref|ZP_08108275.1| 6-phosphogluconate dehydrogenase [Clostridium symbiosum WAL-14673]
 gi|323401372|gb|EGA93721.1| 6-phosphogluconate dehydrogenase [Clostridium symbiosum WAL-14163]
 gi|323501813|gb|EGB17696.1| 6-phosphogluconate dehydrogenase [Clostridium symbiosum WAL-14673]
          Length = 473

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 198/467 (42%), Positives = 288/467 (61%), Gaps = 8/467 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IGIIGL  MG +L+LN+ D GF++  YN+  E+T+  +++     + +I   +L+++V++
Sbjct: 8   IGIIGLAVMGRSLALNMADHGFKVGGYNRSREVTETLMREHP--HENLIPFYDLKELVDS 65

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
             +PRK L+MV  G PVD +ID+L PLL   D++LDGGNS F DT+ R  +L EKGIY+ 
Sbjct: 66  QERPRKFLIMVKAGKPVDMVIDQLLPLLDEGDMILDGGNSFFEDTRRREKELKEKGIYYF 125

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G GVSGG  GAR G S+M GG++KAY  +  IL  I+AK Q  PCCA +GPDG+GH+VKM
Sbjct: 126 GTGVSGGEMGARFGPSIMPGGDKKAYEHIAPILEEIAAKAQGEPCCAYMGPDGAGHYVKM 185

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y +L+ +      E++ +F++W+ G+L SYLI ITA I    D 
Sbjct: 186 VHNGIEYADMQLIAEAYLLLKYAGGFTNRELADVFTEWNKGELKSYLIGITAGIFREKDD 245

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            T   ++D I D A QKGTG  + +E  K   ++++   A  AR +S    E    +  F
Sbjct: 246 FTDGELVDYILDSAGQKGTGRWTSLESLKQGINVSMITAACNARIMSNRISERNAARELF 305

Query: 306 NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAG 365
                  +    +F + +   LY + I ++ QGF ++  +S +Y W L    IA I+RAG
Sbjct: 306 AGPMQNLVPDKAAFQEKVRKGLYTAKIAAYAQGFDLLSHASSEYGWDLDYGKIASIFRAG 365

Query: 366 CIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSA 425
           CII+++ L+DI K+ T +    NL+      + +     SLR I+ T  +NG PVP++S 
Sbjct: 366 CIIQAEFLDDITKAFTNNRELPNLMLDSFFRDGINHGQDSLRSILATGIQNGIPVPAMSQ 425

Query: 426 ALSYFDTFIHDRGT---ANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           A+SY D F   RGT   ANLIQAQRD FG+H ++R D+    H  W+
Sbjct: 426 AISYIDAF---RGTPVGANLIQAQRDCFGAHTYERTDRDGIFHHDWR 469


>gi|206901998|ref|YP_002251734.1| 6-phosphogluconate dehydrogenase, decarboxylating [Dictyoglomus
           thermophilum H-6-12]
 gi|206741101|gb|ACI20159.1| 6-phosphogluconate dehydrogenase, decarboxylating [Dictyoglomus
           thermophilum H-6-12]
          Length = 470

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/468 (41%), Positives = 294/468 (62%), Gaps = 3/468 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           +G+IGL  MG NL+LNI  KG+ ++VYN+  + T  F++K     +K+    +L+  VE+
Sbjct: 5   VGLIGLAVMGQNLALNIARKGYSISVYNRTPDRTKEFVEKRVK-EEKIYPYYDLKSFVES 63

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI++MV  G PVD +I++L P L P D+++DGGNS+F DT  R  +L EK I ++
Sbjct: 64  LEKPRKIILMVKAGQPVDDMINELLPYLEPGDLIIDGGNSYFKDTSRRIRELKEKEILYL 123

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+GVSGG  GA  G SLM GG ++AY  VE +LL I+AK ++ PCC  +G D +GHFVKM
Sbjct: 124 GMGVSGGEYGALHGPSLMPGGTKEAYKLVEEMLLKIAAKTEDGPCCTYVGDDSAGHFVKM 183

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA MQLIA++Y ++R  LN    EI  +F  W+ G+L+S+L++I+ +I+   D 
Sbjct: 184 VHNGIEYAIMQLIAEVYDVMRKVLNMTSEEIGDVFQTWNNGELNSFLMEISYKIMRRKDE 243

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM-QSF 304
            TG P+++VI DKA QKGTG  +      L         A+ AR +S ++D    + ++ 
Sbjct: 244 ETGKPLVEVILDKAEQKGTGKWTSQTALDLGIPTPTLNMAVEARIISHFKDLRVNLSKTL 303

Query: 305 FNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P  +  L   +  ++DLE AL     +SF+QG W+I ++S+ +++++ L+ + RIW+ 
Sbjct: 304 PVPKENLSLNR-EELIRDLEKALLFGVFISFSQGLWLIDEASKTFNYNIDLSEVLRIWKG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+++LN + + + E+P + NLL        +K  I S +RI       G P+  L+
Sbjct: 363 GCIIRAKLLNFLREIIKENPQNANLLASEKAVNFLKDKIESAKRISNLGKLTGIPLLCLN 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           +AL Y+     +   ANLIQAQRDFFG+H ++R DK    H  W+K+ 
Sbjct: 423 SALDYYFALATENLPANLIQAQRDFFGAHTYERIDKEGIFHTEWEKLE 470


>gi|56751469|ref|YP_172170.1| 6-phosphogluconate dehydrogenase [Synechococcus elongatus PCC 6301]
 gi|56686428|dbj|BAD79650.1| 6-phosphogluconate dehydrogenase [Synechococcus elongatus PCC 6301]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 286/471 (60%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG NL+LNI   GF L VYN+  E T+ F+       + ++   +LE
Sbjct: 1   MALQQFGLIGLAVMGENLALNIERNGFSLTVYNRTAEKTEAFMAD-RAQGKNIVPAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
             V ++ +PR+IL+MV  G PVD ++++LKPLL P D+++DGGNS F DT+ R   L   
Sbjct: 60  DFVASLERPRRILVMVKAGGPVDAVVEQLKPLLDPGDLIIDGGNSLFTDTERRVKDLEAL 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG + AY  VE I+ SI+A+  + PC   +GP GSG
Sbjct: 120 GLGFMGMGVSGGEEGALNGPSLMPGGTQAAYEAVEPIVRSIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L+     N  E+  +F+ W+ T +L S+LI+ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKSVAGLNASELHDVFAAWNKTPELDSFLIEITADI 239

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
            +  D + TG P++++I D A QKGTG  ++    ++  ++     A+ AR LS  + E 
Sbjct: 240 FTKVDDLGTGQPLVELIIDAAGQKGTGRWTVETALEIGVAIPTIIAAVNARILSSIKAER 299

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           +      +     P      +F+  + +ALY S I S+ QG  ++ K+S+ Y++ L+L  
Sbjct: 300 QAASEILSGPITEPFSGDRQAFIDSVRDALYCSKICSYAQGMALLAKASQVYNYGLNLGE 359

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIW+ GCIIR+  LN I ++   DP+  NLL  P   + +     + RR++    E G
Sbjct: 360 LARIWKGGCIIRAGFLNKIKQAYDADPTLANLLLAPEFRQTILDRQLAWRRVIAIAAERG 419

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ SA+L YFD++  DR   NL QAQ D+FG+H ++R D+    H  W
Sbjct: 420 IPVPAFSASLDYFDSYRRDRLPQNLTQAQCDYFGAHTYERTDRSGSFHAQW 470


>gi|225570678|ref|ZP_03779701.1| hypothetical protein CLOHYLEM_06778 [Clostridium hylemonae DSM
           15053]
 gi|225160505|gb|EEG73124.1| hypothetical protein CLOHYLEM_06778 [Clostridium hylemonae DSM
           15053]
          Length = 477

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 288/471 (61%), Gaps = 8/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M++ DIG+IGL  MG +L+LN+ D GF++  YN+  E+TD  +K+       ++   +LE
Sbjct: 7   MQKTDIGVIGLAVMGRSLALNMADHGFKVGGYNRSREVTDALVKEHP--HDNLVPFYDLE 64

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            +V +  +PR+ L+MV  G PVD +ID+L  LL   D++LDGGNS F DT+ R  +L  +
Sbjct: 65  TLVASQERPRRFLIMVKAGKPVDMVIDQLVLLLDKGDMILDGGNSFFEDTRRREKRLKAE 124

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GIY+ G GVSGG  GAR G S+M GG E AY  +  +L +++AK Q  PCCA +GPDG+G
Sbjct: 125 GIYYFGTGVSGGEHGARFGPSIMPGGEESAYRHIAPVLEAVAAKAQGEPCCAYMGPDGAG 184

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEYA+MQLIA+ Y +L+ + N    E++ LF +W+ G+L SYLI+ITA I 
Sbjct: 185 HYVKMVHNGIEYADMQLIAEAYLLLKYAGNYTNEELADLFEEWNEGELKSYLIEITARIF 244

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
             +D      ++D I D A QKGTG  + +E  K   ++++   A  AR +S    E   
Sbjct: 245 READDYAEGELVDHILDSAGQKGTGRWTSLESLKQGVNVSMITAACNARIMSNRIAERNA 304

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            ++    ++  P     +F + +   LY + I+++ QGF ++  +S +Y W L+   IA 
Sbjct: 305 AKALIKEAAKQPAADKKAFGESVRKGLYTAKIVAYAQGFDLLRHASSEYGWDLNYGRIAS 364

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           I+RAGCII++Q L+DI K+   D   +NL+      E +     SL+ I+    +NG P+
Sbjct: 365 IFRAGCIIQAQFLDDITKAFENDSELSNLMLDSYFLEGINSGKGSLQSILCLGIQNGIPL 424

Query: 421 PSLSAALSYFDTFIHDRGT---ANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P++S A +Y D F   RGT   ANLIQAQRD FG+H ++R D+    H  W
Sbjct: 425 PAMSQAEAYIDAF---RGTPTGANLIQAQRDCFGAHTYERTDREGVFHHDW 472


>gi|148544972|ref|YP_001272342.1| 6-phosphogluconate dehydrogenase [Lactobacillus reuteri DSM 20016]
 gi|148532006|gb|ABQ84005.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           reuteri DSM 20016]
          Length = 478

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/479 (40%), Positives = 298/479 (62%), Gaps = 20/479 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A IG++GL  MG NL+LNI  +GF + VYN+    TD  ++  S   +K++ +  +++
Sbjct: 4   QKAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDDMMRDHS--DKKLVPSYTVKE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ KPR+ILMMV  G P D LID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVDSLEKPRRILMMVKAGKPTDALIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK +    PC A +GP+G+
Sbjct: 122 INFIGMGVSGGELGALHGPSLMPGGQKEAYDLVAPILTKIAAKAEEDGKPCVAYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADI 241

Query: 240 LSSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           L+  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +D
Sbjct: 242 LTRKDDLGDDKSKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKD 301

Query: 297 ESKKMQSFFNPSSHFPLKCF-------DSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           E  ++Q+    S   P++            ++ +  ALY   ++S+ QGF  +   SE Y
Sbjct: 302 E--RVQA----SKELPVETEAISIDDKKEMIEKVRQALYFGKLMSYAQGFEQMRIDSEHY 355

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L    +A+IWRAGCIIR+Q L +I  + T++P   NLL      +  KK   + R +
Sbjct: 356 DWNLKYGELAQIWRAGCIIRAQFLQNITDAFTKNPDLKNLLLDDYFKDIAKKYQKATRDV 415

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSLSAA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 416 VALAVKAGIPVPSLSAAISYYDSYRSEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 474


>gi|46445951|ref|YP_007316.1| 6-phosphogluconate dehydrogenase [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46399592|emb|CAF23041.1| probable phosphogluconate dehydrogenase (decarboxylating)
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 484

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/461 (41%), Positives = 285/461 (61%), Gaps = 4/461 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QADIG+IGL  MG NL LN+ D G+ +AVYN+     D F+   +    KVI   +L+
Sbjct: 3   MTQADIGLIGLAVMGQNLVLNMNDHGYTVAVYNRTTSKVDEFLDGPAK-GTKVIGAHSLK 61

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
            ++  + +PR++++MV  G+PVD  I++  P L   DIL+DGGNS F DT  R   L EK
Sbjct: 62  DLISQLKRPRRVMLMVKAGEPVDNFIEQCLPYLEKGDILIDGGNSLFTDTNRRCNSLKEK 121

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI FIG G+SGG +GAR G S+M GGN + +  ++ I  SISAK +  PCC  +G  G+G
Sbjct: 122 GIIFIGTGISGGEEGARHGPSIMPGGNPEGWPHIKEIFQSISAKVEGEPCCDWVGDQGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLI++ Y +L+++L+ N  E+  +F+ W+ G L SYLI+IT++I 
Sbjct: 182 HYVKMVHNGIEYGDMQLISEAYYLLKEALHLNQNELYQVFADWNKGDLDSYLIEITSKIF 241

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
             +D   G P++D I D A QKGTG  ++I    L   +T+   A+FAR LS  +DE   
Sbjct: 242 KVNDE-DGKPLVDKILDVAGQKGTGKWTVINALDLGMPLTLIGEAVFARCLSALKDERVA 300

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P + F     + F++ +  ALY+S I+S+TQGF ++ +++ +Y W L+   IA
Sbjct: 301 ASELLKGPDAKFE-GNREEFIQAIREALYSSKIISYTQGFMLMQQAAAEYKWQLNYGAIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRSQ L  I ++   +P+  +LL      ++++K     R++V    E G  
Sbjct: 360 LMWRGGCIIRSQFLGKIKEAFKLNPNLKSLLLDEYFLQEIQKRQKGWRKVVSKSVELGIA 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            P  + AL ++D +   +  ANL+QAQRDFFG+H ++R D+
Sbjct: 420 TPCFNTALVFYDGYRTAKLPANLLQAQRDFFGAHTYERGDR 460


>gi|270294015|ref|ZP_06200217.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. D20]
 gi|270275482|gb|EFA21342.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. D20]
          Length = 493

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 303/475 (63%), Gaps = 24/475 (5%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQ--KVIVT 56
           + + DIG+IGL  MG NL+LN+ DKG+ ++VYN+     +  V  + ++G ++  K+   
Sbjct: 6   LNKTDIGLIGLAVMGENLALNMADKGWNVSVYNRTVPGVEEGVVERFVNGRAKGKKIEGY 65

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++ + V ++  PRKI+MMV  G  VD+L+++L P LS  DIL+DGGNS++ DT  R   
Sbjct: 66  TDIAEFVTSIAIPRKIMMMVRAGSAVDELMEQLFPHLSEGDILIDGGNSNYEDTNRRVAL 125

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
             +KG  F+G GVSGG +GA +GAS+M GG+E A++ V+ IL SI+AK  + +PCC  +G
Sbjct: 126 AEKKGFRFVGAGVSGGEEGALNGASIMPGGSESAWSEVKPILQSIAAKASDGTPCCQWIG 185

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L  +  +++ +F+ W+ GKL SYLI+I
Sbjct: 186 PAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLLGLDNGQMAEIFADWNEGKLRSYLIEI 245

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--- 292
           TA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS   
Sbjct: 246 TANILRHKDK-SGGYLIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQK 304

Query: 293 -LYRDESKKM-----QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSS 346
            L    SK+      Q+ +N S           VKD+ +ALYAS ++S+ QGF V+ ++S
Sbjct: 305 GLRETASKQFVCRRSQAVYNKSE---------MVKDIYSALYASKLVSYAQGFAVLQRAS 355

Query: 347 EKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSL 406
           + ++W+L LA+IAR+WR GCIIRS  LNDI  +        +LL  P    +++  +   
Sbjct: 356 DAFAWNLDLASIARMWRGGCIIRSIFLNDIATAFEAKDKPKHLLLAPYFKNEMQLLLSGW 415

Query: 407 RRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           + +V    +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 416 KHLVAQSMKEELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 470


>gi|256839590|ref|ZP_05545099.1| 6-phosphogluconate dehydrogenase, decarboxylating [Parabacteroides
           sp. D13]
 gi|256738520|gb|EEU51845.1| 6-phosphogluconate dehydrogenase, decarboxylating [Parabacteroides
           sp. D13]
          Length = 486

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 295/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK +DIG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSDIGLIGLAVMGENLALNMESKGFTVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTERRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK  + +PCC  +G
Sbjct: 120 MEAHGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLDDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNEALARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILRFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ ++S++Y W L  
Sbjct: 300 EERKKASSLYPKSGVLGQTLISE--KEIKQALYAAKLVSYAQGFSLLYQASKRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|154492698|ref|ZP_02032324.1| hypothetical protein PARMER_02335 [Parabacteroides merdae ATCC
           43184]
 gi|154087003|gb|EDN86048.1| hypothetical protein PARMER_02335 [Parabacteroides merdae ATCC
           43184]
          Length = 490

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 295/467 (63%), Gaps = 11/467 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE----LTDVFIKKISGLSQKVIVTKN 58
           +A+IG+IGL  MG NL+LN+  KGF +AVYN+       + D FI    G S++ I T +
Sbjct: 2   KANIGLIGLAVMGENLALNMESKGFTVAVYNRSVPGEEGVVDRFING-RGKSKRFIGTHS 60

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +EQ+V++V  P  I+MMV  G PVD+LI +L P LS  D+++DGGNS F DT+ R  +L 
Sbjct: 61  IEQLVDSVKSPHIIMMMVKAGRPVDELISQLLPFLSSGDVIIDGGNSDFHDTERRVKELE 120

Query: 119 EKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPD 177
           +KGIYF+G G+SGG +GA  G S+M GG+ +A+  V++IL  ISAK  + SPCC  +G  
Sbjct: 121 KKGIYFVGTGISGGEEGALHGPSVMPGGSVEAWPLVKDILQGISAKLDDGSPCCEWIGAG 180

Query: 178 GSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA 237
           G+GHFVKM+HNGIEY +MQLI++ Y +L++    +   ++ +F +W+ G+L S+LI+ITA
Sbjct: 181 GAGHFVKMVHNGIEYGDMQLISEAYSLLKNRKGLDNDAMAVVFDEWNGGELDSFLIEITA 240

Query: 238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
            IL   D   G P++D I D A QKGTG  S I     +  +T+   A++AR LS    E
Sbjct: 241 NILRFRDE-DGKPLLDKILDVAGQKGTGKWSAIAAMDENDPLTLITEAVYARLLSALYPE 299

Query: 298 SKKMQSFFNPSSHFPL-KCFDSF---VKDLENALYASTILSFTQGFWVIGKSSEKYSWSL 353
             K  S ++        K  D+    ++D+  ALYA+ ++S+ QGF ++  +SE Y W L
Sbjct: 300 RIKAASLYSGKLKVESGKLSDNAQLSIEDVRQALYAAKLISYAQGFSLLRHASEHYGWDL 359

Query: 354 SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTC 413
              TIARIWR GCIIRS  L  I ++  +DP   NLL       K+++ +P+ RR+V   
Sbjct: 360 DYGTIARIWRKGCIIRSVFLQKITEAYRKDPDLENLLFDDFFHTKIQEALPAWRRVVAEG 419

Query: 414 TENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
             +G  +P++S+AL+YFD        AN+IQAQRD+FG+H ++R D+
Sbjct: 420 ALSGVALPAMSSALNYFDGLRTLYSAANMIQAQRDYFGAHTYERTDR 466


>gi|300722477|ref|YP_003711765.1| gluconate-6-phosphate dehydrogenase [Xenorhabdus nematophila ATCC
           19061]
 gi|297628982|emb|CBJ89567.1| gluconate-6-phosphate dehydrogenase, decarboxylating [Xenorhabdus
           nematophila ATCC 19061]
          Length = 468

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/469 (40%), Positives = 292/469 (62%), Gaps = 4/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++ + ++E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVIAENPG--KKLVPSYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN++F DT  R+ +LS +
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYFQDTIRRNRELSAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG + AY  V  IL  I+A+ +  PC   +G DG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKDAYELVAPILKEIAAQVEGEPCVTYIGADGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L++SLN +  E+S +FS W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKNSLNLSNQELSEIFSDWNQGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 239 RKQDE-EGKYLVDVILDEAANKGTGKWTSQSSLDLGVPVTLITESVFARYISSMKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +  +     P     + F++ +  ALY   I+S+ QGF  +  +S++Y+W L+   IA
Sbjct: 298 ASNVLSGPEVQPFNGDKAEFIEKVRRALYLGKIVSYAQGFQQLKAASDEYNWDLNYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E P+  NLL  P   +   +   +LR ++    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITDAYNETPAIANLLLAPYFKQIADEYQQALRDVISYGVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 418 TPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEW 466


>gi|311113827|ref|YP_003985049.1| 6-phosphogluconate dehydrogenase [Rothia dentocariosa ATCC 17931]
 gi|310945321|gb|ADP41615.1| 6-phosphogluconate dehydrogenase [Rothia dentocariosa ATCC 17931]
          Length = 490

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 300/485 (61%), Gaps = 20/485 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG+ GL  MG+NL+ N+   G+ +A++N+  E TD  + +  G     I T++L+ 
Sbjct: 5   KKAQIGVTGLAVMGANLARNLARNGYTVALHNRSVEKTDALLSE-HGADGDFIRTESLQD 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V+++  PR+IL+MV  G PVD +I++L PLL   DI++DGGNSHF DT  R   L+EKG
Sbjct: 64  LVDSLESPRRILIMVKAGAPVDAVIEQLTPLLDEGDIIIDGGNSHFPDTIRRERALAEKG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++F+G+GVSGG +GA  G S+M GG+ ++Y  V  +L  ISAK     SPCCA +  DGS
Sbjct: 124 LHFVGVGVSGGEEGALWGPSIMPGGSAESYKHVGPMLEKISAKAPQDGSPCCAWISTDGS 183

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEYA+MQ+I + Y ILR      P E + +F KW+   L+SYLI+IT+E+
Sbjct: 184 GHFVKMVHNGIEYADMQVIGEAYDILRSVAGIEPAEQAEIFKKWNETDLNSYLIEITSEV 243

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D  TG P++DVI D+A QKGTG  ++     L + ++    ++FAR LS     S 
Sbjct: 244 LAQVDAKTGKPLVDVILDQAGQKGTGRWTVQAALDLGAPVSAIAESVFARALS-----SS 298

Query: 300 KMQSFFNPSSHFPLKCFDS---------FVKDLENALYASTILSFTQGFWVIGKSSEKYS 350
            +++        P     +         FV+D+  AL+AS ++++ QG  +I ++ ++Y 
Sbjct: 299 DVKARAQAQQELPAGLIATTGVGAGDPEFVEDVRRALFASKLVAYAQGMDMIARAGQEYG 358

Query: 351 WSLSLATIARIWRAGCIIRSQILNDIVKSLT-EDPSSTNLLNIPSISEKVKKTIPSLRRI 409
           W L L TIA +WRAGCIIR+++L DI+ +   E P+  N+L  P+    +++ +PS RR+
Sbjct: 359 WELHLDTIASLWRAGCIIRAELLGDIMAAYAGEVPA--NMLLAPAFKNLMEELVPSWRRV 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           V   T  G PVP  S+ALSY+D    DR  A LIQ QRDFFG+H + R D     H  W 
Sbjct: 417 VAKATALGVPVPVFSSALSYYDGLRRDRLPAALIQGQRDFFGAHTYGRVDAEGAFHTMWS 476

Query: 470 KVSTE 474
              +E
Sbjct: 477 GDRSE 481


>gi|167573573|ref|ZP_02366447.1| 6-phosphogluconate dehydrogenase [Burkholderia oklahomensis C6786]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 290/470 (61%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE 
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLEA 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYTEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  +D+  
Sbjct: 240 FGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                    +  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W L L TI
Sbjct: 300 AASKVLTGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWHLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I  +  ++ +  NLL  P   +       SLR +VV     G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSSLRDVVVAAVNAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 PVPAFASAIAYFDSYRSARVPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|300741725|ref|ZP_07071746.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rothia
           dentocariosa M567]
 gi|300380910|gb|EFJ77472.1| 6-phosphogluconate dehydrogenase, decarboxylating [Rothia
           dentocariosa M567]
          Length = 490

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 300/485 (61%), Gaps = 20/485 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG+ GL  MG+NL+ N+   G+ +A++N+  E TD  + +  G     I T++L+ 
Sbjct: 5   KKAQIGVTGLAVMGANLARNLARNGYTVALHNRSVEKTDALLSE-HGADGDFIRTESLQG 63

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V+++  PR+IL+MV  G PVD +I++L PLL   DI++DGGNSHF DT  R   L+EKG
Sbjct: 64  LVDSLESPRRILIMVKAGAPVDAVIEQLTPLLDEGDIIIDGGNSHFPDTIRRERSLAEKG 123

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++F+G+GVSGG +GA  G S+M GG+ ++Y  V  +L  ISAK     SPCCA +  DG+
Sbjct: 124 MHFVGVGVSGGEEGALWGPSIMPGGSAESYKHVGPMLEKISAKAPQDGSPCCAWISTDGA 183

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEYA+MQ+I + Y ILR      P E + +F KW+   LSSYLI+IT+E+
Sbjct: 184 GHFVKMVHNGIEYADMQVIGEAYDILRSVAGIEPAEQAEIFKKWNETDLSSYLIEITSEV 243

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D  TG P++DVI D+A QKGTG  ++     L + ++    ++FAR LS     S 
Sbjct: 244 LAQVDAKTGKPLVDVILDQAGQKGTGRWTVQAALDLGAPVSAIAESVFARALS-----SS 298

Query: 300 KMQSFFNPSSHFPLKCFDS---------FVKDLENALYASTILSFTQGFWVIGKSSEKYS 350
            +++        P     +         FV+D+  AL+AS ++++ QG  +I ++ ++Y 
Sbjct: 299 DVKARAQAQQELPAGLIATTGVGAGDPEFVEDVRRALFASKLVAYAQGMDMIARAGQEYG 358

Query: 351 WSLSLATIARIWRAGCIIRSQILNDIVKSLT-EDPSSTNLLNIPSISEKVKKTIPSLRRI 409
           W L L TIA +WRAGCIIR+++L DI+ +   E P+  N+L  P+    +++ +PS RR+
Sbjct: 359 WELHLDTIASLWRAGCIIRAELLGDIMAAYAGEVPA--NMLLAPAFKNLMEELVPSWRRV 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQ 469
           V   T  G PVP  S+ALSY+D    DR  A LIQ QRDFFG+H + R D     H  W 
Sbjct: 417 VAKATALGVPVPVFSSALSYYDGLRRDRLPAALIQGQRDFFGAHTYGRVDAEGAFHTMWS 476

Query: 470 KVSTE 474
              +E
Sbjct: 477 GDRSE 481


>gi|282899212|ref|ZP_06307186.1| 6-phosphogluconate dehydrogenase, decarboxylating
           [Cylindrospermopsis raciborskii CS-505]
 gi|281195895|gb|EFA70818.1| 6-phosphogluconate dehydrogenase, decarboxylating
           [Cylindrospermopsis raciborskii CS-505]
          Length = 476

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/473 (40%), Positives = 285/473 (60%), Gaps = 2/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     G+IGL  MG N++LN+   GF +AVYN+  E TD F+   +G  + V     LE
Sbjct: 1   MTLQSFGVIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMSNRAG-GRNVKAAFTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DT+ R+ +L   
Sbjct: 60  EFVASLERPRKILVMVQAGKPVDAVIQQLKPLLQEGDIIIDGGNSWFEDTERRTQELEPT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ +IG+GVSGG +GA +G SLM GG + +Y  +  I   I+A+  + PC   +GP GSG
Sbjct: 120 GLRYIGMGVSGGEEGALNGPSLMPGGTKSSYEYLSPIFNRIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L++    +  ++  +F++W+ T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNVGGLDATQLHQVFTEWNQTDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  T  P++D+I D A QKGTG  ++    +L  ++     A+ +R +S  R+E  
Sbjct: 240 FPYVDPETKQPLVDLIVDAAGQKGTGRWTVQTALELGVAIPTITAAVNSRIISSIREERI 299

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                         K   +FV  + +ALY S I S+ QG  +I  +S+ Y+W L+L  +A
Sbjct: 300 AASKQLTGPVPTQFKDTRTFVNMVRDALYCSKICSYAQGMALISTASKTYNWGLNLGEMA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIW+ GCIIR+  LN I K+  E+P+  NLL  P   + +     + R I+VT  + G P
Sbjct: 360 RIWKGGCIIRAGFLNKIKKAFDENPALPNLLLAPEFKQTILDRQSAWREIIVTAAKTGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ SA+L YFD++  +R   NL QAQRD+FG+H + R D     H  W  ++
Sbjct: 420 VPAFSASLDYFDSYRRERLPQNLTQAQRDYFGAHTYKRVDIEGTFHTEWVPIA 472


>gi|227504306|ref|ZP_03934355.1| 6-phosphogluconate dehydrogenase [Corynebacterium striatum ATCC
           6940]
 gi|227198954|gb|EEI79002.1| 6-phosphogluconate dehydrogenase [Corynebacterium striatum ATCC
           6940]
          Length = 481

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/466 (40%), Positives = 285/466 (61%), Gaps = 2/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  E T   I++  G     I ++ +E  V
Sbjct: 8   AHIGVVGLAVMGSNLARNFAHNGNTVAVYNRSPEKTHKLIEE-HGSEGNFIPSETVEDFV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRK ++MV  G   D +ID+L   +   DI++DGGN+ + DT  R  +++ KG +
Sbjct: 67  ASLARPRKAIIMVQAGKATDAVIDQLAAAMDEGDIIIDGGNALYTDTIRREKEVAAKGKH 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  +++  +  IL SI+AK   +PC   +GPDG+GHFV
Sbjct: 127 FVGAGISGGEEGALNGPSIMPGGPAESWKTLGPILESIAAKVDGTPCVTHIGPDGAGHFV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P EI+ +F +W++G L SYLI+ITAE+L+ +
Sbjct: 187 KMVHNGIEYADMQVIGEAYQLLRYGAGLEPAEIAAVFKEWNSGDLDSYLIEITAEVLAQT 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D A QKGTG  + I G +L   +T    A+FAR LS   ++    Q 
Sbjct: 247 DPETGKPLVDVIVDAAGQKGTGRWTAINGLELGVPVTAIAEAVFARALSSATEQRAAAQE 306

Query: 304 FFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
              P+          +F++D+  ALYAS +++++QGF  I   SE++ W +    +A IW
Sbjct: 307 GELPAGVIETDVDKQAFIEDVRQALYASKLIAYSQGFDEIKAGSEQFGWDVDPRDLATIW 366

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ L+ I ++   +P    L+  P    ++ + I   RR+VVT T+ G PVP 
Sbjct: 367 RGGCIIRAKFLDRIREAYDTNPQLPALILDPYFKGELSELIAPWRRVVVTATQLGLPVPV 426

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            +++LSY+D+   +R  A LIQ QRDFFG+H F R DK    H  W
Sbjct: 427 FASSLSYYDSLRAERLPAALIQGQRDFFGAHTFKRVDKEGTFHIEW 472


>gi|332670629|ref|YP_004453637.1| 6-phosphogluconate dehydrogenase [Cellulomonas fimi ATCC 484]
 gi|332339667|gb|AEE46250.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cellulomonas
           fimi ATCC 484]
          Length = 484

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/472 (39%), Positives = 282/472 (59%), Gaps = 2/472 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A+IG+ GL  MG NL+ N    GF +A++N+ F  T   +    G     + ++++E  V
Sbjct: 11  AEIGVTGLAVMGRNLARNFARNGFTVAIHNRSFAKTQSLLDD-HGDEGTFVASESVEDFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRK+++MV  G   D +ID+L PLL   DI++D GN+HF DT  R   L  KG++
Sbjct: 70  ASLARPRKVVVMVKAGAATDAVIDELVPLLDEGDIVVDAGNAHFPDTVRREAALRAKGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG  ++Y  +  IL  ISAK    PCC  +GP G+GHFV
Sbjct: 130 FVGTGVSGGEEGALLGPSIMPGGTAESYEWLGPILEKISAKVDGVPCCTYVGPGGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +L+  L  +  EI  +F++W+TG L S+LI+ITA++L   
Sbjct: 190 KMVHNGIEYADMQLIAEAYDLLKQGLGASAAEIGQIFAEWNTGDLESFLIEITADVLQHV 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS-LYRDESKKMQ 302
           D  TG   +DV+ D+A QKGTG  ++     L   +T    A FAR LS      +  + 
Sbjct: 250 DAATGAAFVDVVLDQAEQKGTGRWTVQNALDLGVPITGIAEATFARALSGSVPQRTAALG 309

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
           +    ++ + ++  D+FV+D+  ALYAS +++++QGF  I  +SE++ W +    +ARIW
Sbjct: 310 TLPAHTTPWAVEDRDAFVEDVRLALYASKVVAYSQGFDQIAAASEQFGWDIDRGAMARIW 369

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ LN I ++   +     LL     +  V   + + RR+V     +G P P+
Sbjct: 370 RGGCIIRARFLNRITEAYERNADLPLLLADEYFTGAVGNGVQAWRRVVSGAALHGVPTPA 429

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            +++L+Y+D    +R  A LIQAQRDFFG+H + R D+    H  W    TE
Sbjct: 430 FASSLAYYDGVRAERLPAALIQAQRDFFGAHTYRRTDREGTFHTTWSTDRTE 481


>gi|160889728|ref|ZP_02070731.1| hypothetical protein BACUNI_02158 [Bacteroides uniformis ATCC 8492]
 gi|317478766|ref|ZP_07937919.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 4_1_36]
 gi|156860720|gb|EDO54151.1| hypothetical protein BACUNI_02158 [Bacteroides uniformis ATCC 8492]
 gi|316905101|gb|EFV26902.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 4_1_36]
          Length = 493

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 302/475 (63%), Gaps = 24/475 (5%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQ--KVIVT 56
           + + DIG+IGL  MG NL+LN+ DKG+ ++VYN+     +  V  + ++G ++  K+   
Sbjct: 6   LNKTDIGLIGLAVMGENLALNMADKGWNVSVYNRTVPGVEEGVVERFVNGRAKGKKIEGY 65

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
            ++ + V ++  PRKI+MMV  G  VD+L+++L P LS  DIL+DGGNS++ DT  R   
Sbjct: 66  TDIAEFVTSIAIPRKIMMMVRAGSAVDELMEQLFPHLSEGDILIDGGNSNYEDTNRRVAL 125

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
             +KG  F+G GVSGG +GA +GAS+M GG+E A+  V+ IL SI+AK  + +PCC  +G
Sbjct: 126 AEKKGFRFVGAGVSGGEEGALNGASIMPGGSESAWPEVKPILQSIAAKASDGTPCCQWIG 185

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P GSGHFVKMIHNGIEY +MQLIA+ Y ++++ L  +  +++ +F+ W+ GKL SYLI+I
Sbjct: 186 PAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLLGLDNGQMAEIFADWNEGKLRSYLIEI 245

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS--- 292
           TA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS   
Sbjct: 246 TANILRHKDK-SGGYLIDKILDTAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQK 304

Query: 293 -LYRDESKKM-----QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSS 346
            L    SK+      Q+ +N S           VKD+ +ALYAS ++S+ QGF V+ ++S
Sbjct: 305 GLRETASKQFVCRRSQAVYNKSE---------MVKDIYSALYASKLVSYAQGFAVLQRAS 355

Query: 347 EKYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSL 406
           + ++W+L LA+IAR+WR GCIIRS  LNDI  +        +LL  P    +++  +   
Sbjct: 356 DAFAWNLDLASIARMWRGGCIIRSIFLNDIATAFEAKDKPKHLLLAPYFKNEMQLLLSGW 415

Query: 407 RRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           + +V    +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 416 KHLVAQSMKEELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 470


>gi|153806786|ref|ZP_01959454.1| hypothetical protein BACCAC_01058 [Bacteroides caccae ATCC 43185]
 gi|149131463|gb|EDM22669.1| hypothetical protein BACCAC_01058 [Bacteroides caccae ATCC 43185]
          Length = 491

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 209/472 (44%), Positives = 306/472 (64%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWYVSVYNRTVPGVEEGVVDRFMNSRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G+PVD+L+++L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVDSIATPRKIMMMVRAGNPVDELMEQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+EKA++ V+ IL SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWSEVKPILQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y ++++ ++ N  E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKNLIDLNNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  TG  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITANILRHKDK-TGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D  +     F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKDLRRLASKQFQCQHTQPIYNKAELVKNIFSALYASKLVSYAQGFAVLQRASDAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +   + +
Sbjct: 357 DWHLDLASIARMWRGGCIIRSIFLNDIAAAFEAPDKPKHLLLAPYFREEIKTLLSGWKSL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|256828155|ref|YP_003156883.1| 6-phosphogluconate dehydrogenase [Desulfomicrobium baculatum DSM
           4028]
 gi|256577331|gb|ACU88467.1| 6-phosphogluconate dehydrogenase, decarboxylating [Desulfomicrobium
           baculatum DSM 4028]
          Length = 485

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/467 (41%), Positives = 283/467 (60%), Gaps = 12/467 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG++GL  MG NL LN+  KGF +A +N+     D FI+   G ++ +I   +LE++V
Sbjct: 7   ADIGMVGLAVMGENLVLNMEGKGFTVACFNRTVAKVDAFIEG-RGANKNIIGCHSLEELV 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PRK++ M+  G+ VD L+  L PLL P DI++DGGNSH+ DT  R  +     I 
Sbjct: 66  GTLSRPRKVMCMIKAGEAVDALMASLMPLLEPGDIIIDGGNSHYLDTSRRVREARAHQIL 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA  G S+M GG  +A++ +  I  SI A   + +PCC  +GPDG+GHF
Sbjct: 126 FVGTGISGGEEGALIGPSIMPGGAIEAWDSIRPIFQSICAVTPDGAPCCEWVGPDGAGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI ++Y ++++ L  +  E+  +FS+W+ G+L SYLI+IT+EIL  
Sbjct: 186 VKMVHNGIEYADMQLICEVYQMMKEGLKLSNEEMHGIFSRWNKGRLDSYLIEITSEILGF 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE----S 298
            D   G  ++D+I D A QKGTG  ++    +    +T+   A+FAR+LS  +DE    S
Sbjct: 246 RDE-DGSYVLDLILDSAQQKGTGKWTVNAALEAGQPLTLIGEAVFARSLSALKDERVLAS 304

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           + ++    P+           V DL+ ALYAS I+S+ QGF ++   S +  W L    I
Sbjct: 305 RVLEGPVQPAGEA-----GGMVDDLQEALYASKIVSYAQGFQILSAVSHEEGWDLDHGGI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           AR+WR GCIIRS  L DI K+   DP   +LL      + V       RR+V      G 
Sbjct: 360 ARMWRNGCIIRSVFLGDIEKAFIRDPKLASLLLDQFFKDAVHHAQAGWRRVVAAGALRGI 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPH 465
           P+P+LSA L+YFD +   R  ANL+QAQRD+FG+H ++R D+    H
Sbjct: 420 PMPTLSAGLAYFDGYRSARLPANLLQAQRDYFGAHTYERIDRPRGRH 466


>gi|50295024|ref|XP_449923.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49529237|emb|CAG62903.1| unnamed protein product [Candida glabrata]
          Length = 489

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/455 (43%), Positives = 271/455 (59%), Gaps = 6/455 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           AD G+IGL  MG NL LNI D G+ +  YN+  +    F+       + +I  +++E +V
Sbjct: 3   ADFGLIGLAVMGQNLILNIADHGYTVVAYNRSVDKVHQFLDN-EAKGKSIIGAESIEDLV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PRKI+M+V  G PVD LI +L P L   DI++DGGNSHF D+  R  +L  KGI 
Sbjct: 62  AKLKRPRKIMMLVKAGAPVDGLIAQLVPHLEKGDIIIDGGNSHFPDSNRRYEELKAKGIL 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG E+A+  ++ I  SISAK    PCC  +GP GSGH+V
Sbjct: 122 FVGSGVSGGEDGARYGPSLMPGGAEEAWPHIKEIFQSISAKSDGEPCCDWVGPAGSGHYV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F KWDTG L S+L++IT  IL   
Sbjct: 182 KMVHNGIEYGDMQLICEAYDIMKRIGGFTDKEISEVFGKWDTGVLDSFLVEITTNILKKD 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D + G P+++ I D A QKGTG  + I    L   +++   A+FAR LS  + E  K   
Sbjct: 242 D-VDGKPLVEKIMDSAGQKGTGKWTAINALDLGMPVSLIGEAVFARCLSALKCERVKASK 300

Query: 304 FFNPSSHFP---LKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
              P    P   +K    F+ DLE ALYAS I+S+ QGF +I ++++ Y W L+   IA 
Sbjct: 301 TL-PGPEIPKDLIKDRQQFIDDLEQALYASKIISYAQGFMLIREAAKTYGWKLNNPAIAL 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  E+P   NLL      + V K     RR +      G P 
Sbjct: 360 MWRGGCIIRSVFLGEITKAYRENPDLENLLFHKFFKDAVTKAQGGWRRSLALAATYGIPS 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF 455
           P+ + ALS++D +  +R  ANL+QAQRD+FG+H F
Sbjct: 420 PAFATALSFYDGYRSERLPANLLQAQRDYFGAHTF 454


>gi|298375287|ref|ZP_06985244.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           3_1_19]
 gi|298267787|gb|EFI09443.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           3_1_19]
          Length = 486

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 296/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK ++IG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSNIGLIGLAVMGENLALNMESKGFTVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTERRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK ++ +PCC  +G
Sbjct: 120 MEAHGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLEDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNEALARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILRFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ ++S++Y W L  
Sbjct: 300 EERKKASSLYPKSGVLGQTLISE--KEIKQALYAAKLVSYAQGFSLLCQASKRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|284045750|ref|YP_003396090.1| 6-phosphogluconate dehydrogenase, decarboxylating [Conexibacter
           woesei DSM 14684]
 gi|283949971|gb|ADB52715.1| 6-phosphogluconate dehydrogenase, decarboxylating [Conexibacter
           woesei DSM 14684]
          Length = 480

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/474 (40%), Positives = 284/474 (59%), Gaps = 8/474 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           A+IG++GL  MGSNL+ N+  + G  +AVYN+  E     + +        + ++++EQ 
Sbjct: 8   ANIGVVGLAVMGSNLARNLASREGNTVAVYNRSPERARTLVAEHP--EAGFVASESIEQF 65

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
             ++ KPR  ++MV  G   D +ID+L  L    DI++DGGN++F DT  R   L E+G+
Sbjct: 66  AASLAKPRTAIVMVQAGKGTDAVIDQLADLFEDGDIIVDGGNANFHDTIRREHALRERGL 125

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G G+SGG +GA +G S+M GG+ +AY  +  IL SI+A  +  PC   +G DG+GHF
Sbjct: 126 NFVGAGISGGEEGALNGPSIMPGGSAEAYATLGPILASIAAVAEGEPCVTHVGTDGAGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKMIHNGIEYA+MQLIA+ Y +LR     +   I+ +F+ W+ G L SYLI+ITAE+L  
Sbjct: 186 VKMIHNGIEYADMQLIAESYDLLRRVGGHDAEAIAEVFAAWNEGDLESYLIEITAEVLRQ 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P++DVI D+A  KGTG+ ++     L   +     A+FAR +S    +   +Q
Sbjct: 246 TDAATGRPLVDVILDEAGSKGTGVWTVQNSVGLGVPVGGIAEAVFARAVSSKPAQRAAVQ 305

Query: 303 SFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +     P    P    D F  D+  ALYAS ++++ QGF VI   ++++ W +SL  IA+
Sbjct: 306 ATIEARPEIQAP---GDGFEDDVRAALYASKVVAYAQGFDVIIAGAKEFGWEISLGDIAK 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR++ LN IV++   +PS T LL  P  +  V+    + RRIV T   +G P 
Sbjct: 363 IWRGGCIIRARFLNRIVEAYANNPSLTTLLEDPYFAAAVRDGETAWRRIVATAALSGIPA 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  SAAL+Y+D+   +R  A L+Q QRDFFG+H + R D+    H  W    +E
Sbjct: 423 PGFSAALAYYDSLASERLPAALVQGQRDFFGAHTYRRVDRDGAFHTLWSGDRSE 476


>gi|238060549|ref|ZP_04605258.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micromonospora
           sp. ATCC 39149]
 gi|237882360|gb|EEP71188.1| 6-phosphogluconate dehydrogenase, decarboxylating [Micromonospora
           sp. ATCC 39149]
          Length = 481

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/466 (40%), Positives = 286/466 (61%), Gaps = 2/466 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N+   GF +AV+N+  E T   +    G     + +++LE  V
Sbjct: 7   AQIGVTGLAVMGRNLARNLARNGFTVAVHNRSPERTRSLVAD-HGDEGTFVPSESLEDFV 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PR +++MV  G P D +ID+L PLL   DI++D GN+HF DT+ R   L  +G++
Sbjct: 66  ASLERPRAVIIMVKAGAPTDAVIDELVPLLDEGDIIVDCGNAHFADTRRREEALRARGLH 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F G GVSGG +GA  G S+M GG+ ++Y ++  +   I+A+   + CC  +GPDG+GHFV
Sbjct: 126 FSGTGVSGGEEGALLGPSIMPGGSAESYAKLGPMFEKIAAQVDGTSCCRHIGPDGAGHFV 185

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQLIA+ Y +LR  L+ +P EI+ +F +W+TG+L S+LI+ITAE+L  +
Sbjct: 186 KMVHNGIEYADMQLIAEAYDLLRAGLSASPAEIAEIFREWNTGELESFLIEITAEVLGHT 245

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM-Q 302
           D  TG   +DV+ D+A QKGTG  ++     L   +T    A FAR+LS +  + +   +
Sbjct: 246 DAATGRAFVDVVLDQAEQKGTGRWTVQSALDLGIPITGIAEATFARSLSGHAGQREAARR 305

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
           +F +    + ++  D+FV+D+  AL AS I+++ QGF  I   S +Y+W + L   A IW
Sbjct: 306 AFGDAGEKWQVEDRDTFVEDVRRALLASKIVAYAQGFDHIRAGSSEYNWDIDLGGTATIW 365

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIR++ L+ I ++    P   +LL  P  +E V   +PS RR+VV     G P P+
Sbjct: 366 RGGCIIRARFLDRIKEAYDAQPELPSLLVAPYFAEAVSAGVPSWRRVVVDAARAGVPTPA 425

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            S++L+YFD    +R  A L+Q  RD FG+H + R D+    H  W
Sbjct: 426 FSSSLAYFDGLRAERLPAALLQGLRDNFGAHTYRRVDRDGSFHTLW 471


>gi|212712121|ref|ZP_03320249.1| hypothetical protein PROVALCAL_03203 [Providencia alcalifaciens DSM
           30120]
 gi|212685168|gb|EEB44696.1| hypothetical protein PROVALCAL_03203 [Providencia alcalifaciens DSM
           30120]
          Length = 468

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/472 (40%), Positives = 292/472 (61%), Gaps = 10/472 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++    +E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSKDKTDEVIAENPG--KKLVPNYTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN+ + DT  R+ +LSE+
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIAALTPHLDKGDILIDGGNTLYKDTIRRNRELSEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+AK +  PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAKAEGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+ SLN +  E++ +FS+W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKGSLNLSNEELADIFSEWNQGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR LS  +D+   
Sbjct: 239 KKKDE-DGKYLVDVILDEAANKGTGKWTSQSALDLGIPLTLITESVFARYLSFLKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                   +   LK  +    +F++ +  ALY   I+S+ QGF  +  +S++Y+W L+  
Sbjct: 298 ASKVLTGPA---LKTVEGDKKAFIEKVRRALYLGKIVSYAQGFQQLKAASDEYNWDLNYG 354

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA+I+RAGCIIR+Q L  I  +  ++    NLL  P   +   +   +LR +V    +N
Sbjct: 355 EIAKIFRAGCIIRAQFLQKITDAYNDNAQIANLLLAPYFKQIADEYQQALRDVVCYGVQN 414

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G P P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 415 GIPTPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEW 466


>gi|330718383|ref|ZP_08312983.1| 6-phosphogluconate dehydrogenase [Leuconostoc fallax KCTC 3537]
          Length = 477

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/474 (41%), Positives = 295/474 (62%), Gaps = 12/474 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QA+IG++G+  MG NL+LNI  +GF + +YN+  E T+  +K  S   +K++ +  +   
Sbjct: 4   QANIGVVGMAVMGKNLALNIESRGFTVGIYNRSSEKTEQVMKDHS--EKKLVPSYTIADF 61

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ KPR+IL+MV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + GI
Sbjct: 62  VASLEKPRRILLMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSGI 121

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGSG 180
            FIG+GVSGG  GA  G SLM GG + AY+ VE IL  I+A+    + PC + +GP+G+G
Sbjct: 122 NFIGMGVSGGELGALQGPSLMPGGQKAAYDLVEPILKQIAARAPQDDKPCVSYIGPNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + QLI + Y I+R     +  E S +FS+W+ G+L SYLI+ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEQLIDESYSIMRYVGGISVDEQSKIFSEWNKGELDSYLIEITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           S  D +      PI+D+I D+ + KGTG  S  +   +    ++   A++AR +S+ +DE
Sbjct: 242 SREDDLGDDKSKPIVDMILDRGNNKGTGKWSSEDALNIQVPQSVITEAVYARYISMMKDE 301

Query: 298 ---SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
              + K+ S  N +   P K  +  V+ +  ALY S I+S+ QGF  +  +SE Y W L 
Sbjct: 302 RVAASKVLSGPNGAVKVPAK--EDLVEKVREALYFSKIMSYAQGFEQLRIASETYDWDLK 359

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
              +A+IWRAGCIIR+Q L +I ++  + P   NLL      +   K   S R +V    
Sbjct: 360 FGELAQIWRAGCIIRAQFLQNITEAYNKQPDLNNLLLDDYFKDIAAKYQQSARDVVALAV 419

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           ++G PVPS+SAA++Y+D++      ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 420 QSGVPVPSMSAAVTYYDSYRAAVLPANLLQAQRDYFGAHTYERVDRSGNFHYSW 473


>gi|167567965|ref|ZP_02360881.1| 6-phosphogluconate dehydrogenase [Burkholderia oklahomensis EO147]
          Length = 471

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/470 (42%), Positives = 289/470 (61%), Gaps = 6/470 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           KQA IG++GL  MG NL+LNI  +G+ ++VYN+  E TD  I +     +K++    LE 
Sbjct: 3   KQA-IGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFP--DRKLVPAHTLEA 59

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+IL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ G
Sbjct: 60  FVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAG 119

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           ++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK      PC A +GPDG+
Sbjct: 120 LHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+        E+  ++++W+ G+L SYLI+ITA+I
Sbjct: 180 GHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYTEWNQGELDSYLIEITAKI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  +D+  
Sbjct: 240 FGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRV 299

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                    +  PL+    +FV+ +  ALY S ++S+ QGF  +  +S++Y W L L TI
Sbjct: 300 AASKVLTGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWHLDLGTI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+I+RAGCIIR++ L  I     ++ +  NLL  P   +       SLR +VV     G 
Sbjct: 360 AKIFRAGCIIRARFLQKITDVYAKNAALANLLLDPYFQDIAANYQSSLRDVVVAAVNAGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ ++A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 420 PVPAFASAIAYFDSYRSARVPANLVQAQRDFFGAHTFERTDKPGSFHANW 469


>gi|257870433|ref|ZP_05650086.1| 6-phosphogluconate dehydrogenase [Enterococcus gallinarum EG2]
 gi|257804597|gb|EEV33419.1| 6-phosphogluconate dehydrogenase [Enterococcus gallinarum EG2]
          Length = 473

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/471 (41%), Positives = 287/471 (60%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T+  +K+    + K   T  +E
Sbjct: 1   MTKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGSKTEEVVKEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++  PR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVQSIETPRRILLMVKAGFATDATIQELLPHLEKGDILIDGGNTFFKDTIRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQISAKAEDGTPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +FS+W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMQKILGLSVSEMAEIFSEWNKGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D + TG PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDLGTGKPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                       F        FV+ +  ALY S I+S+ QGF  +  +S++Y W L    
Sbjct: 299 VNASQVLPKPEGFEFTGDKQEFVEKIREALYFSKIMSYAQGFAQLRTASKEYDWQLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  +D    NLL      E  K+   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYEKDTDIENLLLDDYFKEITKRYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 469


>gi|282896119|ref|ZP_06304145.1| 6-phosphogluconate dehydrogenase, decarboxylating [Raphidiopsis
           brookii D9]
 gi|281199037|gb|EFA73912.1| 6-phosphogluconate dehydrogenase, decarboxylating [Raphidiopsis
           brookii D9]
          Length = 476

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/473 (40%), Positives = 287/473 (60%), Gaps = 2/473 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M     GIIGL  MG N++LN+   GF +AVYN+  E TD F+   +G  + V     LE
Sbjct: 1   MTLQSFGIIGLAVMGENIALNVERNGFPIAVYNRSREKTDAFMSNRAG-GRNVKAAFTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ +PRKIL+MV  G PVD +I +LKPLL   DI++DGGNS F DT+ R+ +L   
Sbjct: 60  EFVASLERPRKILVMVQAGKPVDAVIQQLKPLLEEGDIIIDGGNSWFEDTERRTQELETT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ +IG+GVSGG +GA +G SLM GG + +Y  +  I   I+A+  + PC   +GP GSG
Sbjct: 120 GLRYIGMGVSGGEEGALNGPSLMPGGTKSSYEYLSPIFNRIAAQVDDGPCVTYIGPGGSG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L++    +  ++  +F++W+ T +L+S+LI+ITA I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLKNVGGLDATQLHEVFTEWNQTDELNSFLIEITANI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  T  P++D+I D A QKGTG  ++    +L  ++     A+ +R +S  R+E  
Sbjct: 240 FPYIDPGTKQPLVDLIVDAAGQKGTGRWTVQTALELGVAIPTITAAVNSRIISSIREERI 299

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                    +    +   +FV  +++ALY S I S+ QG  +I  +S+ Y+W L+L  +A
Sbjct: 300 AASKQLTGPAPTQFEDTRTFVNMVQDALYCSKICSYAQGMALISSASKTYNWDLNLGEMA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           RIW+ GCIIR+  LN I K+  E+P+  NLL  P   + +     + R I+VT  + G P
Sbjct: 360 RIWKGGCIIRAGFLNKIKKAFDENPALPNLLLAPEFKQTILDRQSAWREIIVTAAKTGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           VP+ SA+L YFD++  ++   NL QAQRD+FG+H + R D     H  W  ++
Sbjct: 420 VPAFSASLDYFDSYRREKLPQNLTQAQRDYFGAHTYKRVDIEGTFHTEWVPIA 472


>gi|253990360|ref|YP_003041716.1| 6-phosphogluconate dehydrogenase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781810|emb|CAQ84973.1| 6-phosphogluconate dehydrogenase, decarboxylating [Photorhabdus
           asymbiotica]
          Length = 480

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 293/471 (62%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++    +E
Sbjct: 13  MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVIAENPG--KKLVPNYTIE 70

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN++F DT  R+ +LS +
Sbjct: 71  EFVDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYFQDTIRRNRELSAQ 130

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY+ V  IL  I+AK +  PC A +GPDG+G
Sbjct: 131 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYDLVAPILQEIAAKAEGKPCVAYIGPDGAG 190

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L++SL+ +   +S +F+ W+ G+LSSYLI+ITA+I 
Sbjct: 191 HYVKMVHNGIEYGDMQLIAEAYSLLKNSLDLSNEGLSEIFTDWNNGELSSYLIEITADIF 250

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 251 RKKDE-EGQYLVDVILDEAANKGTGKWTSQSSLDLGIPVTLITESVFARYISSLKDQRVA 309

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P K   + F++ +  ALY   I+S+ QGF  +  +S++Y W+L+   IA
Sbjct: 310 AAKVLSGPVAQPFKGDKAEFIEKVRRALYLGKIVSYAQGFQQLKAASDEYQWALNYGEIA 369

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+RAGCIIR+Q L  I  + +E+    NLL  P   +   +   +LR +V    +NG P
Sbjct: 370 GIFRAGCIIRAQFLQKITDAYSENADIANLLLAPYFKKIADEYQQALRDVVSYGVQNGIP 429

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 430 TPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWME 480


>gi|290968815|ref|ZP_06560352.1| 6-phosphogluconate dehydrogenase, decarboxylating [Megasphaera
           genomosp. type_1 str. 28L]
 gi|290781111|gb|EFD93702.1| 6-phosphogluconate dehydrogenase, decarboxylating [Megasphaera
           genomosp. type_1 str. 28L]
          Length = 469

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 292/471 (61%), Gaps = 7/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M   +IGIIG+G MGSNL+LNI D  + ++VYN     T+ F++  +     +I   +L+
Sbjct: 1   MGVQNIGIIGMGVMGSNLALNIADHAYTVSVYNHTPRSTENFVRDHA--HANIIPYYDLQ 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           Q + ++ KPRKI++M+  G+PVDQ+I ++ PL    DI++DGGNS F DTQ R+    EK
Sbjct: 59  QFIASLEKPRKIMLMIVAGEPVDQMIARILPLTDAGDIIIDGGNSFFKDTQRRTQVCREK 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDGS 179
           G++F+G+G+SGG  GAR G ++MVGG   AY ++ +I  +++AK   + PCCA +GPDG+
Sbjct: 119 GVFFVGMGISGGETGARRGPAVMVGGESTAYEKIRHIYEAVAAKADDDKPCCAHVGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEYA+MQLIA+ Y +L++       E++ +F  W+TG+L SYLI ITA++
Sbjct: 179 GHFVKMVHNGIEYADMQLIAEAYLLLKEMGGYTHAELADIFHDWNTGELHSYLIGITADV 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L  ++T  G  ++ +I D+A QKGTG  + IE       +++   A  AR LS      +
Sbjct: 239 L--AETEDGGSVLSMIADRAEQKGTGRWTGIEALAEGVDVSLIIAACNARVLSQVAGR-R 295

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           + Q  F       +K  D FV+ +  +LY + I+++ QGF +  K+S+ Y W L    IA
Sbjct: 296 RAQIVFPRPERGQVKAAD-FVEAVRKSLYTAKIVAYAQGFALYQKASQTYGWQLDYRRIA 354

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            I+RAGCII+++ L+ I  +  ED    NLL  P  + K+K+   SLR++       G P
Sbjct: 355 EIFRAGCIIQAKFLDTISTAYAEDAQVENLLFHPFFTGKIKEGEHSLRQVAALGLAAGIP 414

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           VP+++ AL+Y D +      ANLIQ  RD+FG+H F R DK    H  W++
Sbjct: 415 VPAMAGALTYLDAYAGPCVGANLIQGLRDYFGAHTFRRTDKEGNFHHVWRE 465


>gi|329577035|gb|EGG58509.1| phosphogluconate dehydrogenase [Enterococcus faecalis TX1467]
          Length = 472

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/470 (40%), Positives = 286/470 (60%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G++G+  MG NL+LNI  +G+ +A+YN+    T   +++     +    T ++E
Sbjct: 1   MTKQQFGVVGMAVMGKNLALNIESRGYTVALYNRTGSKTTEVVEEHP--DKNFQATYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPR+I++MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVNAIEKPRRIMLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWNEGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   T  PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTDQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
            K     +P++          ++ +  ALY S ++S+ QGF  +  +SE+Y W L    I
Sbjct: 299 VKASGILSPAAFNFAGDKKELIEKIREALYFSKLMSYAQGFAQLRAASEEYGWDLPFGEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A+IWRAGCIIR+Q L  I  +  ++P+  NLL      E  KK   ++R +V    + G 
Sbjct: 359 AKIWRAGCIIRAQFLQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVAIAVQAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ S+A++Y+D++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 PVPTFSSAIAYYDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 468


>gi|266621958|ref|ZP_06114893.1| 6-phosphogluconate dehydrogenase, decarboxylating [Clostridium
           hathewayi DSM 13479]
 gi|288866347|gb|EFC98645.1| 6-phosphogluconate dehydrogenase, decarboxylating [Clostridium
           hathewayi DSM 13479]
          Length = 483

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/467 (40%), Positives = 290/467 (62%), Gaps = 2/467 (0%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE 64
           DIG+IGL  MG +L+LN+ D GFR+A YN+  E+T   +++       +    +L ++V 
Sbjct: 16  DIGLIGLSVMGRSLALNMADHGFRVAGYNRSPEVTQKVMEEYP--HPNLTPFFSLPELVS 73

Query: 65  AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF 124
           A+ KPRKI++M+  G PVD +ID+L PLL   D ++DGGNS+F DT  R+  L EKG+++
Sbjct: 74  ALRKPRKIMVMIQAGAPVDAVIDQLIPLLEEGDFIMDGGNSYFGDTNRRAALLKEKGLHY 133

Query: 125 IGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVK 184
           +G+G+SGG +GAR G S+M GG+ +AY  V  IL +I+AK  N+PCCA +GPDG+GH+VK
Sbjct: 134 LGVGISGGEEGARFGPSIMPGGSREAYEAVGQILQTIAAKADNTPCCAYIGPDGAGHYVK 193

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEYA+MQLIA+ Y +L+ +      E++ ++  W+ G+L SYLI ITA+I   +D
Sbjct: 194 MVHNGIEYADMQLIAESYLLLKYAGGFTNRELAEIYRTWNEGELHSYLIGITADIFLEAD 253

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
            +    +ID I D A QKGTG  + IE  +    +++   A  AR +S + +  +K  S 
Sbjct: 254 DMADGDLIDHILDSAGQKGTGRWASIEALRQGVDISMITAACNARIMSNHLERRQKASSL 313

Query: 305 FNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
                        +F + +  ALY S I+++ QGF ++  +S ++ W L L +IA I+RA
Sbjct: 314 IAAPVITAAGDKQAFTEMVREALYISKIIAYAQGFSLLQDASRRFGWDLDLGSIASIFRA 373

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCII+++ LNDI ++  + P   +L+       ++ +   +LR+       +G PVP+L 
Sbjct: 374 GCIIQAEFLNDITRAFLKAPDLESLIFDDFFLSRINRYQENLRKTAGLAVSSGLPVPALF 433

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
            A+SY D+F      ANLIQAQRD FG+H F+R D+    H  W+ V
Sbjct: 434 NAVSYLDSFRTKTAGANLIQAQRDLFGAHTFERTDRKGIFHHEWRAV 480


>gi|262382127|ref|ZP_06075265.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_33B]
 gi|262297304|gb|EEY85234.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_33B]
          Length = 486

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 295/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK ++IG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSNIGLIGLAVMGENLALNMESKGFAVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTERRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK  + +PCC  +G
Sbjct: 120 MEAHGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLDDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNEALARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILRFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ ++S++Y W L  
Sbjct: 300 EERKKASSLYPKSGVLGQTLISE--KEIKQALYAAKLVSYAQGFSLLYQASKRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|296164827|ref|ZP_06847386.1| 6-phosphogluconate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295899841|gb|EFG79288.1| 6-phosphogluconate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 489

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/456 (39%), Positives = 276/456 (60%), Gaps = 1/456 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G     + ++++ + +
Sbjct: 15  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSVAKTDALLKEHGG-DGNFVRSESIAEFL 73

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   +   DI++DGGN+ + DT  R   + E+G++
Sbjct: 74  DALEKPRRVLIMVKAGDPTDAVINELADAMEEGDIIIDGGNALYTDTIRREKAMRERGLH 133

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 134 FVGAGISGGEEGALNGPSIMPGGPAESYESLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 193

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L K   +I+ +F +W++G L S+L++ITA++L  +
Sbjct: 194 KMVHNGIEYSDMQLIGEAYQLLRDGLGKTAEQIADVFDEWNSGDLDSFLVEITAQVLRQT 253

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 254 DAKTGKPLVDVILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVTQRKATTG 313

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +            F +D+  ALYAS I+++ QGF  I   S +Y W ++   +A IWR
Sbjct: 314 LASGELGANPTDAKQFTEDVRQALYASKIIAYAQGFNQIQAGSAEYGWGITPGDLATIWR 373

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I  +  EDP    L+  P     ++  I   RR+VVT T+ G P+P  
Sbjct: 374 GGCIIRAKFLNRIKDAFDEDPDLPTLIVAPYFRSAIEAAIDGWRRVVVTATQLGIPIPGF 433

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           S+ALSY+D    +R  A L Q  RDFFG+H + R D
Sbjct: 434 SSALSYYDALRTERLPAALTQGLRDFFGAHTYGRID 469


>gi|116626124|ref|YP_828280.1| 6-phosphogluconate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229286|gb|ABJ87995.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 485

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/467 (41%), Positives = 285/467 (61%), Gaps = 7/467 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + ADI +IGL  MG NL +N+ D G+ +  YN+     D F+   +  S KVI   ++E+
Sbjct: 3   QTADIALIGLAVMGQNLIMNMNDHGYTVVAYNRTTSKVDEFLNDAAKGS-KVIGAHSIEE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           MV+ + +PRKI++MV  G PVD+ I+ L P L P D+++DGGNSHF DT  R+  L  KG
Sbjct: 62  MVKLLKRPRKIMLMVKAGKPVDEFIETLLPYLEPGDLIIDGGNSHFPDTIRRTQYLESKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDGSG 180
           + F+G GVSGG +GAR G S+M GG   A+  V++I  +I AK  +  PCC  +G DG+G
Sbjct: 122 LLFVGTGVSGGEEGARFGPSMMPGGTPAAWPLVKDIFQAICAKTPEGEPCCDWVGRDGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM HNGIEY +MQLI + Y ++++ L  +  E+  +F++W+ G+L SYLI+IT +IL
Sbjct: 182 HFVKMTHNGIEYGDMQLICEAYQLMKEGLGMSNEEMHEVFAEWNKGELDSYLIEITRDIL 241

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG   +D I D A QKGTG  + +    L   +T+   A++AR LS  +D+  K
Sbjct: 242 GYKDPATGEQTLDKILDTAGQKGTGKWTSVSSLDLGMPVTLIGEAVYARCLSAMKDDRVK 301

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P + FP     +FV+D+  AL AS I+S+ QGF ++ +++++Y W L+  +IA
Sbjct: 302 ASKILTGPKAKFPGDK-KAFVEDIRQALLASKIVSYAQGFMLLAEAAKEYKWDLNYGSIA 360

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L  I  +   +P+  NLL        + +   S R  V     NG P
Sbjct: 361 MMWREGCIIRSVFLGKIKAAFANNPTLANLLLDSYFRGLLDRCQGSWRHTVSEAVLNGVP 420

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           VP+ + AL+++D +  +R  ANL+QAQRD+FG+H F+R D   +P G
Sbjct: 421 VPAFTTALAFYDGYRSERLPANLLQAQRDYFGAHTFERVD---QPRG 464


>gi|205374834|ref|ZP_03227627.1| 6-phosphogluconate dehydrogenase [Bacillus coahuilensis m4-4]
          Length = 466

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 286/464 (61%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+  KG  +AVYN   +LTD  +++       +      +  +++
Sbjct: 5   IGVIGLGVMGSNIALNMASKGETVAVYNYTRDLTDQLMERRD--DHALHPYYEAQDFIQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           +  PRKI MMVT G  VD +I  + P L   DI++DGGNS + D++ R  +L +KG++F+
Sbjct: 63  LEAPRKIFMMVTAGKAVDSVIHSILPFLEEGDIIMDGGNSFYKDSERRYEELRDKGVHFL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA +G S+M GG+++AY+ V +IL  ISAK    PCC  +GP G+GH+VKM
Sbjct: 123 GIGISGGEVGALTGPSIMPGGDKEAYDEVASILTKISAKVDGEPCCTYIGPKGAGHYVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLI + Y  LR ++  +  EI+ +F  W+ G+L SYLI+ITA IL   D 
Sbjct: 183 VHNGIEYADMQLITEAYTFLRQNVGLSIEEIAEIFDTWNQGELQSYLIEITASILKKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
           +TG P++DVI DK  Q GTG  + I+  +     TI   ++FAR +S  ++E  + +   
Sbjct: 243 VTGAPMVDVILDKVGQNGTGQWTSIQAIQDGIPSTIITESLFARYISSLKEERVQAEDLL 302

Query: 306 N-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           + PS        + +++ +  ALY   + ++ QGF    K+SE   W+L L  IA I+R 
Sbjct: 303 HGPSGERDELNKEKWIEYVRQALYMGKVCAYAQGFAQYKKTSELNGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+Q LN I +   E+    NLL  P  ++K+K     LR +V T    G   P LS
Sbjct: 363 GCIIRAQFLNVISQVYGENSELANLLVSPFFADKIKDYQKGLRNVVSTGVLTGTAFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           ++L+Y+D++     +A+L+QAQRD+FG+H ++RKD   + H  W
Sbjct: 423 SSLTYYDSYRKGESSASLLQAQRDYFGAHTYERKDMTGKFHTNW 466


>gi|15828114|ref|NP_302377.1| 6-phosphogluconate dehydrogenase [Mycobacterium leprae TN]
 gi|221230591|ref|YP_002504007.1| 6-phosphogluconate dehydrogenase [Mycobacterium leprae Br4923]
 gi|13093668|emb|CAC31020.1| 6-phosphogluconate dehydrogenase [Mycobacterium leprae]
 gi|219933698|emb|CAR72162.1| 6-phosphogluconate dehydrogenase [Mycobacterium leprae Br4923]
          Length = 483

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/471 (39%), Positives = 284/471 (60%), Gaps = 1/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G     + T+ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDTLLKE-HGSEGNFVRTETIPEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR++L+MV  GD  D +I++L  ++ P DI++DGGNS F DT  R   + E+G++
Sbjct: 70  AALQTPRRVLIMVKAGDATDAVINELADVMEPSDIIIDGGNSLFTDTIRREKAMRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA      CC  +GP GSGHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPAESYTSLGPLLEEISAHVDGVSCCTHIGPGGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L  +  +I+ +F++W+ G L+SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFTEWNRGDLNSYLVEITAEVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI DKA QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 250 DIKTGRPLVDVILDKAEQKGTGRWTVQSALDLGVPITGIAEAVFARALSGSVLQRKAAIG 309

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +          ++F++D+  ALYAS I+++ QGF  I   S ++ W+++   +A IWR
Sbjct: 310 LASGKLGNKPTDRETFIEDVRQALYASKIVAYAQGFNHIQTGSTEFGWNITPGDLATIWR 369

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I ++    P   +L+  P     V+  I S RR+V T T+ G P P  
Sbjct: 370 GGCIIRAKFLNRIKEAFDAAPDLASLIVAPYFRSAVESAIDSWRRVVSTATQLGIPNPGF 429

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S+ALSY+D    +R  A L QAQRDFFG+H + R D   + H  W +  +E
Sbjct: 430 SSALSYYDALRTERLPAALTQAQRDFFGAHSYGRVDARGKFHTLWSEDRSE 480


>gi|118463874|ref|YP_882057.1| 6-phosphogluconate dehydrogenase [Mycobacterium avium 104]
 gi|118165161|gb|ABK66058.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mycobacterium
           avium 104]
          Length = 494

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/459 (39%), Positives = 280/459 (61%), Gaps = 5/459 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G   + +  + + + +
Sbjct: 20  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLKE-HGDEGEFVRCETIAEFL 78

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 79  DALEKPRRVLIMVKAGDPTDAVINELADAMEPGDIIIDGGNALYTDTIRREQAMRERGLH 138

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 139 FVGAGISGGEEGALNGPSIMPGGPAESYRSLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 198

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD+L K   +I+ +F +W++G L S+L++ITA++L  +
Sbjct: 199 KMVHNGIEYSDMQLIGEAYQLLRDALGKTAEQIADVFDEWNSGDLDSFLVEITAQVLRQT 258

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++     L   +T    A+FAR LS    + +    
Sbjct: 259 DAKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVAQRRATTG 318

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               S     K  D+  F +D+  ALYAS I+++ QGF  I   S +Y W ++   +A I
Sbjct: 319 L--ASGRLGEKPSDAAQFTEDIRQALYASKIIAYAQGFNQIQAGSAEYGWDITPGDLATI 376

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I  +  E+P    L+  P     ++  I   RR+VVT T  G P+P
Sbjct: 377 WRGGCIIRAKFLNRIKDAFDENPDLPTLIVAPYFRSAIEAAIDGWRRVVVTATRLGIPIP 436

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
             S+ALSY+D    +R  A L Q  RDFFG+H + R D+
Sbjct: 437 GFSSALSYYDALRTERLPAALTQGLRDFFGAHTYGRIDE 475


>gi|23100642|ref|NP_694109.1| 6-phosphogluconate dehydrogenase [Oceanobacillus iheyensis HTE831]
 gi|22778876|dbj|BAC15143.1| phosphogluconate dehydrogenase (decarboxylating) [Oceanobacillus
           iheyensis HTE831]
          Length = 465

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 285/464 (61%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+ GLG MG+NL++N+ +KG ++AVYN   +LT+ F    +  S       +LE+ V +
Sbjct: 4   IGVFGLGVMGANLAMNMANKGEKVAVYNYTSDLTEKFKSNFT--SDNAEAHYDLERFVNS 61

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRK+ +MVT G  +D +ID L PLL  +DI++DGGNS+F D+  R  +L E GI+F+
Sbjct: 62  LEKPRKVFLMVTAGPVIDSVIDSLVPLLDKDDIMMDGGNSNFNDSNRRYHRLKEAGIHFV 121

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
            +GVSGG +GA  G +LM  G+EK Y  V  IL  I+A+     CC  LG +GSGH+VKM
Sbjct: 122 SVGVSGGEEGALHGPALMPSGDEKVYQEVAPILEKIAAQVDGKACCGYLGKEGSGHYVKM 181

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLI + Y  LR+ L  +  EI+  F +W+ G+L SYL++IT++IL+  D 
Sbjct: 182 VHNGIEYADMQLITEAYQFLRERLGLSVEEIATTFREWNEGELESYLMEITSDILTHVDE 241

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            T  P++DVI DK+ QKGTG  +      +   ++I   ++FAR LS  ++E  +     
Sbjct: 242 ETNKPMVDVILDKSGQKGTGKWTSQNALDVGVPLSIITESVFARFLSGLKEERVRADQML 301

Query: 306 NPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           +  +         ++++ +  AL+   I ++ QGF    ++SE Y W L L  IA I+R 
Sbjct: 302 SGPTKLDQDLDKQAWLELVRKALFMGKICAYAQGFHQYKQASEAYGWDLKLEEIALIFRG 361

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+ ILN+I  +   D    NLL  P   EK+     SLR++V+   E+G  +PSL 
Sbjct: 362 GCIIRAGILNEISDAFKADKQLPNLLLSPFFQEKMNDYQASLRKVVIKGMESGLSLPSLG 421

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           A+L+Y+D +   +  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 422 ASLTYYDGYRSSQSGANMIQAQRDYFGAHTYERVDKKGTFHTAW 465


>gi|170076852|ref|YP_001733490.1| 6-phosphogluconate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169884521|gb|ACA98234.1| 6-phosphogluconate dehydrogenase, decarboxylating [Synechococcus
           sp. PCC 7002]
          Length = 472

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/465 (40%), Positives = 289/465 (62%), Gaps = 10/465 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G+IGL  MG NL+LN+   GF +AVYN+    T+ F+     + + +    +LE
Sbjct: 1   MTKRTFGVIGLAVMGENLALNVERNGFPIAVYNRTASKTEEFMA-TRAVGKDIKAAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+ + +PRKIL+MV  G PVD +I+ LKPLL   D+++DGGNS + DT+ R+  L   
Sbjct: 60  EFVQLLERPRKILVMVKAGAPVDYVINDLKPLLEEGDMIIDGGNSLYEDTERRTKDLEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG E AY  +E IL  ++A+  + PC   +GP G+G
Sbjct: 120 GLGFVGMGVSGGEEGALNGPSLMPGGTEAAYRELEPILTKVAAQVNDGPCVTFIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM+HNGIEY +MQLIA+ Y +L ++   N  E+  +F++W+ T +L+S+LI+ITA+I
Sbjct: 180 HYVKMVHNGIEYGDMQLIAEAYDLLANAAKLNHTELHEVFTEWNQTDELNSFLIEITADI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  T  P++++I D A QKGTG  +++   +L   +     A+ AR +S Y+DE +
Sbjct: 240 FKKIDPETNQPLVELILDSAGQKGTGRWTVVSSLELGVPIPTIYAAVNARVMSAYKDE-R 298

Query: 300 KMQSFFNPSSHFPLKCF----DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           K  S   PS   P + +     +F+  + +ALY S + S+ QG  ++GK+S +Y ++L L
Sbjct: 299 KAASLELPS---PERVYRGDIKTFINQVRDALYCSKMCSYAQGMALLGKASAEYGYNLDL 355

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
              ARIW+ GCIIR+  L+ I  +  E+P+  NLL  P   + +     + R +++   E
Sbjct: 356 GETARIWKGGCIIRAGFLDKIKAAYVENPNLPNLLLAPEFKQSIIDRQTAWRTVILAANE 415

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            G  VP+ SA+L YFD++   R   NL QAQRD+FG+H ++R DK
Sbjct: 416 LGIAVPAFSASLDYFDSYRRARLPQNLTQAQRDYFGAHTYERTDK 460


>gi|150007301|ref|YP_001302044.1| 6-phosphogluconate dehydrogenase [Parabacteroides distasonis ATCC
           8503]
 gi|149935725|gb|ABR42422.1| 6-phosphogluconate dehydrogenase [Parabacteroides distasonis ATCC
           8503]
          Length = 486

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 295/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK ++IG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSNIGLIGLAVMGENLALNMESKGFTVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTERRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK  + +PCC  +G
Sbjct: 120 MEAHGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLDDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNEALARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILCFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ ++S++Y W L  
Sbjct: 300 EERKKASSLYPKSGALGQTLISE--KEIKQALYAAKLVSYAQGFSLLCQASKRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|2578375|emb|CAA15451.1| 6-phosphogluconate dehydrogenase [Mycobacterium leprae]
          Length = 486

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/471 (39%), Positives = 284/471 (60%), Gaps = 1/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  +K+  G     + T+ + + +
Sbjct: 14  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDTLLKE-HGSEGNFVRTETIPEFL 72

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+  PR++L+MV  GD  D +I++L  ++ P DI++DGGNS F DT  R   + E+G++
Sbjct: 73  AALQTPRRVLIMVKAGDATDAVINELADVMEPSDIIIDGGNSLFTDTIRREKAMRERGLH 132

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA      CC  +GP GSGHFV
Sbjct: 133 FVGAGISGGEEGALNGPSIMPGGPAESYTSLGPLLEEISAHVDGVSCCTHIGPGGSGHFV 192

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L  +  +I+ +F++W+ G L+SYL++ITAE+L  +
Sbjct: 193 KMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFTEWNRGDLNSYLVEITAEVLRQT 252

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI DKA QKGTG  ++     L   +T    A+FAR LS    + K    
Sbjct: 253 DIKTGRPLVDVILDKAEQKGTGRWTVQSALDLGVPITGIAEAVFARALSGSVLQRKAAIG 312

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +          ++F++D+  ALYAS I+++ QGF  I   S ++ W+++   +A IWR
Sbjct: 313 LASGKLGNKPTDRETFIEDVRQALYASKIVAYAQGFNHIQTGSTEFGWNITPGDLATIWR 372

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I ++    P   +L+  P     V+  I S RR+V T T+ G P P  
Sbjct: 373 GGCIIRAKFLNRIKEAFDAAPDLASLIVAPYFRSAVESAIDSWRRVVSTATQLGIPNPGF 432

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S+ALSY+D    +R  A L QAQRDFFG+H + R D   + H  W +  +E
Sbjct: 433 SSALSYYDALRTERLPAALTQAQRDFFGAHSYGRVDARGKFHTLWSEDRSE 483


>gi|319902523|ref|YP_004162251.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           helcogenes P 36-108]
 gi|319417554|gb|ADV44665.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           helcogenes P 36-108]
          Length = 494

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/476 (40%), Positives = 302/476 (63%), Gaps = 27/476 (5%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-LTDVFIKKISG---LSQKVIVTKN 58
           ++DIG+IGL  MG NL+LN+ DKG+ ++VYN+    + +  +++ +G     + +    +
Sbjct: 6   KSDIGLIGLAVMGENLALNMADKGWNVSVYNRTVPGVEEGVVQRFTGGRARGKSIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           +   V +V  PRKI+MMV  G  VD+L+++L PLLS  DIL+DGGNS++ DT  R +   
Sbjct: 66  IAGFVASVAVPRKIMMMVRAGSAVDELMEQLFPLLSEGDILIDGGNSNYEDTDRRVMLAE 125

Query: 119 EKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPD 177
           +KG  FIG GVSGG +GA +GAS+M GG+  A+  V+++L SI+AK  + +PCC  +GP 
Sbjct: 126 KKGFRFIGAGVSGGEEGALNGASIMPGGSASAWPEVKSVLQSIAAKASDGTPCCDWIGPA 185

Query: 178 GSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA 237
            SGHFVKMIHNGIEY +MQLIA+ Y +++  L  +  +++ +F++W+ GKL SYL +ITA
Sbjct: 186 SSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLGLDNEQMADIFARWNEGKLRSYLTEITA 245

Query: 238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSL---Y 294
            IL   D   G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS     
Sbjct: 246 GILRHKDKAGGY-LIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQKSL 304

Query: 295 RDES------KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEK 348
           RD +      +++Q+ +N             ++D+ +ALYAS ++S+ QGF V+ ++S+ 
Sbjct: 305 RDAASRQFAGQRLQAVYNKP---------EMIQDIHSALYASKLVSYAQGFAVLQRASDA 355

Query: 349 YSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSS---TNLLNIPSISEKVKKTIPS 405
           + W L LA+IAR+WR GCIIRS  LNDI  +      +    +LL  P    ++++ +P 
Sbjct: 356 FGWQLDLASIARMWRGGCIIRSAFLNDIAAAFQAQDKAGIPRHLLLAPYFKNEIQQQLPG 415

Query: 406 LRRIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
            + +V+   +   PVP+ S+AL+YF + +  +  AN+IQAQRD+FG+H F+R D++
Sbjct: 416 WKHLVMQSMKEELPVPAFSSALNYFYSLVSAKLPANMIQAQRDYFGAHTFERTDEL 471


>gi|28564155|gb|AAO32456.1| GND1 [Saccharomyces servazzii]
          Length = 493

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 281/456 (61%), Gaps = 8/456 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           AD G+IGL  MG NL LN+ D GF +  YN+     D F+       + ++  K++E+ +
Sbjct: 7   ADFGLIGLAVMGQNLILNVADHGFTVCAYNRTVSKVDDFLAN-EAKGKSIVGAKSIEEFI 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PRKI+++V  G PVD +I+ L P L   DI++DGGNSHF DT  R  +L++KGI 
Sbjct: 66  AKLKRPRKIMLLVKAGKPVDYIINDLLPHLEKGDIIIDGGNSHFPDTNRRYEELTKKGIL 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG E+A+  +++I  SISAK    PCC  +GP G+GH+V
Sbjct: 126 FVGSGVSGGEDGARYGPSLMPGGAEEAWPHIKDIFQSISAKADGEPCCDWVGPAGAGHYV 185

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++     +  EIS +F+ W+ G L S+LI+IT +IL+ +
Sbjct: 186 KMVHNGIEYGDMQLICEAYDIMKRIGGFSDKEISDVFATWNKGVLDSFLIEITRDILAFN 245

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE----SK 299
           D   G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  + E    SK
Sbjct: 246 DK-DGKPLVEKILDSAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKSERILASK 304

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           ++     P+    +K    FV +LE ALYAS I+S+ QGF +I ++++ Y W L+   IA
Sbjct: 305 QLAGPTIPAD--AIKDKKQFVDELEQALYASKIMSYAQGFMLIREAAKTYGWKLNNPAIA 362

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L +I K+  E+P   NLL     S+ V K     R+ +   T  G P
Sbjct: 363 LMWRGGCIIRSVFLGEITKAYRENPDLENLLLNKFFSDAVTKAQTGWRKTIGLATTYGIP 422

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF 455
            P+ S AL+++D +  +R  ANL+QAQRD+FG+H F
Sbjct: 423 TPTFSTALAFYDGYRSERLPANLLQAQRDYFGAHTF 458


>gi|284038939|ref|YP_003388869.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirosoma
           linguale DSM 74]
 gi|283818232|gb|ADB40070.1| 6-phosphogluconate dehydrogenase, decarboxylating [Spirosoma
           linguale DSM 74]
          Length = 484

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/461 (42%), Positives = 285/461 (61%), Gaps = 5/461 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K ADIG+IGL  MG NL LN+  KG+ +AVYN+  E  D FI    G  +  I   ++E+
Sbjct: 3   KTADIGLIGLAVMGENLVLNMESKGYTVAVYNRTVEKVDNFING-RGAGKNFIGAHSIEE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V ++  PRK++M+V  G PVD  ID++ P L P DIL+DGGNS+F DT  R+  +  KG
Sbjct: 62  LVASLESPRKVMMLVKAGQPVDDFIDQIIPHLEPGDILIDGGNSYFPDTIRRTQYVESKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
             ++G GVSGG  GA  G S+M GG+ +A+  V++I  SI+AK  N  PCC  +G DG+G
Sbjct: 122 FLYVGTGVSGGEIGALHGPSMMPGGSAQAWPFVKDIFQSIAAKVDNGVPCCDWVGSDGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQ+I + Y I++D L  +  E+  +F+KW+T +L SYLI+ITA+I+
Sbjct: 182 HFVKMVHNGIEYGDMQIIGEAYQIMKDLLGMSADEMHEVFTKWNTEELDSYLIEITADIM 241

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D   G P+ID I DKA QKGTG  +     +L   +T+   ++FAR LS  +D    
Sbjct: 242 AYKDE-DGSPMIDKILDKAGQKGTGKWTGSAALELGVPLTLIGESVFARFLSAQKDMRVA 300

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                + P   F      + + DL+ ALY + ++S+ QG+ ++ +++++Y W L    IA
Sbjct: 301 ASKLISGPKPEFSGDK-QAMLNDLKMALYGAKLISYAQGYNLLMEAAKEYDWQLDYGGIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L DI K+   +P+  +LL      +KV+      RR+      NG P
Sbjct: 360 LMWRGGCIIRSAFLGDIKKAFDNNPALAHLLLDDFFKQKVELAQDGWRRVCAAALLNGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            PSL++AL Y D F  +   ANL+QAQRD+FG+H ++R DK
Sbjct: 420 APSLTSALCYLDGFRSEWLPANLLQAQRDYFGAHTYERIDK 460


>gi|38233803|ref|NP_939570.1| 6-phosphogluconate dehydrogenase [Corynebacterium diphtheriae NCTC
           13129]
 gi|38200064|emb|CAE49740.1| 6-phosphogluconate dehydrogenase, decarboxylating [Corynebacterium
           diphtheriae]
          Length = 484

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 289/475 (60%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IGI+GL  MGSNL+ N   KG  +AV+N+ FE T   + +  G     I +  +E+ V
Sbjct: 8   AQIGIVGLAVMGSNLARNFAHKGHTVAVFNRSFEKTQALMDQ-HGDEGNFIPSATIEEFV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G   D +I++L   +   DI++DGGN+ + DT  R  +++++G+ 
Sbjct: 67  ASLEKPRRAIIMVQAGPATDAVINQLADAMDEGDIIIDGGNALYTDTIRRESEIAQRGLN 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG +K++  +  +L SI+A+   +PC   +GPDG+GHFV
Sbjct: 127 FVGAGISGGEEGALNGPSIMPGGPDKSWEALGPLLESIAAQVGGTPCVTHIGPDGAGHFV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F  W+ G L SYLI+IT+E+L+  
Sbjct: 187 KMVHNGIEYADMQVIGEAYQLLRYATEMQPSEIADVFKTWNQGDLDSYLIEITSEVLAQV 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D+ TG P+ID+I D+A QKGTG  ++     L  + T    A+FAR LS    + K  Q 
Sbjct: 247 DSETGTPLIDLIVDEAGQKGTGRWTVKAALDLGIATTGIGEAVFARALSGATTQRKAAQG 306

Query: 304 FFNPSSHFPLKCF----DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +   L       D FV+D+  ALYAS ++++ QGF  I   S +++W +    +A
Sbjct: 307 NLPAGTLESLASLNIDKDQFVEDVRRALYASKLVAYAQGFDEIIAGSAEHNWDVDPRDLA 366

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN IV++   +P   +LL  P    +++  I S RR+VV  T+ G P
Sbjct: 367 TIWRGGCIIRAKFLNRIVEAYDANPELPSLLLDPYFKTELESLIDSWRRVVVAATQLGLP 426

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 427 VPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYRRTDKDGSFHTLWSGDRSE 481


>gi|302562212|ref|ZP_07314554.1| 6-phosphogluconate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302479830|gb|EFL42923.1| 6-phosphogluconate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 479

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/468 (40%), Positives = 287/468 (61%), Gaps = 5/468 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +AV+N+    T   +++  G     +  +  ++ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVAVHNRTAARTHALVEEF-GHEGSFVAAETAKEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+P D +I++  PLL P D+++DGGN+HF DT+ R   L E+GI+
Sbjct: 64  AALERPRRLVVMVKAGEPTDAVIEEFAPLLEPGDMIIDGGNAHFADTRRREKALREQGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G+GVSGG +GA  G S+M GG +++Y+ +  +L  ISAK ++ SPC   +GPDG+GHF
Sbjct: 124 FVGMGVSGGEEGALHGPSIMPGGPKESYDSLGPMLEKISAKAKDGSPCVTHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P +I+ +F  W+TG+L SYLI+ITAE+LS 
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPAQIADIFRTWNTGRLDSYLIEITAEVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS +    +  +
Sbjct: 244 VDAATGEPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAALREASR 303

Query: 303 SFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               P +  PL   +  +F   +E ALYAS I+S+TQGF  I   SE+YSW + L  ++ 
Sbjct: 304 GLAGPKA-APLGESEAAAFADRVEQALYASKIVSYTQGFHEIAAGSEEYSWDIDLGAVSA 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+  L+ I  +    P   +LL+  + + ++       R +++  T  G P 
Sbjct: 363 IWRGGCIIRAAFLDRIRAAYDARPGLPSLLSDETFAREIADAQDDWREVLIAATRQGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  +AAL+Y+D    +R  A L Q QRD+FG+H + R D+    H  W
Sbjct: 423 PGFAAALAYYDALRAERLPAALTQGQRDYFGAHTYRRTDREGSFHTLW 470


>gi|294790263|ref|ZP_06755421.1| 6-phosphogluconate dehydrogenase, decarboxylating [Scardovia
           inopinata F0304]
 gi|294458160|gb|EFG26513.1| 6-phosphogluconate dehydrogenase, decarboxylating [Scardovia
           inopinata F0304]
          Length = 489

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/473 (39%), Positives = 292/473 (61%), Gaps = 5/473 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A+IG+IGLG MG++L+ N+  +G  +AVYN+  + T  F+K+  G     I    L++
Sbjct: 9   EKANIGVIGLGVMGASLARNLAHQGNVVAVYNRHTDKTADFMKRY-GAEGSFIPAATLQE 67

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           + +++ KPRK+++M+T G   D +ID L  +  P+DI++DGGN++F DT  R   + E G
Sbjct: 68  LSDSLAKPRKVILMITAGRATDAVIDDLLGIFEPDDIIIDGGNAYFEDTMRREKNVREHG 127

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++F+G G+SGG +GA  G S+M GG + ++N ++ I  SI+AK +  PC   +G +G+GH
Sbjct: 128 LHFVGCGISGGEEGALKGPSMMPGGTDWSWNYLKPIFESIAAKAEGEPCVTHIGENGAGH 187

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQLI + Y +LR  L   P EI  +F +W+ G+L+SYL++IT++IL 
Sbjct: 188 FVKMVHNGIEYADMQLIGESYDLLRRGLGLTPKEIGDIFDQWNKGELNSYLVEITSDILH 247

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK-- 299
            +D  +G P +DV+ D A  KGTG  ++     L++ +T    A+F+R LS  +++ +  
Sbjct: 248 HTDAASGKPFVDVVLDVAGMKGTGTWTVQTALSLATPVTGIAEAVFSRGLSGQKEQRQEN 307

Query: 300 KMQSFFNPSSHFPL--KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           +      P     L     ++FV+ +  ALYAS I+++ QGF  I   +++Y W + L  
Sbjct: 308 RRNPLAGPDGTIDLTDDQKEAFVEAVRQALYASKIVAYAQGFDEINAGAQEYGWHIDLGA 367

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           +ARIWR GCIIR++ LN I  +     + ++LL      + V+    S RR+V    + G
Sbjct: 368 VARIWRGGCIIRAKFLNRISDAYDSGRTFSSLLFDDYFKKAVENAQESWRRVVAAAAQAG 427

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            PVP+ +++LSY+D    DR  A LIQ QRDFFG+H + R DK    H  W +
Sbjct: 428 IPVPAFASSLSYYDGLRSDRLPAALIQGQRDFFGAHTYKRVDKPGTFHTLWAQ 480


>gi|268590240|ref|ZP_06124461.1| 6-phosphogluconate dehydrogenase, decarboxylating [Providencia
           rettgeri DSM 1131]
 gi|291314524|gb|EFE54977.1| 6-phosphogluconate dehydrogenase, decarboxylating [Providencia
           rettgeri DSM 1131]
          Length = 468

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/474 (40%), Positives = 291/474 (61%), Gaps = 10/474 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++    +E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSKDKTDEVIAENPG--KKLVPNYTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTLFTDTIRRNRELSEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+A+ +  PC   +G DG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAQAEGEPCVTYIGADGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+ SLN +  E++ +F++W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKGSLNLSNEELAGIFAEWNKGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 239 KKKDE-DGKYLVDVILDEAANKGTGKWTSQSALDLGIPLTLITESVFARYISFLKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFDS----FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                   +   LK  +     F++ +  ALY   I+S+ QGF  +  +SE+Y+W L+  
Sbjct: 298 ASKVLTGPT---LKAVEGDKKDFIEKVRRALYLGKIVSYAQGFQQLKAASEEYNWDLNYG 354

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA+I+RAGCIIR+Q L  I  +  +D    NLL  P   +   +   +LR +V    +N
Sbjct: 355 EIAKIFRAGCIIRAQFLQKITDAYNQDAKIANLLLAPYFKQIADEYQQALRDVVCYGVQN 414

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           G P P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 415 GIPTPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKDGVFHTEWME 468


>gi|15841312|ref|NP_336349.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|148823055|ref|YP_001287809.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis F11]
 gi|215403852|ref|ZP_03416033.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis
           02_1987]
 gi|215427189|ref|ZP_03425108.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis T92]
 gi|215430748|ref|ZP_03428667.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis
           EAS054]
 gi|215446033|ref|ZP_03432785.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis T85]
 gi|219557791|ref|ZP_03536867.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis T17]
 gi|253799112|ref|YP_003032113.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           KZN 1435]
 gi|254232022|ref|ZP_04925349.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           C]
 gi|254364667|ref|ZP_04980713.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           str. Haarlem]
 gi|254550853|ref|ZP_05141300.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260186808|ref|ZP_05764282.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis
           CPHL_A]
 gi|260200928|ref|ZP_05768419.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|260205127|ref|ZP_05772618.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis K85]
 gi|289443320|ref|ZP_06433064.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           tuberculosis T46]
 gi|289447458|ref|ZP_06437202.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           CPHL_A]
 gi|289554382|ref|ZP_06443592.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           KZN 605]
 gi|289569920|ref|ZP_06450147.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T17]
 gi|289574526|ref|ZP_06454753.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           K85]
 gi|289745724|ref|ZP_06505102.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           02_1987]
 gi|289750417|ref|ZP_06509795.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T92]
 gi|289753937|ref|ZP_06513315.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           EAS054]
 gi|289757949|ref|ZP_06517327.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T85]
 gi|294996752|ref|ZP_06802443.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis 210]
 gi|297634404|ref|ZP_06952184.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis KZN
           4207]
 gi|297731391|ref|ZP_06960509.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis KZN
           R506]
 gi|306779843|ref|ZP_07418180.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu002]
 gi|306784586|ref|ZP_07422908.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu003]
 gi|306788948|ref|ZP_07427270.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu004]
 gi|306793284|ref|ZP_07431586.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu005]
 gi|306797662|ref|ZP_07435964.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu006]
 gi|306803550|ref|ZP_07440218.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu008]
 gi|306808124|ref|ZP_07444792.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu007]
 gi|306967938|ref|ZP_07480599.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu009]
 gi|313658725|ref|ZP_07815605.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis KZN
           V2475]
 gi|13881543|gb|AAK46163.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mycobacterium
           tuberculosis CDC1551]
 gi|124601081|gb|EAY60091.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           C]
 gi|134150181|gb|EBA42226.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148721582|gb|ABR06207.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           F11]
 gi|253320615|gb|ACT25218.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           KZN 1435]
 gi|289416239|gb|EFD13479.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           tuberculosis T46]
 gi|289420416|gb|EFD17617.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           CPHL_A]
 gi|289439014|gb|EFD21507.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           KZN 605]
 gi|289538957|gb|EFD43535.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           K85]
 gi|289543674|gb|EFD47322.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T17]
 gi|289686252|gb|EFD53740.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           02_1987]
 gi|289691004|gb|EFD58433.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T92]
 gi|289694524|gb|EFD61953.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           EAS054]
 gi|289713513|gb|EFD77525.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           T85]
 gi|308327206|gb|EFP16057.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu002]
 gi|308330630|gb|EFP19481.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu003]
 gi|308334475|gb|EFP23326.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu004]
 gi|308338268|gb|EFP27119.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu005]
 gi|308341959|gb|EFP30810.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu006]
 gi|308345439|gb|EFP34290.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu007]
 gi|308349741|gb|EFP38592.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu008]
 gi|308354381|gb|EFP43232.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu009]
 gi|323719585|gb|EGB28708.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903446|gb|EGE50379.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           W-148]
 gi|328458867|gb|AEB04290.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           KZN 4207]
          Length = 483

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/471 (39%), Positives = 279/471 (59%), Gaps = 1/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +AV+N+    TD  +K+ S    K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVAVHNRSVAKTDALLKEHSS-DGKFVRSETIPEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ KPR++L+MV  G+  D +I++L   + P DI++DGGN+ + DT  R   + E+G++
Sbjct: 70  AALEKPRRVLIMVKAGEATDAVINELADAMEPGDIIIDGGNALYTDTMRREKAMRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPAESYQSLGPLLEEISAHVDGVPCCTHIGPDGSGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y ++RD L      I+ +F++W+ G L SYL++ITAE+L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLMRDGLGLTAPAIADVFTEWNNGDLDSYLVEITAEVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    +      
Sbjct: 250 DAKTGKPLVDVIVDRAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVGQRSAASG 309

Query: 304 FFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
             +           +F +D+  ALYAS I+++ QGF  I   S ++ W ++   +A IWR
Sbjct: 310 LASGKLGEQPADPATFTEDVRQALYASKIVAYAQGFNQIQAGSAEFGWDITPGDLATIWR 369

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR++ LN I ++    P+  +L+  P     V+  I S RR+V T  + G P P  
Sbjct: 370 GGCIIRAKFLNHIKEAFDASPNLASLIVAPYFRGAVESAIDSWRRVVSTAAQLGIPTPGF 429

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S+ALSY+D     R  A L QAQRDFFG+H + R D+  + H  W    TE
Sbjct: 430 SSALSYYDALRTARLPAALTQAQRDFFGAHTYGRIDEPGKFHTLWSSDRTE 480


>gi|299145338|ref|ZP_07038406.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           3_1_23]
 gi|298515829|gb|EFI39710.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           3_1_23]
          Length = 508

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 302/472 (63%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + + F+      K I G + 
Sbjct: 23  KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVERFLNGRAKGKNIEGFT- 81

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 82  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 135

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R +QL+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +P
Sbjct: 136 -RRVQLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTP 194

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL 
Sbjct: 195 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLR 254

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 255 SYLIEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 313

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D        F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 314 SLSSQKDLRHLASKQFQCQHTQPIYNKAELVKNIFSALYASKLVSYAQGFAVLQRASDAF 373

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 374 GWHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKSL 433

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 434 VAESMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 485


>gi|260170669|ref|ZP_05757081.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. D2]
 gi|315919013|ref|ZP_07915253.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           D2]
 gi|313692888|gb|EFS29723.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           D2]
          Length = 491

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 208/465 (44%), Positives = 303/465 (65%), Gaps = 8/465 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+     +  V  + ++G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVERFLNGRAKGKNIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           ++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT  R +QL+
Sbjct: 66  IKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN-RRVQLA 124

Query: 119 E-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGP 176
           E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +PCC  +GP
Sbjct: 125 ESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTPCCQWVGP 184

Query: 177 DGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKIT 236
            GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL SYLI+IT
Sbjct: 185 AGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLRSYLIEIT 244

Query: 237 AEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           A IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  +D
Sbjct: 245 ANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSSQKD 303

Query: 297 ESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                   F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ + W L LA
Sbjct: 304 LRHLASKQFQCQHTQPIYNKAELVKNIFSALYASKLVSYAQGFAVLQRASDAFGWHLDLA 363

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
           +IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +V    + 
Sbjct: 364 SIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKSLVAESMKE 423

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
             PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 424 ELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|217966634|ref|YP_002352140.1| 6-phosphogluconate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335733|gb|ACK41526.1| 6-phosphogluconate dehydrogenase, decarboxylating [Dictyoglomus
           turgidum DSM 6724]
          Length = 470

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/467 (41%), Positives = 291/467 (62%), Gaps = 1/467 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGL  MG NL+LNI   GF ++VYN+  E T  FI+K     +K+    +L+  VE+
Sbjct: 5   IGLIGLAVMGQNLALNIARNGFSVSVYNRTPERTKEFIEKRVK-EEKIDPYYDLKSFVES 63

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI++MV  G PVD++I +L P L P D+++DGGNS+F DT  R  +L +KGI ++
Sbjct: 64  LEKPRKIILMVKAGQPVDEMIQELLPYLEPGDLIIDGGNSYFRDTSRRIRELKDKGILYL 123

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+GVSGG  GA  G SLM GG ++AY  VE +LL I+AK ++ PCC  +G D +GHFVKM
Sbjct: 124 GMGVSGGEYGALHGPSLMPGGTKEAYKLVEEMLLKIAAKTEDGPCCTYVGDDSAGHFVKM 183

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA M+LIA+IY I+R  LN    EI  +F  W+ G+L+S+L++I+ +I+   D 
Sbjct: 184 VHNGIEYAIMELIAEIYDIMRKVLNMPSEEIGKVFESWNNGELNSFLMEISYKIMRVKDE 243

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P++++I DKA QKGTG  +      L         A+ AR +S ++D   ++    
Sbjct: 244 ETGKPLVELILDKAEQKGTGKWTAQTALDLGIPTPTLNMAVEARIISHFKDLRVELSKTL 303

Query: 306 NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAG 365
             S        +  +KDLE AL     +SF+QG W+I ++S+  ++++ L+ + RIW+ G
Sbjct: 304 PVSKESISLNREEILKDLEKALLFGVFISFSQGLWLIDEASKVLNYNIDLSEVLRIWKGG 363

Query: 366 CIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSA 425
           CIIR++ILN + + + E+P + NLL        +K  I S+++I      +G  +  L++
Sbjct: 364 CIIRAKILNFLREIIKENPQNANLLASEKTVNFLKDKIESVKKISDIGKRSGISLLCLNS 423

Query: 426 ALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           AL Y+     +   ANLIQAQRDFFG+H ++R DK    H  W+K+ 
Sbjct: 424 ALDYYFALATENLPANLIQAQRDFFGAHTYERIDKEGIFHTEWEKLE 470


>gi|293371921|ref|ZP_06618324.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           ovatus SD CMC 3f]
 gi|292633090|gb|EFF51668.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           ovatus SD CMC 3f]
          Length = 491

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 302/472 (63%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + + F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVERFLNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R +QL+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +P
Sbjct: 119 -RRVQLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D        F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSSQKDLRHLASKQFQCQHTQPIYNKAELVKNIFSALYASKLVSYAQGFAVLQRASDAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 357 GWHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKSL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAESMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|255014074|ref|ZP_05286200.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_7]
          Length = 486

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 295/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK ++IG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSNIGLIGLAVMGENLALNMESKGFAVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTEHRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK  + +PCC  +G
Sbjct: 120 MEAYGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLDDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNEALARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILRFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ ++S++Y W L  
Sbjct: 300 EERKKASSLYPKSGVLGQTLISE--KEIKQALYAAKLVSYAQGFSLLCQASKRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|116492481|ref|YP_804216.1| 6-phosphogluconate dehydrogenase [Pediococcus pentosaceus ATCC
           25745]
 gi|116102631|gb|ABJ67774.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Pediococcus
           pentosaceus ATCC 25745]
          Length = 472

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 290/471 (61%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q  IG++G+  MG NL+LNI  +G+ +A+YN+    T+  ++  S   +K++   ++E
Sbjct: 1   MDQPQIGVVGMAVMGKNLALNIESRGYTVAIYNRTASKTEKVMQDHS--EKKLVPAYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I+MMV  G P D +I +L PLL   D+L+DGGN++F DT  R+ +L E 
Sbjct: 59  EFVNSLEKPRRIMMMVKAGKPTDAVIAELLPLLDKGDVLIDGGNTNFEDTMRRNKELDES 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG  GA  G S+M GG ++AY+ V  I   ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGELGALQGPSMMPGGQKEAYDLVAPIFEQISAKAKDGDPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + QLI + Y ++R  L     EI+ +F+ W+ G+L SYLI ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDEQLIDESYDLMRKLLGLPVKEIADIFADWNQGELDSYLIDITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+ +D + +  PI+D+I DK   KGTG  S     +L    ++   +++AR +S+ +DE 
Sbjct: 239 LTRTDDLGSDKPIVDLIMDKGGNKGTGKWSSQNALELGVPQSLITESVYARYISVLKDER 298

Query: 299 KKMQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                    P     +   D  ++ +  ALY S I+S+ QGF  +  +SE Y W+L+   
Sbjct: 299 VAASKVLAGPEKKIDVDK-DEVIEKIRRALYFSKIMSYAQGFEQMRVASENYDWNLNFGE 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L +I  +  ++P   NLL      E   K   ++R +V    + G
Sbjct: 358 IAKIWRAGCIIRAQFLQNITDAFDKNPELNNLLMDSYFQEIAAKYQEAVRDVVALAVKAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+LSAA++Y+D++      ANL+QAQRD+FG+H ++R D+    H PW
Sbjct: 418 IPVPALSAAVAYYDSYRSAVLPANLLQAQRDYFGAHTYERVDREGIYHFPW 468


>gi|227529997|ref|ZP_03960046.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           vaginalis ATCC 49540]
 gi|227350076|gb|EEJ40367.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           vaginalis ATCC 49540]
          Length = 491

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/479 (40%), Positives = 294/479 (61%), Gaps = 20/479 (4%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A IG++GL  MG NL+LNI  +GF + VYN+    TD  I+      +K++ +  +E 
Sbjct: 17  QKAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDEMIRDHG--DKKLVPSYTIED 74

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ILMMV  G   D +ID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 75  FVNSLEKPRRILMMVKAGKATDAVIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSG 134

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ VE IL  I+AK +    PC A +GP+G+
Sbjct: 135 INFIGMGVSGGELGALYGPSLMPGGQKEAYDLVEPILTKIAAKAEEDGKPCVAYIGPNGA 194

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+I
Sbjct: 195 GHYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADI 254

Query: 240 LSSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           L+  D +      PI+D+I D+ + KGTG  S        +  ++   A++AR +S+ + 
Sbjct: 255 LTRKDDLGDDKSKPIVDMILDRGANKGTGKWSSETALDGGAPQSVITEAVYARYISMMKK 314

Query: 297 ESKKMQSFFNPSSHFPLKCF-------DSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           E  ++Q+    S   P+             V+ +  ALY   ++S+ QGF  +   SE+Y
Sbjct: 315 E--RVQA----SKELPVDTEAVSIDNKKELVEKIRQALYFGKVMSYAQGFEQMRIDSERY 368

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
           +W+L    +A+IWRAGCIIR+Q L +I  +  ++P   NLL      +  KK   ++R +
Sbjct: 369 NWNLQYGELAQIWRAGCIIRAQFLQNITDAFAKNPDLKNLLFDDYFKDIAKKYQKAIRDV 428

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSLSAA+SY+D+F  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 429 VALAVKAGVPVPSLSAAISYYDSFRAEVLPANLLQAQRDYFGAHTYERTDRPGNYHYSW 487


>gi|257885310|ref|ZP_05664963.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,501]
 gi|257821162|gb|EEV48296.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,501]
          Length = 473

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYALVAPILEQISAKAEDGAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ LN +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILNLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +SE++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKELVEKIREALYFSKIMSYAQGFAQLRVASEEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYDKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|290997790|ref|XP_002681464.1| 6-phosphogluconate dehydrogenase [Naegleria gruberi]
 gi|284095088|gb|EFC48720.1| 6-phosphogluconate dehydrogenase [Naegleria gruberi]
          Length = 475

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/474 (40%), Positives = 301/474 (63%), Gaps = 7/474 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGL---SQKVIVTKNLE 60
           ADIG+IGL  MG NL+LNI DKGF+++VYN+ +E T+  +K+       S ++   K ++
Sbjct: 2   ADIGLIGLAVMGQNLALNIADKGFKISVYNRSYEKTEHTVKRAEDEGKGSYQLAGFKTMQ 61

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPRK++M+V  G+PVD  I+ L PLL   DI++DGGN  F +T+ R+ +  E 
Sbjct: 62  EFVNSLSKPRKVIMLVQAGNPVDSTIELLSPLLEKGDIIIDGGNEWFLNTEKRAKKAVEL 121

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSP-CCALLGPDGS 179
           G+ ++G+GVSGG +GAR G SLM GG  +AY+++++IL  I+A   N P C   +G  GS
Sbjct: 122 GLLYMGMGVSGGEEGARHGPSLMPGGPIEAYDQIKHILEKIAAPLVNEPPCVTYIGERGS 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           G++VKM+HNGIEY +MQLIA++Y +++        EI+  F++W+  +L SYLI+IT++I
Sbjct: 182 GNYVKMVHNGIEYGDMQLIAEVYDMMKSVGKLTNEEIAETFTEWNNSELKSYLIEITSKI 241

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D +    ++D I DK+  KGTG  ++ EG +   ++    +A+ +R +S  RDE  
Sbjct: 242 FKKKDDLGEGHLVDKIVDKSGSKGTGKWTVQEGAERGIAIPTMASALDSRYISSLRDERL 301

Query: 300 KMQS-FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             +S    P+ +   +  D   FV+ L+NALY S I S+TQG  +I ++S++Y W+L L 
Sbjct: 302 SAESQLTGPTPNDLTETVDKKVFVQQLKNALYCSKICSYTQGMNLIAEASKQYGWNLKLG 361

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IARIW+ GCIIR+  L+ I  +   +P+  +L   P  ++++ +   + R+I+      
Sbjct: 362 EIARIWKGGCIIRAVFLDRIKNAYDLNPNLPSLFLDPDFNKEIAERQAAWRKIIQMAISA 421

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
           G P P+LS++L+Y+D++   R  ANLIQAQRDFFG+H ++R D     H  W++
Sbjct: 422 GIPTPALSSSLAYYDSYRRGRLPANLIQAQRDFFGAHTYERTDMKGAFHAKWEE 475


>gi|239945806|ref|ZP_04697743.1| 6-phosphogluconate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239992277|ref|ZP_04712941.1| 6-phosphogluconate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291449265|ref|ZP_06588655.1| 6-phosphogluconate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291352212|gb|EFE79116.1| 6-phosphogluconate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 480

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/468 (40%), Positives = 284/468 (60%), Gaps = 5/468 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    GF +A++N+    TD  +++  G     +     E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGFTVALHNRTTSRTDALVEEF-GDEGTFVAAHTPEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G P D +I +  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVIMVKAGKPTDAVIQEFAPLLEEGDVIIDGGNAHFEDTRRREKELRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G+G+SGG +GA +G S+M GG+ ++Y  +  +L  I+A+ ++ +PC A +GPDG+GHF
Sbjct: 124 FVGVGISGGEEGALNGPSIMPGGSAESYASLGPMLERIAAQAKDGTPCTAHIGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR     +P +I+ +F  W+TG+L SYLI+ITAE+L+ 
Sbjct: 184 VKMVHNGIEYADMQLIAEAYDLLRAVAGYSPAQIADVFRTWNTGRLDSYLIEITAEVLAH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +D++ D+A QKGTG  ++     L   ++    A+FAR+LS + D  +  +
Sbjct: 244 TDAATGKPFVDIVQDRAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHADLREAAR 303

Query: 303 SFFNPSSHFPLK--CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               P+   PL      +F   +E ALYAS I+S+TQGF  I   SE Y W + L ++A 
Sbjct: 304 GLPGPTPE-PLDAAGAAAFADKVEQALYASKIVSYTQGFHQIRAGSEAYDWDIDLGSVAA 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+ I  +    P   +LL+     +++       R +V      G P 
Sbjct: 363 IWRAGCIIRAAFLDRIRAAYDSRPDLVSLLSDKEFGQEIGAAQEDWRAVVAEAVRQGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  +AAL+Y+D    DR  A L Q QRDFFG+H + R D+    H  W
Sbjct: 423 PGFAAALAYYDGLRADRLPAALTQGQRDFFGAHTYRRTDREGSFHTLW 470


>gi|332712030|ref|ZP_08431960.1| 6-phosphogluconate dehydrogenase [Lyngbya majuscula 3L]
 gi|332349358|gb|EGJ28968.1| 6-phosphogluconate dehydrogenase [Lyngbya majuscula 3L]
          Length = 477

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/478 (39%), Positives = 298/478 (62%), Gaps = 6/478 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M Q   G+IGL  MG NL+LN+  +GF +AVYN+    T+ F+ +     + V    +LE
Sbjct: 1   MTQRTFGVIGLAVMGENLALNVESRGFPIAVYNRTAAKTEKFMAE-RAQGKDVKAAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+A+ +PRKIL+MV  G PVD +I++LKPLL P D+++DGGNS + DT+ R+  L   
Sbjct: 60  EFVQALERPRKILVMVKAGKPVDAVIEQLKPLLEPGDMIIDGGNSLYQDTERRTKDLEAT 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G+ F+G+GVSGG +GA +G SLM GG   AY  +E IL  I+A+  + PC   +GP G+G
Sbjct: 120 GLGFVGMGVSGGEEGALNGPSLMPGGTSSAYQDLEPILTKIAAQVDDGPCVTYIGPGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEI 239
           H+VKM HNGIEY +MQLIA+ Y +L+++L  +  ++  +F++W+ T +L+S+LI+ITA+I
Sbjct: 180 HYVKMAHNGIEYGDMQLIAEAYDVLKNALGLDHKQLHEVFAEWNTTDELNSFLIEITADI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES- 298
               D  T  P++++I D A QKGTG  +++   +L  S+     A+ AR +S ++D+  
Sbjct: 240 FKYIDPDTNGPLVEMILDAAGQKGTGRWTVVSSLELGVSIPTIYAAVNARVMSSFKDQRV 299

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
              +    P   +      +F+  + +ALY S + S+ QG  ++ ++SE+++++L+L+ +
Sbjct: 300 AAAKEITGPVGKYDGDV-KAFITKVRDALYCSKMCSYAQGMALLSRASEEFNYNLNLSEV 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARIW+ GCIIR+  L+ I  +  ++P   NLL  P   + +       R ++    + G 
Sbjct: 359 ARIWKGGCIIRAGFLDKIKNAFNQNPQLPNLLLAPEFKQTILDRQDGWRDVLAVSNKLGI 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVSTE 474
           PVP+ SA+L YFD++  DR   NL QAQRD+FG+H ++R DK      H  W  +S++
Sbjct: 419 PVPAFSASLDYFDSYRRDRLPQNLTQAQRDYFGAHTYERLDKPRGEFFHTDWMGLSSQ 476


>gi|301310699|ref|ZP_07216638.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           20_3]
 gi|300832273|gb|EFK62904.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           20_3]
          Length = 486

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/464 (40%), Positives = 294/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNK----DFELTDVFIKKISGLSQKVIVT 56
           MK ++IG+IGL  MG NL+LN+  KGF ++VYN+    +  + D F+    G  +  I T
Sbjct: 1   MKTSNIGLIGLAVMGENLALNMESKGFAVSVYNRTAPGEEGVVDRFMSG-RGKGKNFIGT 59

Query: 57  KNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQ 116
             +++ VE++ +PRKI++MV  G PVD+L+ +L P LSP D+++DGGNS F DT+ R  +
Sbjct: 60  HTIQEFVESIERPRKIMLMVKAGAPVDELMAQLIPYLSPGDVIIDGGNSDFHDTERRVKE 119

Query: 117 LSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLG 175
           +   G+YF+G G+SGG  GA  G S+M GG+  A+  V+++L SI+AK  + +PCC  +G
Sbjct: 120 MEAHGMYFVGTGISGGEIGALYGPSVMPGGSPAAWPLVKDVLQSIAAKLDDGTPCCQWIG 179

Query: 176 PDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKI 235
           P G+GHFVKM+HNGIEY +MQLI++ Y +L++ L+ +   ++ +F  W+TG+L SYLI I
Sbjct: 180 PGGAGHFVKMVHNGIEYGDMQLISEAYSLLKNRLDLDNETLARIFEDWNTGELDSYLIGI 239

Query: 236 TAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYR 295
           TA+IL   D      ++D I D A QKGTG  S I     +  +T+   A++AR LS  +
Sbjct: 240 TADILRFKDEAGEGYLLDKILDAAGQKGTGKWSAIAAMDENDPLTLITEAVYARMLSSMQ 299

Query: 296 DESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           +E KK  S +  S            K+++ ALYA+ ++S+ QGF ++ +++ +Y W L  
Sbjct: 300 EERKKASSLYPKSGVLGQTLISE--KEIKQALYAAKLVSYAQGFSLLYQATNRYDWQLDY 357

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
            TIA+IWR GCIIRS  L  I ++  ++ +  NLL      +K++ ++ + R++V     
Sbjct: 358 GTIAKIWRKGCIIRSVFLEKITQAYEKNRNLENLLFDEFFIQKIESSLLAWRQVVAEGAL 417

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +G  +P++S+ LSYFD        ANLIQAQRD+FG+H ++R D
Sbjct: 418 HGVALPAMSSGLSYFDGLSTPHSAANLIQAQRDYFGAHTYERVD 461


>gi|290473986|ref|YP_003466860.1| gluconate-6-phosphate dehydrogenase, decarboxylating [Xenorhabdus
           bovienii SS-2004]
 gi|289173293|emb|CBJ80068.1| gluconate-6-phosphate dehydrogenase, decarboxylating [Xenorhabdus
           bovienii SS-2004]
          Length = 468

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/469 (40%), Positives = 288/469 (61%), Gaps = 4/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++ + ++E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVIAENPG--KKLVPSYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN++F DT  R+ +LS +
Sbjct: 59  EFVGSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYFQDTIRRNRELSAQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+AK    PC   +G DG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAKVDGEPCVTYIGADGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+ SLN +  E++ +FS W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKHSLNLSNQELADVFSDWNQGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G  ++DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 239 RKKDE-EGQYLVDVILDEAANKGTGKWTSQSSLDLGVPVTLITESVFARYISSLKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P     + F++ +  ALY   I+S+ QGF  +  SS+ Y+W L+   IA
Sbjct: 298 ASKVLSGPEAQPFNGDKAEFIEKVRRALYLGKIVSYAQGFQQLKASSDDYNWDLNYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E+ +  NLL  P   +   +   +LR +V    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITNAYNENAAIANLLLAPYFKQVADEYQQALRDVVSYGVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 418 TPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEW 466


>gi|319648448|ref|ZP_08002664.1| 6-phosphogluconate dehydrogenase [Bacillus sp. BT1B_CT2]
 gi|317389527|gb|EFV70338.1| 6-phosphogluconate dehydrogenase [Bacillus sp. BT1B_CT2]
          Length = 467

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 206/464 (44%), Positives = 284/464 (61%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+  KG ++AVYN   +LTD  ++K  G  Q V     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMASKGEQVAVYNYTRDLTDQLVQKTGG--QTVKPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +ID L PLL   D+++DGGNSH+ DT+ R   L  KGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIDSLVPLLEEGDVIMDGGNSHYEDTERRYDSLKAKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA  G S+M GG+   Y +   IL  I+A+    PCC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEIGALKGPSIMPGGDRDVYEKAAPILTKIAAQVDGDPCCVYIGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR+ L     EI+ +F  W+ G+L+SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLREKLLLPIDEIADIFDTWNQGELNSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        +I   ++FAR LS  +DE    +   
Sbjct: 243 KTGAPLIDVILDKTGQKGTGKWTSLQAVDNGIPSSIITESLFARYLSSLKDERTAAEKVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P++       + ++  +  ALY   I ++ QGF     +S+   W+L L  IA I+R 
Sbjct: 303 AGPATEERRLDQNVWIDRVRQALYMGKICAYAQGFAQYKMTSDLNGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+Q LN I ++  + P  +NLL  P  +EK+K+    LR++V     +G   P LS
Sbjct: 363 GCIIRAQFLNLISEAFDKQPDLSNLLVAPDFAEKLKEYQSGLRKVVCEGISSGISFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            ALSY+D +   R  ANL+QAQRD+FG+H ++R D     H  W
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMEGVFHTDW 466


>gi|160882558|ref|ZP_02063561.1| hypothetical protein BACOVA_00509 [Bacteroides ovatus ATCC 8483]
 gi|156112002|gb|EDO13747.1| hypothetical protein BACOVA_00509 [Bacteroides ovatus ATCC 8483]
          Length = 508

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 302/472 (63%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + + F+      K I G + 
Sbjct: 23  KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVERFLNGRAKGKNIEGFT- 81

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 82  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 135

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R +QL+E KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +P
Sbjct: 136 -RRVQLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTP 194

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL 
Sbjct: 195 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLR 254

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 255 SYLIEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 313

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D        F      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 314 SLSSQKDLRHLASKQFQCQHTQPIYNKAELVKNIFSALYASKLVSYAQGFAVLQRASDAF 373

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 374 GWHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKSL 433

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 434 VAESMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 485


>gi|281491088|ref|YP_003353068.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactococcus
           lactis subsp. lactis KF147]
 gi|281374846|gb|ABX75588.2| 6-phosphogluconate dehydrogenase, decarboxylating [Lactococcus
           lactis subsp. lactis KF147]
          Length = 471

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/473 (40%), Positives = 288/473 (60%), Gaps = 6/473 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + +++TK LE
Sbjct: 1   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKEHQ--DKNLVLTKTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDKGDILIDGGNTHFPDTMRRNAELADS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 119 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDLLKRVLGLSNAEIQAIFEEWNEGELDSYLIEITKE 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 239 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+ +F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 299 VKASKVLSGPAVNFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 358 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W K
Sbjct: 418 IPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDWYK 470


>gi|332882450|ref|ZP_08450075.1| phosphogluconate dehydrogenase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332679620|gb|EGJ52592.1| phosphogluconate dehydrogenase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 478

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/467 (39%), Positives = 300/467 (64%), Gaps = 12/467 (2%)

Query: 1   MKQ-ADIGIIGLGSMGSNLSLNILDKGFRLAVYNK-----DFELTDVFIKKISGLSQKVI 54
           M+Q +D+G+IGLG MG NL+LN+   G R++V+N+     +  + + F++  +   ++++
Sbjct: 1   MEQLSDVGLIGLGVMGENLALNMERNGRRVSVWNRTVPGVEEGVAERFVEGRAA-GKQIL 59

Query: 55  VTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRS 114
              +L + V ++ +PR I+MMV  GD VD+LID++ P L+  D+L+DGGNS + DT  R 
Sbjct: 60  GFSDLSEFVASLNRPRIIMMMVRAGDAVDELIDQVSPFLAEGDVLIDGGNSDYMDTGRRV 119

Query: 115 LQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCAL 173
                +G+ F+G GVSGG +GA  GAS+M GG ++A+  +  +L  ++AK  + +PCC  
Sbjct: 120 AACRARGLLFVGAGVSGGAEGALRGASIMPGGAKEAWPLIRPLLQDMAAKAADGTPCCDW 179

Query: 174 LGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLI 233
           +GPDG+GHFVKM+HNGIEY +MQLIA+ Y +L+ +   +   +S LF +W+ G+L SYL+
Sbjct: 180 MGPDGAGHFVKMVHNGIEYGDMQLIAETYFLLKRAGGMDNERMSRLFGRWNEGRLKSYLV 239

Query: 234 KITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSL 293
           +IT++IL+  +   G  ++D I D A QKGTG  S+    +L  S  +   A+F RN+S 
Sbjct: 240 EITSDILAYKEADGGY-LVDRILDVAGQKGTGQWSVKNALELGESFGLIAEAVFQRNIST 298

Query: 294 YRDESKKMQSFFNPSSHFPLKCFDSFVKD-LENALYASTILSFTQGFWVIGKSSEKYSWS 352
            ++   +    +  +S    + + SF  D +E  L+AS ++++ QGF ++ ++SE++ W+
Sbjct: 299 QKELRVEAARVY--ASRLEKEPYASFSADEVEQTLFASKLVAYAQGFDLLSRASEQFGWN 356

Query: 353 LSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVT 412
           L LA IAR+WR GCIIRS  L+++ ++        NL+  P+ S +V++ +P+ RR+V T
Sbjct: 357 LDLAMIARMWRGGCIIRSAFLDELARAYEAGGGRGNLMLFPAFSTQVREALPAWRRVVAT 416

Query: 413 CTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
               G  VP+ ++AL+YF +   D   ANLIQAQRD+FG+H F+R D
Sbjct: 417 AVCEGVAVPAFASALNYFHSLTTDFLPANLIQAQRDYFGAHTFERTD 463


>gi|307822909|ref|ZP_07653139.1| 6-phosphogluconate dehydrogenase, decarboxylating [Methylobacter
           tundripaludum SV96]
 gi|307735684|gb|EFO06531.1| 6-phosphogluconate dehydrogenase, decarboxylating [Methylobacter
           tundripaludum SV96]
          Length = 481

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/464 (42%), Positives = 293/464 (63%), Gaps = 5/464 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A+IG+IGL  MG NL+LN+ D GF++AVYN+     D F+   +  +Q +I T +LE++
Sbjct: 2   KANIGLIGLAVMGQNLALNMNDHGFKVAVYNRTTSTVDEFLTGPAKNTQ-IIGTHSLEEL 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           ++ +  PR +++MV  G+ VDQ IDKL PLLS +DI++DGGNS F DT  R L L ++ I
Sbjct: 61  IDNLESPRIVMLMVKAGEVVDQYIDKLTPLLSADDIIVDGGNSLFTDTARRMLSLQQQNI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            +IG GVSGG +GAR G S+M GGN+ A+  V+ I  SISA+    PCC  +G +G+GH+
Sbjct: 121 LYIGAGVSGGEQGARHGPSIMPGGNKAAWPIVKTIFQSISAQVNGEPCCEWVGDNGAGHY 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + Y ++ D L     E+  +F+ W+ G L+SYLI+ITA IL+ 
Sbjct: 181 VKMVHNGIEYGDMQLIGEAYQLMSDGLGLGANEMHSIFAAWNQGPLNSYLIEITAAILAY 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D   G  ++  I D A QKGTG  + I    L   +T+   ++FAR LS  ++E  K  
Sbjct: 241 KDE-DGQLLLKKILDTAGQKGTGKWAGINALDLGIPLTLIGESVFARCLSAQKEERVKAA 299

Query: 303 SFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIW 362
           S     +   +    + +  + +ALYA+ I+S+ QGF ++ ++S++Y  SL+   IA +W
Sbjct: 300 SVLPKRALRFIGDKKAMINAIGDALYAAKIISYAQGFRLMREASKEYGLSLNYGDIALMW 359

Query: 363 RAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPS 422
           R GCIIRS  LNDI ++   +P   NLL     ++ +K+     R+ V+   E   P P+
Sbjct: 360 RGGCIIRSLFLNDIKQAYDANPDLENLLFADFFAKTMKQADEGWRKAVILGIELSIPTPA 419

Query: 423 LSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHG 466
           LS+AL+Y+D +  ++  ANL+QAQRD+FG+H ++R D   +P G
Sbjct: 420 LSSALAYYDGYRSEKLPANLLQAQRDYFGAHTYERTD---QPRG 460


>gi|295114599|emb|CBL33236.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           sp. 7L76]
          Length = 473

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 286/471 (60%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G++G+  MG NL+LNI  +G+ +A+YN+    T   +++     +    T ++E
Sbjct: 1   MTKQQFGVVGMAVMGKNLALNIESRGYTVALYNRTGSKTTEVVEEHP--DKNFQATYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPR+I++MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVNAIEKPRRIMLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWNEGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   T  PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTDQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     +  + F     +   ++ +  ALY S ++S+ QGF  +  +SE+Y W L    
Sbjct: 299 VKASGILSKPAAFNFAGDEKELIEKIREALYFSKLMSYAQGFAQLRAASEEYGWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  ++P+  NLL      E  KK   ++R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVAIAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++Y+D++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYYDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 469


>gi|52082571|ref|YP_081362.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52787966|ref|YP_093795.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52005782|gb|AAU25724.1| 6-phosphogluconate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52350468|gb|AAU43102.1| GntZ [Bacillus licheniformis ATCC 14580]
          Length = 467

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 206/464 (44%), Positives = 284/464 (61%), Gaps = 3/464 (0%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+IGLG MGSN++LN+  KG ++AVYN   +LTD  ++K  G  Q V     LE  V++
Sbjct: 5   IGVIGLGVMGSNIALNMASKGEQVAVYNYTRDLTDQLVQKTGG--QTVKPYYELEDFVQS 62

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRKI +MVT G PVD +ID L PLL   D+++DGGNSH+ DT+ R   L  KGI ++
Sbjct: 63  LEKPRKIFLMVTAGKPVDSVIDSLVPLLEEGDVIMDGGNSHYEDTERRYDSLKVKGIGYL 122

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           GIG+SGG  GA  G S+M GG+   Y +   IL  I+A+    PCC  +GP G+GHFVKM
Sbjct: 123 GIGISGGEIGALKGPSIMPGGDRDVYEKAAPILTKIAAQVDGDPCCVYIGPKGAGHFVKM 182

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEYA+MQLIA+ Y  LR+ L     EI+ +F  W+ G+L+SYLI+ITAEIL   D 
Sbjct: 183 VHNGIEYADMQLIAEAYTFLREKLLLPIDEIADIFDTWNQGELNSYLIEITAEILRKKDE 242

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P+IDVI DK  QKGTG  + ++        +I   ++FAR LS  +DE    +   
Sbjct: 243 KTGAPLIDVILDKTGQKGTGKWTSLQAVDNGIPSSIITESLFARYLSSLKDERTAAEKVL 302

Query: 306 -NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
             P++       + ++  +  ALY   I ++ QGF     +S+   W+L L  IA I+R 
Sbjct: 303 AGPATEERRLDQNVWIDRVRQALYMGKICAYAQGFAQYKMTSDLNGWNLPLKDIALIFRG 362

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+Q LN I ++  + P  +NLL  P  +EK+K+    LR++V     +G   P LS
Sbjct: 363 GCIIRAQFLNLISEAFDKQPDLSNLLVAPDFAEKLKEYQSGLRKVVCEGISSGISFPCLS 422

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            ALSY+D +   R  ANL+QAQRD+FG+H ++R D     H  W
Sbjct: 423 TALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMEGVFHTDW 466


>gi|225575320|ref|ZP_03783930.1| hypothetical protein RUMHYD_03410 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037457|gb|EEG47703.1| hypothetical protein RUMHYD_03410 [Blautia hydrogenotrophica DSM
           10507]
          Length = 483

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/461 (40%), Positives = 294/461 (63%), Gaps = 5/461 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M+++ IG+IGL  MG NL +N+  KGFR++VYN+  E    F++      +++    +LE
Sbjct: 1   MEKSKIGVIGLAVMGENLVMNMESKGFRVSVYNRTTEKVTRFLQG-RARGKQIQGAYSLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           ++V  + KPRKI +MV  G PVD L+++L PLL   DIL+DGGNSHF DTQ R+  +  +
Sbjct: 60  ELVGQLEKPRKIFLMVKAGQPVDVLVEQLLPLLEEGDILIDGGNSHFPDTQRRTEYVESQ 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGS 179
           G Y++G GVSGG  GA  G SLM GG+++A+ +++ IL +I+AK ++  PCC  +G  G+
Sbjct: 120 GKYYVGCGVSGGESGALRGPSLMPGGSKEAWPKIQPILQAIAAKTEDGIPCCQWVGNGGA 179

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +M+LI + Y +++  L  +  E+  +F++W+  +L+SYLI+IT +I
Sbjct: 180 GHFVKMVHNGIEYGDMELICEAYHLMKTLLGLSCQEMHEIFARWNESRLNSYLIEITGDI 239

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
           L+  D   G P+++ I D A QKGTG  ++       S++T+   A+F+R LS  ++E  
Sbjct: 240 LAYRDE-DGEPLVEHILDTAGQKGTGKWTVEAALNQGSALTLIGEAVFSRCLSAMKEERV 298

Query: 300 KMQSFFNPSSHFPLKCF-DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K      P  H   +   + F+  +E+ALYAS I+S+ QG+ ++  +S  Y W L+   I
Sbjct: 299 KASRLL-PGVHRKFEGNKEEFLNWIEDALYASKIVSYAQGYALMRNASVSYGWKLAYGDI 357

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCIIRS  L +I  +  ++P+  NLL     ++ ++K     R++     E G 
Sbjct: 358 ALMWRGGCIIRSAFLGEIKNAYDKNPALENLLLDSYFTDAMEKAQQGWRKVCAAALEYGV 417

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           PVP++++ALSY+D    +R  ANL+QAQRD+FG+H ++R D
Sbjct: 418 PVPAMTSALSYYDGCRCERLPANLLQAQRDYFGAHTYERLD 458


>gi|326775087|ref|ZP_08234352.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces cf.
           griseus XylebKG-1]
 gi|326655420|gb|EGE40266.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces cf.
           griseus XylebKG-1]
          Length = 479

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 280/473 (59%), Gaps = 3/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   ++   G     + T + E  V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVALHNRTAARTRELVEHF-GDEGDFVATGSAEDFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +I +  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVIMVKAGEATDAVIGEFAPLLENGDVIIDGGNAHFADTRRRERELRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA  G S+M GG+E++Y  +  +L  ISAK ++ +PC   +GPDG+GHF
Sbjct: 124 FVGTGISGGEEGALDGPSIMPGGSEESYASLGPMLEKISAKAKDGAPCVTHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM HNGIEYA+MQLI + Y +LRD    +P  I+ +F  W+TG+L SYLI+ITAE+LS 
Sbjct: 184 VKMTHNGIEYADMQLIGEAYQLLRDVAGYSPARIADIFRTWNTGRLESYLIEITAEVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR++S + D     +
Sbjct: 244 VDGATGKPFVDVVLDRAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSVSGHADLRDASR 303

Query: 303 SFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               P++         +F   +E ALYAS I+++TQGF  I   SE+Y W++ L  +A I
Sbjct: 304 HLAGPAARTLGEDEAAAFADRVEQALYASKIVAYTQGFHEIAAGSEQYGWNIDLGAVASI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+  L+ I  +    P    LL     +E++       R +V T    G P P
Sbjct: 364 WRGGCIIRAAFLDRITGAYEARPRMVGLLADRGFAEEIAAAQDDWRTVVATAVTQGVPTP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           + +AAL+Y+D+   +R  A L Q QRD+FG+H + R D+    H  W    TE
Sbjct: 424 AFAAALAYYDSLRAERLPAALTQGQRDYFGAHTYRRTDRDGTFHTLWGGDRTE 476


>gi|192361140|ref|YP_001983553.1| 6-phosphogluconate dehydrogenase [Cellvibrio japonicus Ueda107]
 gi|190687305|gb|ACE84983.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cellvibrio
           japonicus Ueda107]
          Length = 484

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 295/461 (63%), Gaps = 9/461 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIV--TKNLEQ 61
           +DIG++GL  MG NL LN+  KG+ +  YN+  +  D F+   SG +Q   +   +++E+
Sbjct: 5   SDIGLVGLAVMGENLILNMASKGYTVTAYNRSVDKVDNFL---SGRAQGKTIRGARSIEE 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
           +V ++ KPRKI++MV  G  VD  I++L P L P DI++DGGN+HF DT  R+  L+ KG
Sbjct: 62  LVASLAKPRKIMLMVKAGKAVDDFIEQLIPHLEPGDIIIDGGNTHFPDTDRRTAYLASKG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSG 180
           + FIG GVSGG +GA +G S+M GG+ +A+  V++I  SISAK  + SPCC  +G +G+G
Sbjct: 122 LRFIGTGVSGGEEGALTGPSIMPGGSPEAWPYVKDIFQSISAKVDDGSPCCDWVGENGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKM+HNGIEY +MQLI + Y I+++ L  +  E+  +F++W+ G+L SYLI+IT +IL
Sbjct: 182 HFVKMVHNGIEYGDMQLICEAYQIMKEVLGLSADEMHQVFAEWNKGELDSYLIEITRDIL 241

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D   G P+++ I D A QKGTG  + +    L   +T+   A+FAR LS  + E  +
Sbjct: 242 AYKDD-DGEPLVEKILDTAGQKGTGKWTGVIALDLGVPLTLISEAVFARCLSSQKAERVE 300

Query: 301 MQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                  P+ +F      +F+ DL NA++AS I+S+ QG+ ++ +++++Y W+L+   IA
Sbjct: 301 AAKVIKGPAVNFTGDK-QAFINDLRNAVFASKIISYAQGYLLMREAAKEYGWNLNYGGIA 359

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L +I ++  ++P   NLL     ++ V       RR+      NG P
Sbjct: 360 LMWRGGCIIRSSFLGNIKEAFDKNPELKNLLLDDYFTKTVDAAQAGWRRVAAAAIVNGIP 419

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            P++++AL+YFD +   R  ANL+QAQRD+FG+H ++R D+
Sbjct: 420 APTITSALTYFDGYRTARLPANLLQAQRDYFGAHTYERIDR 460


>gi|298480906|ref|ZP_06999101.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           D22]
 gi|298272929|gb|EFI14495.1| 6-phosphogluconate dehydrogenase, decarboxylating [Bacteroides sp.
           D22]
          Length = 491

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 207/471 (43%), Positives = 297/471 (63%), Gaps = 20/471 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPC 170
            R      KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +PC
Sbjct: 119 RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTPC 178

Query: 171 CALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSS 230
           C  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL S
Sbjct: 179 CQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLRS 238

Query: 231 YLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARN 290
           YLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+
Sbjct: 239 YLIEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERS 297

Query: 291 LSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYS 350
           LS  +D        +      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ + 
Sbjct: 298 LSAQKDLRHLASRQYQCQHTQPIYNKVELVKNIFSALYASKLVSYAQGFAVLQRASDAFD 357

Query: 351 WSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIV 410
           W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +V
Sbjct: 358 WHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKNLV 417

Query: 411 VTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
               +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 418 AEAMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|227517973|ref|ZP_03948022.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis TX0104]
 gi|227074591|gb|EEI12554.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis TX0104]
          Length = 473

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 285/471 (60%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G++G+  MG NL+LNI  +G+ +A+YN+    T   +++     +    T ++E
Sbjct: 1   MTKQQFGVVGMAVMGKNLALNIESRGYTVALYNRTGSKTTEVVEEHP--DKNFQATYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPR+I++MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVNAIEKPRRIMLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWNEGELDSYLIEITADI 238

Query: 240 LS-SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+   D  T  PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTDQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     +  + F         ++ +  ALY S ++S+ QGF  +  +SE+Y W L    
Sbjct: 299 VKASGILSKPAAFDFAGDKKELIEKIREALYFSKLMSYAQGFAQLRAASEEYGWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  ++P+  NLL      E  KK   ++R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVAIAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++Y+D++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYYDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 469


>gi|300858428|ref|YP_003783411.1| 6-phosphogluconate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685882|gb|ADK28804.1| 6-phosphogluconate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302330696|gb|ADL20890.1| 6-phosphogluconate dehydrogenase [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276379|gb|ADO26278.1| 6-phosphogluconate dehydrogenase [Corynebacterium
           pseudotuberculosis I19]
          Length = 501

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/475 (40%), Positives = 284/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N   KG  +AVYN+    T   +++  G     I ++ +E+ V
Sbjct: 24  AQIGVVGLAVMGSNLARNFAHKGHTVAVYNRSAAKTHTLMQE-HGSEGNFIPSETIEEFV 82

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G   D +I++L   + P DI++DGGNS + DT  R  +++ +G+ 
Sbjct: 83  ASLEKPRRAIIMVQAGAATDAVINQLADAMEPGDIIIDGGNSLYTDTIRREKEIAARGLN 142

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++++ +  +L SISA    +PC   +GPDG+GHFV
Sbjct: 143 FVGAGISGGEEGALNGPSIMPGGPAESWDALGPLLESISAVVDGTPCVTHIGPDGAGHFV 202

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F  W+ G L SYLI+ITAE+LS  
Sbjct: 203 KMVHNGIEYADMQVIGEAYQLLRYAAGMEPAEIAEIFKTWNKGDLDSYLIEITAEVLSQV 262

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P+IDVI D A QKGTG  ++     L   +T    A+FAR LS    +      
Sbjct: 263 DAETGQPLIDVIVDAAGQKGTGRWTVKAALDLGIPVTGIGEAVFARALSGAAKQRAATIG 322

Query: 304 FFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +   L   D    +FV+D+  ALYAS ++++ QGF  I   SE++ WS+    +A
Sbjct: 323 SLPSGTLLTLDKLDTDKETFVEDVRRALYASKLVAYAQGFDEIQAGSEEHDWSVDPRDLA 382

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN I ++   D S  +LL  P    ++   + S RR+VV  T+ G P
Sbjct: 383 TIWRGGCIIRAKFLNRIREAYDADSSLPSLLLDPYFKAELGGLVDSWRRVVVAATQLGLP 442

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 443 VPVFTSSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRVDKEGTFHTQWSGDRSE 497


>gi|218440235|ref|YP_002378564.1| 6-phosphogluconate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218172963|gb|ACK71696.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cyanothece sp.
           PCC 7424]
          Length = 475

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 292/471 (61%), Gaps = 5/471 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
            G+IGL  MG NL+LN+  +GF +AVYN+ +E T+ F+    G  + ++  + LE+ V+A
Sbjct: 5   FGVIGLAVMGENLALNVESRGFPIAVYNRTYEKTEEFMN-TRGKGKDIVGPRTLEEFVQA 63

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + +PRKIL+MV  G PVD +I +LKPLL   D+++DGGNS + DT+ R+ +L   G+ F+
Sbjct: 64  LDRPRKILVMVKAGGPVDAVIQQLKPLLDEGDMIIDGGNSLYDDTERRTKELESTGLGFV 123

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+GVSGG +GA +G SLM GG E AY  +E IL  I+A+  + PC   +GP G+GH+VKM
Sbjct: 124 GMGVSGGEEGALNGPSLMPGGTESAYRELEPILTKIAAQVDDGPCVTFIGPGGAGHYVKM 183

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEILSSSD 244
           +HNGIEY +MQLIA+ Y IL+  L  +  ++  +F++W+ T +L+S+LI+ITA+I    D
Sbjct: 184 VHNGIEYGDMQLIAEAYDILKFGLGLSNEQLHQIFAEWNTTDELNSFLIEITADIFKYKD 243

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
             T   ++D+I D A QKGTG  +++   +L   +     A+ AR +S Y+ E       
Sbjct: 244 PSTNEYLVDLILDSAGQKGTGRWTVLSSLELGVPIPTIYAAVNARVMSAYKAERVAASKE 303

Query: 305 FNPSS-HFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWR 363
            N  + H+      SFV  + +ALY S + S+ QG  +I K+S +++++++L   ARIW+
Sbjct: 304 LNGRAIHYDGDDAASFVNKVRDALYCSKMCSYAQGMALIAKASAEFNYNINLPETARIWK 363

Query: 364 AGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSL 423
            GCIIR+  L+ I  +  E+P   NLL  P   + +     + R +++   + G  VP+ 
Sbjct: 364 GGCIIRAGFLDKIKNAYLENPQLPNLLLAPEFKQSILDRQEAWRDVLILANKIGIAVPAF 423

Query: 424 SAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP--HGPWQKVS 472
           SA+L YFD++   R   NL QAQRD+FG+H ++R DK +    H  W  V+
Sbjct: 424 SASLDYFDSYRRSRLPQNLTQAQRDYFGAHTYERIDKPTGEFFHTEWAGVA 474


>gi|307275531|ref|ZP_07556673.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX2134]
 gi|306507919|gb|EFM77047.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX2134]
          Length = 473

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 285/471 (60%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G++G+  MG NL+LNI  +G+ +A+YN+    T   +++     +    T ++E
Sbjct: 1   MTKQQFGVVGMAVMGKNLALNIESRGYTVALYNRTGSKTTEVVEEHP--DKNFQATYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPR+I++MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVNAIEKPRRIMLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWNEGELDSYLIEITADI 238

Query: 240 LS-SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+   D  T  PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTDQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     +  + F         ++ +  ALY S ++S+ QGF  +  +SE+Y W L    
Sbjct: 299 VKASGILSKPAAFNFAGDKKELIEKIREALYFSKLMSYAQGFAQLRTASEEYGWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  ++P+  NLL      E  KK   ++R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVAIAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++Y+D++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYYDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 469


>gi|15672604|ref|NP_266778.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|18202802|sp|Q9CHU6|6PGD_LACLA RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|12723522|gb|AAK04720.1|AE006295_1 decarboxylating 6-phosphogluconate dehydrogenase [Lactococcus
           lactis subsp. lactis Il1403]
 gi|326406122|gb|ADZ63193.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp. lactis
           CV56]
          Length = 472

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 287/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + +++TK LE
Sbjct: 1   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKEHQ--DKNLVLTKTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDKGDILIDGGNTHFPDTMRRNAELADS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 119 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDLLKRVLGLSNAEIQAIFEEWNEGELDSYLIEITKE 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 239 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+ +F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 299 VKASKVLSGPAVNFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 358 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 418 IPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 468


>gi|259502275|ref|ZP_05745177.1| 6-phosphogluconate dehydrogenase [Lactobacillus antri DSM 16041]
 gi|259169740|gb|EEW54235.1| 6-phosphogluconate dehydrogenase [Lactobacillus antri DSM 16041]
          Length = 488

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/473 (39%), Positives = 293/473 (61%), Gaps = 10/473 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG++GL  MG NL+LNI  +GF + VYN+    TD  ++  S   +K++ +  ++  
Sbjct: 15  KAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDEMMRDHS--DKKLVPSYTIKDF 72

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR+IL+MV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + GI
Sbjct: 73  VDSLEKPRRILLMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFHDTMARNAKLDKSGI 132

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGSG 180
            FIG+GVSGG  GA  G +LM GG ++AY+ V  IL  I+AK +    PC A +GP+G+G
Sbjct: 133 NFIGMGVSGGELGALHGPALMPGGQKEAYDLVAPILTKIAAKAEEDGKPCVAYIGPNGAG 192

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+IL
Sbjct: 193 HYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADIL 252

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +DE
Sbjct: 253 TRKDDLGDDKNKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKDE 312

Query: 298 SKKMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                    P     +   D    ++ +  ALY   ++S+ QGF  +   SE+Y W+L +
Sbjct: 313 RVAASKVL-PEVTDSISIDDKKEMIEKVRQALYFGKVMSYAQGFEQMRIDSERYDWNLKM 371

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             +A+IWRAGCIIR+Q L +I  +  ++P   NLL      +  KK   ++R +V    +
Sbjct: 372 GELAQIWRAGCIIRAQFLQNITDAFDKNPDLKNLLLDDYFKDIAKKYQQAIRDVVALAVK 431

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVPS+SAA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 432 AGIPVPSMSAAISYYDSYRAEVLPANLLQAQRDYFGAHTYERVDRPGNYHYSW 484


>gi|302206139|gb|ADL10481.1| 6-phosphogluconate dehydrogenase [Corynebacterium
           pseudotuberculosis C231]
          Length = 498

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/475 (40%), Positives = 284/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N   KG  +AVYN+    T   +++  G     I ++ +E+ V
Sbjct: 21  AQIGVVGLAVMGSNLARNFAHKGHTVAVYNRSAAKTHTLMQE-HGSEGNFIPSETIEEFV 79

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G   D +I++L   + P DI++DGGNS + DT  R  +++ +G+ 
Sbjct: 80  ASLEKPRRAIIMVQAGAATDAVINQLADAMEPGDIIIDGGNSLYTDTIRREKEIAARGLN 139

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  ++++ +  +L SISA    +PC   +GPDG+GHFV
Sbjct: 140 FVGAGISGGEEGALNGPSIMPGGPAESWDALGPLLESISAVVDGTPCVTHIGPDGAGHFV 199

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F  W+ G L SYLI+ITAE+LS  
Sbjct: 200 KMVHNGIEYADMQVIGEAYQLLRYAAGMEPAEIAEIFKTWNKGDLDSYLIEITAEVLSQV 259

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P+IDVI D A QKGTG  ++     L   +T    A+FAR LS    +      
Sbjct: 260 DAETGQPLIDVIVDAAGQKGTGRWTVKAALDLGIPVTGIGEAVFARALSGAAKQRAATIG 319

Query: 304 FFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +   L   D    +FV+D+  ALYAS ++++ QGF  I   SE++ WS+    +A
Sbjct: 320 SLPSGTLLTLDKLDTDKETFVEDVRRALYASKLVAYAQGFDEIQAGSEEHDWSVDPRDLA 379

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN I ++   D S  +LL  P    ++   + S RR+VV  T+ G P
Sbjct: 380 TIWRGGCIIRAKFLNRIREAYDADSSLPSLLLDPYFKAELGGLVDSWRRVVVAATQLGLP 439

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 440 VPVFTSSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRVDKEGTFHTQWSGDRSE 494


>gi|29375628|ref|NP_814782.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis V583]
 gi|229546897|ref|ZP_04435622.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis TX1322]
 gi|229548989|ref|ZP_04437714.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis ATCC 29200]
 gi|255971501|ref|ZP_05422087.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T1]
 gi|255974116|ref|ZP_05424702.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T2]
 gi|256617971|ref|ZP_05474817.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis ATCC 4200]
 gi|256761807|ref|ZP_05502387.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T3]
 gi|256852703|ref|ZP_05558074.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T8]
 gi|256957139|ref|ZP_05561310.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis DS5]
 gi|256960232|ref|ZP_05564403.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis Merz96]
 gi|256962525|ref|ZP_05566696.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis HIP11704]
 gi|257077935|ref|ZP_05572296.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis JH1]
 gi|257081301|ref|ZP_05575662.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis E1Sol]
 gi|257083958|ref|ZP_05578319.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis Fly1]
 gi|257086406|ref|ZP_05580767.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis D6]
 gi|257089456|ref|ZP_05583817.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis CH188]
 gi|257415666|ref|ZP_05592660.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis AR01/DG]
 gi|257418637|ref|ZP_05595631.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T11]
 gi|257421296|ref|ZP_05598286.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis X98]
 gi|293382594|ref|ZP_06628527.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis R712]
 gi|293387822|ref|ZP_06632364.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis S613]
 gi|294779302|ref|ZP_06744706.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis PC1.1]
 gi|300860038|ref|ZP_07106126.1| phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis TUSoD Ef11]
 gi|307269674|ref|ZP_07551007.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX4248]
 gi|307272068|ref|ZP_07553333.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0855]
 gi|307278906|ref|ZP_07559966.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0860]
 gi|307286907|ref|ZP_07566987.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0109]
 gi|307289988|ref|ZP_07569913.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0411]
 gi|312900989|ref|ZP_07760282.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0470]
 gi|312904611|ref|ZP_07763769.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0635]
 gi|312906800|ref|ZP_07765797.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis DAPTO 512]
 gi|312952679|ref|ZP_07771541.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0102]
 gi|312978945|ref|ZP_07790671.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis DAPTO 516]
 gi|29343089|gb|AAO80852.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis V583]
 gi|229306010|gb|EEN72006.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis ATCC 29200]
 gi|229308062|gb|EEN74049.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis TX1322]
 gi|255962519|gb|EET94995.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T1]
 gi|255966988|gb|EET97610.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T2]
 gi|256597498|gb|EEU16674.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis ATCC 4200]
 gi|256683058|gb|EEU22753.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T3]
 gi|256712048|gb|EEU27085.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T8]
 gi|256947635|gb|EEU64267.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis DS5]
 gi|256950728|gb|EEU67360.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis Merz96]
 gi|256953021|gb|EEU69653.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis HIP11704]
 gi|256985965|gb|EEU73267.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis JH1]
 gi|256989331|gb|EEU76633.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis E1Sol]
 gi|256991988|gb|EEU79290.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis Fly1]
 gi|256994436|gb|EEU81738.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis D6]
 gi|256998268|gb|EEU84788.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis CH188]
 gi|257157494|gb|EEU87454.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis ARO1/DG]
 gi|257160465|gb|EEU90425.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis T11]
 gi|257163120|gb|EEU93080.1| 6-phosphogluconate dehydrogenase [Enterococcus faecalis X98]
 gi|291080037|gb|EFE17401.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis R712]
 gi|291082797|gb|EFE19760.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis S613]
 gi|294453669|gb|EFG22067.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis PC1.1]
 gi|300850856|gb|EFK78605.1| phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis TUSoD Ef11]
 gi|306498946|gb|EFM68439.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0411]
 gi|306502032|gb|EFM71319.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0109]
 gi|306504388|gb|EFM73598.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0860]
 gi|306511288|gb|EFM80293.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0855]
 gi|306514002|gb|EFM82593.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX4248]
 gi|310627054|gb|EFQ10337.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis DAPTO 512]
 gi|310629195|gb|EFQ12478.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0102]
 gi|310632124|gb|EFQ15407.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0635]
 gi|311288382|gb|EFQ66938.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis DAPTO 516]
 gi|311291890|gb|EFQ70446.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0470]
 gi|315027026|gb|EFT38958.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX2137]
 gi|315029739|gb|EFT41671.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX4000]
 gi|315034175|gb|EFT46107.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0027]
 gi|315144685|gb|EFT88701.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX2141]
 gi|315147998|gb|EFT92014.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX4244]
 gi|315149570|gb|EFT93586.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0012]
 gi|315153124|gb|EFT97140.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0031]
 gi|315156897|gb|EFU00914.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0043]
 gi|315157684|gb|EFU01701.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0312]
 gi|315160658|gb|EFU04675.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0645]
 gi|315165087|gb|EFU09104.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX1302]
 gi|315168069|gb|EFU12086.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX1341]
 gi|315171986|gb|EFU16003.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX1342]
 gi|315173322|gb|EFU17339.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX1346]
 gi|315574290|gb|EFU86481.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0309B]
 gi|315577418|gb|EFU89609.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0630]
 gi|315581637|gb|EFU93828.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecalis TX0309A]
 gi|323480291|gb|ADX79730.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis 62]
 gi|327534635|gb|AEA93469.1| phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecalis OG1RF]
          Length = 473

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 285/471 (60%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +   G++G+  MG NL+LNI  +G+ +A+YN+    T   +++     +    T ++E
Sbjct: 1   MTKQQFGVVGMAVMGKNLALNIESRGYTVALYNRTGSKTTEVVEEHP--DKNFQATYSIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V A+ KPR+I++MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVNAIEKPRRIMLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++  PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKISAKAEDGEPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +++  L  +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWNEGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   T  PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTDQPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARFISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     +  + F         ++ +  ALY S ++S+ QGF  +  +SE+Y W L    
Sbjct: 299 VKASGILSKPAAFNFAGDKKELIEKIREALYFSKLMSYAQGFAQLRAASEEYGWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  ++P+  NLL      E  KK   ++R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVAIAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++Y+D++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYYDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIYHYSW 469


>gi|28378252|ref|NP_785144.1| 6-phosphogluconate dehydrogenase [Lactobacillus plantarum WCFS1]
 gi|254556459|ref|YP_003062876.1| 6-phosphogluconate dehydrogenase [Lactobacillus plantarum JDM1]
 gi|28271087|emb|CAD63992.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           plantarum WCFS1]
 gi|254045386|gb|ACT62179.1| 6-phosphogluconate dehydrogenase [Lactobacillus plantarum JDM1]
          Length = 478

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/476 (40%), Positives = 295/476 (61%), Gaps = 14/476 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++  IG+IG+  MG NL+LNI  +G+++A++N+    T+  +K  +   ++++ +  +E 
Sbjct: 4   EKPQIGVIGMAVMGKNLALNIESRGYKVAIFNRTGAKTEKVVKDHA--DKQLVPSYKIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+I+MMV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVASLETPRRIIMMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFNDTMARNARLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  ISAK     +PC   +GP+G+
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKISAKAPQDGAPCVTYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+    +  E+S +F+ W+ G+LSSYLI+ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNIMRNVAGLSVDEMSDIFTDWNKGELSSYLIEITADI 241

Query: 240 LSSSDTITG---MPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           LS  D +      PI+D+I D+ + KGTG  S  +   +    ++   A++AR +S+ ++
Sbjct: 242 LSRKDDLGADKTKPIVDMILDRGNNKGTGKWSSEDALNVQVPQSVITEAVYARYISMMKN 301

Query: 297 E----SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWS 352
           E    SKK+     P++   L   +  V+ +  ALY S I+S+ QGF  +  +SE Y W 
Sbjct: 302 ERVAASKKLAG---PTADVDLPAKEELVEKIRQALYFSKIMSYAQGFEQLRFASEHYGWD 358

Query: 353 LSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVT 412
           L    +A+IWRAGCIIR+Q L +I  +  + P   NLL     ++   K   S R ++  
Sbjct: 359 LKFGELAQIWRAGCIIRAQFLQNITDAFDKKPDLNNLLMDDYFADIAAKYQQSTREVLSL 418

Query: 413 CTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             + G PVPS SAALSY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 419 AIQAGVPVPSFSAALSYYDSYRAEVLPANLLQAQRDYFGAHTYERTDREGLYHYSW 474


>gi|223935932|ref|ZP_03627847.1| 6-phosphogluconate dehydrogenase, decarboxylating [bacterium
           Ellin514]
 gi|223895533|gb|EEF61979.1| 6-phosphogluconate dehydrogenase, decarboxylating [bacterium
           Ellin514]
          Length = 484

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/463 (41%), Positives = 293/463 (63%), Gaps = 11/463 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           QADI +IGL  MG NL LN+ D G+ +  +N+     D F+ K      KVI   ++ +M
Sbjct: 4   QADIALIGLAVMGQNLILNMNDHGYTVVAFNRTVSKVDEFLNK-EAKGTKVIGAHSIPEM 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V  + +PR++++MV  G PVD+ I++L P L P DI++DGGNS F DT  R+  +  KG+
Sbjct: 63  VSLLKRPRRVMLMVKAGPPVDEFIEQLIPHLEPGDIIIDGGNSLFQDTIRRTKYVESKGL 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSGH 181
            +IG GVSGG +GAR+G S+M GG+  A+  V+ I  SI+AK  +  PCC  +G +G+GH
Sbjct: 123 LYIGTGVSGGEEGARNGPSIMPGGSPAAWPHVKEIFQSIAAKVDDGVPCCDWVGENGAGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           +VKM+HNGIEY +M+LI + Y +++D L     E+S +F++W+ G+L SYLI ITA+IL+
Sbjct: 183 YVKMVHNGIEYGDMELICEAYQLMKDGLGMTADEMSQVFAEWNKGELDSYLIDITAKILA 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE---- 297
             DT  G P++D I D A QKGTG  ++I    +   +T+   A+++R++S  ++E    
Sbjct: 243 FKDT-DGQPLVDNIQDTAGQKGTGKWTVISSMDMGIPITLIAEAVYSRSVSALKEERVAA 301

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           +KK++      S    K    F++D+  ALYAS I+S+TQG+ ++  ++++Y W+L+   
Sbjct: 302 AKKLKGPRPKISTDRAK----FIEDIRRALYASKIISYTQGYMLMRAAAKEYKWNLNYGG 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA +WR GCIIRS+ L  I ++   +P  TNLL        +K++  S R +V    + G
Sbjct: 358 IALMWRGGCIIRSRFLGKIKEAYDANPKLTNLLLDKFFKGAIKESQRSWRNVVAIAAKKG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            P P+ S AL+++D +   R  ANL+QAQRD+FG+H ++R DK
Sbjct: 418 IPTPAFSTALNFYDAYRSARLPANLLQAQRDYFGAHTYERIDK 460


>gi|120404068|ref|YP_953897.1| 6-phosphogluconate dehydrogenase [Mycobacterium vanbaalenii PYR-1]
 gi|119956886|gb|ABM13891.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Mycobacterium
           vanbaalenii PYR-1]
          Length = 489

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/460 (39%), Positives = 280/460 (60%), Gaps = 5/460 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G   K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLAE-HGTEGKFVRSETIAEFL 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ KPR++L+MV  GDP D +I++L   +   DI++DGGN+ + DT  R   + E+G++
Sbjct: 70  DALEKPRRVLIMVKAGDPTDAVINELADAMEEGDIIIDGGNALYTDTIRREKAIRERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG +++Y  +  +L  ISA     PCC  +GPDG+GHFV
Sbjct: 130 FVGAGISGGEEGALNGPSIMPGGPKESYESLGPLLEEISAHVDGVPCCTHIGPDGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY++MQLI + Y +LRD L K   EI+ +F +W++G L S+L++ITA++L  +
Sbjct: 190 KMVHNGIEYSDMQLIGEAYQLLRDGLGKTAPEIADVFDEWNSGDLDSFLVEITAQVLRQT 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D+A QKGTG  ++     L   +T    A+FAR LS    + +    
Sbjct: 250 DAKTGKPLVDLILDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVAQRRATTG 309

Query: 304 FFNP--SSHFPL--KCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             +       P   +    FV+D+  ALYAS I+++ QGF  I   S +Y+W ++   +A
Sbjct: 310 LASGRLGERVPADGEAAAQFVEDIRQALYASKIIAYAQGFNQIQAGSAEYNWGITPGDMA 369

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN I  +   DP    L+  P   + ++  + S RR+V+  TE G P
Sbjct: 370 TIWRGGCIIRAKFLNRIKDAFDNDPDLPTLIVDPYFRDAIEAAVDSWRRVVIKATELGIP 429

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           +P  S+ALSY+D    +R  A L Q  RDFFG+H + R D
Sbjct: 430 IPGFSSALSYYDGLRTERLPAALTQGLRDFFGAHTYGRID 469


>gi|296139313|ref|YP_003646556.1| 6-phosphogluconate dehydrogenase, decarboxylating [Tsukamurella
           paurometabola DSM 20162]
 gi|296027447|gb|ADG78217.1| 6-phosphogluconate dehydrogenase, decarboxylating [Tsukamurella
           paurometabola DSM 20162]
          Length = 480

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/473 (38%), Positives = 281/473 (59%), Gaps = 4/473 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           +A+IG++G+  MGSNL  N+  + G  +A+YN+  E T   +          + +++++ 
Sbjct: 7   KANIGVVGMAVMGSNLVRNLASREGNTVAIYNRSPEKTREVVANHP--EANFVASESIDD 64

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR  ++MV  G   D +I++L+    P DI++DGGN++F DT  R  +++  G
Sbjct: 65  FVASLATPRTAIIMVQAGAGTDAVIEQLQERFEPGDIIVDGGNANFHDTIAREARIAPTG 124

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I+F+G G+SGG +GA  G S+M GG  ++Y  +  IL SI+A  +   C   +G DG+GH
Sbjct: 125 IHFVGAGISGGEEGALKGPSIMPGGTPESYETLGPILASIAAVAEGEACVTHVGTDGAGH 184

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKMIHNGIEYA+M+LI + Y +LR+    +P  IS +F  W++G L+SYLI+IT EIL 
Sbjct: 185 FVKMIHNGIEYADMELIGEAYDLLRNVAGHSPQAISDIFKTWNSGPLNSYLIEITTEILK 244

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P +D++ D+A  KGTG+ ++     L   +     A+F R +S  R +   +
Sbjct: 245 HIDAETGKPFVDIVVDQAGSKGTGVWTVQTALDLGVPVGGVAEAVFGRAVSSKRTQRDAV 304

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           ++        P    DSFV D+  ALYAS I+++ QGF  I   +EKY W++    +A+I
Sbjct: 305 RALGIARPDAP-TVDDSFVDDVAKALYASKIVAYAQGFDAIIAGAEKYGWNIDKGAVAKI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+Q LN +  +  E+P+   LL  P  ++ ++    + RR+V+T T+ G PVP
Sbjct: 364 WRGGCIIRAQFLNVLADAYAENPNLATLLEAPYFAQAIRDGEAAWRRVVITATQAGVPVP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             + ALSYFD+   DR  A L+Q QRDFFG+H + R DK    H  W    +E
Sbjct: 424 GFATALSYFDSLNVDRLPAALVQGQRDFFGAHTYKRVDKAGTFHTLWSGDRSE 476


>gi|290955737|ref|YP_003486919.1| 6-phosphogluconate 1-dehydrogenase [Streptomyces scabiei 87.22]
 gi|260645263|emb|CBG68349.1| 6-phosphogluconate 1-dehydrogenase [Streptomyces scabiei 87.22]
          Length = 479

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 289/474 (60%), Gaps = 5/474 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSNL+ N    G+ +AV+N+    T   I++  G     I  +  +  V
Sbjct: 5   AQIGVTGLAVMGSNLARNFARNGYTVAVHNRSAAKTHALIEE-HGHEGDFIAAETAKDFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
           +A+ +PR++++MV  G P D +I++  PLL P D+++DGGN+HF DT+ R   L E+GI+
Sbjct: 64  QALERPRRLVVMVKAGGPTDAVIEEFAPLLEPGDMIIDGGNAHFADTRRREAALREQGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA +G S+M GG  ++Y+ +  +L  ISAK  + +PC   +GPDG+GHF
Sbjct: 124 FVGAGISGGEEGALNGPSIMPGGPVESYDSLGPMLEKISAKAADGAPCVTHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P +I+ +F  W+TG+L SYLI+ITAE+L+ 
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPAQIAEIFRTWNTGRLDSYLIEITAEVLAH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS +       +
Sbjct: 244 VDADTGKPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAALRDASR 303

Query: 303 SFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           S   P +  PL   +  +F   +E ALYAS I+S+TQGF  I  + ++Y W++ L  +A 
Sbjct: 304 SLAGPKA-TPLSAAEAGAFADRVEQALYASKIVSYTQGFHEIDAARDEYDWNIDLGRVAS 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWR GCIIR+  L+ I  +    P   +LL+  + ++++       R ++V  T  G P 
Sbjct: 363 IWRGGCIIRAAFLDRIRAAYDARPDLPSLLSDDAFAQEIAAAQDDWREVLVAATRQGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           P  +AAL+Y+D    +R  A L Q QRDFFG+H + R D+    H  W +  +E
Sbjct: 423 PGFAAALAYYDALRAERLPAALTQGQRDFFGAHTYRRVDREGSFHTLWGQGRSE 476


>gi|318060330|ref|ZP_07979053.1| 6-phosphogluconate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318080548|ref|ZP_07987880.1| 6-phosphogluconate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 479

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 283/468 (60%), Gaps = 5/468 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   +++  G     + T++ E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARHGYTVALHNRTAAKTRALVEEF-GDEGSFVPTESAEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +ID+  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVVMVKAGEATDAVIDEFAPLLEEGDMIVDGGNAHFADTRRRERKLRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA +G S+M GG++++Y  +  +L  I+AK ++ +PC   +GPDG+GHF
Sbjct: 124 FVGTGISGGEEGALNGPSIMPGGSKESYKALGPMLEKIAAKAEDGAPCVTHIGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P  I+ +F  W+TG+L SYLI+ITAE+L  
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPARIADVFRTWNTGRLDSYLIEITAEVLKH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           SD  TG P +DV+ D A QKGTG  ++     L   ++    A+FAR+LS +    +   
Sbjct: 244 SDPKTGKPFVDVVADAAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHTALREASG 303

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               P+   PL+  ++  F   +E ALYAS I+S+TQGF  I   S +Y W + L  +A 
Sbjct: 304 HLSGPTPK-PLEEAEAARFADQVEQALYASKIVSYTQGFHEIAAGSAEYGWDIDLGAVAS 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+ I  +    P   +LL+ P  + +V+      R ++ T    G   
Sbjct: 363 IWRAGCIIRAAFLDRITAAYARQPELPSLLSDPRFASEVEGAQGDWRDVIGTAVRQGVAT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  S AL+Y+D     R  A L QAQRD+FG+H + R D+    H  W
Sbjct: 423 PGFSTALAYYDALRAPRLPAALTQAQRDYFGAHTYQRVDRDGTFHTLW 470


>gi|28564035|gb|AAO32396.1| GND1 [Saccharomyces bayanus]
          Length = 489

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/455 (42%), Positives = 273/455 (60%), Gaps = 6/455 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           AD G+IGL  MG NL LN  D GF +  YN+     D F+       + +I   +++  +
Sbjct: 3   ADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLAN-EAKGKSIIGATSIQDFI 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PRK++++V  G PVD LI ++ PLL   DI++DGGNSHF D+  R  +L + GI 
Sbjct: 62  SKLKRPRKVMLLVKAGAPVDALIKEIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKHGIL 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+E+A+  ++NI  SISAK    PCC  +GP G+GH+V
Sbjct: 122 FVGSGVSGGEDGARYGPSLMPGGSEEAWPHIKNIFQSISAKSDGEPCCEWVGPAGAGHYV 181

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F+ W+ G L S+LI+IT +IL   
Sbjct: 182 KMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISEVFTTWNKGVLDSFLIEITRDILKFD 241

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D + G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  ++E  +   
Sbjct: 242 D-VDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERVRASK 300

Query: 304 FFNPSSHFP---LKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
              P    P   +K    FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA 
Sbjct: 301 VL-PGPQVPKDAVKDRKQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIAL 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L +I K+  ++P   NLL     ++ V K     R+ +   T  G P 
Sbjct: 360 MWRGGCIIRSVFLAEITKAYRQEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPT 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF 455
           P+ S AL+++D +  +R  ANL+QAQRD+FG+H F
Sbjct: 420 PAFSTALTFYDGYRSERLPANLLQAQRDYFGAHTF 454


>gi|261208955|ref|ZP_05923360.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium TC 6]
 gi|289565233|ref|ZP_06445685.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium D344SRF]
 gi|294615032|ref|ZP_06694921.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1636]
 gi|294618640|ref|ZP_06698178.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1679]
 gi|260076994|gb|EEW64716.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium TC 6]
 gi|289163054|gb|EFD10902.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium D344SRF]
 gi|291592163|gb|EFF23783.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1636]
 gi|291595113|gb|EFF26452.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1679]
          Length = 473

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYALVAPILEQISAKAEDEAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ LN +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILNLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +S+++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKELVEKIREALYFSKIMSYAQGFAQLRVASKEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYDKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|149239352|ref|XP_001525552.1| 6-phosphogluconate dehydrogenase [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451045|gb|EDK45301.1| 6-phosphogluconate dehydrogenase [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 520

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 268/456 (58%), Gaps = 4/456 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           + D G+IGL  MG NL LN  D G+ +  YN+     D FI       + +I   +++ +
Sbjct: 31  RGDFGLIGLAVMGQNLILNAADHGYTVVAYNRTTSKVDHFIAN-EAKGKSIIGVHSVKSL 89

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V  + +PRKI+++V  GD VD  I +L P L   DI++DGGNSHF D+  R  +L EKGI
Sbjct: 90  VANLKRPRKIMLLVKAGDAVDNFIGQLLPFLDKGDIIIDGGNSHFPDSNRRFEELKEKGI 149

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G GVSGG +GAR+G SLM GGNE A+  ++ I   I+AK    PCC  +G  G+GH+
Sbjct: 150 LFVGTGVSGGEEGARTGPSLMPGGNEAAWPEIKAIFQDIAAKSDGEPCCDWVGDAGAGHY 209

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQLI + Y +++        EI+ +F+KW+ G L S+LI+IT +IL  
Sbjct: 210 VKMVHNGIEYGDMQLICEAYDVMKRVGKFTDKEIADVFAKWNNGVLDSFLIEITRDILKF 269

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D   G P+++ I D A QKGTG  + I    L   +T+   A+FAR LS  + E  K  
Sbjct: 270 DDPTDGEPVVEKILDTAGQKGTGKWTAINALDLGVPVTLIGEAVFARCLSALKAERVKAS 329

Query: 303 SFFNP---SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                    +  P+K    F+ DLE ALYAS I+S+ QGF ++ ++++ Y W L+ A IA
Sbjct: 330 KILEGPEVGAESPIKDKQKFIDDLEQALYASKIISYAQGFMLMNQAAKDYGWKLNNAGIA 389

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L +I  +  E+P   NLL  P   + + K     R  +     NG P
Sbjct: 390 LMWRGGCIIRSVFLKEITSAYRENPELDNLLFHPFFKDAITKAQSGWRSAIGQAIANGIP 449

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGF 455
            P+ S AL+++D     +  ANL+QAQRD+FG+H F
Sbjct: 450 TPAFSTALAFYDGLRSSKLPANLLQAQRDYFGAHTF 485


>gi|154508263|ref|ZP_02043905.1| hypothetical protein ACTODO_00759 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797897|gb|EDN80317.1| hypothetical protein ACTODO_00759 [Actinomyces odontolyticus ATCC
           17982]
          Length = 488

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 280/468 (59%), Gaps = 4/468 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG MG+NL+ N+   G+  AV+N+    T+  + +  G     +    LE  V
Sbjct: 11  ADIGVYGLGVMGANLARNLARNGYATAVFNRTPARTEKLMAE-HGDEATFVPASTLEDFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR  +MMV  G   D ++++L  L+   DI++D GNS F DT  R    +E+G++
Sbjct: 70  ASLRAPRVAIMMVQAGPSTDAVMEQLADLMDEGDIIVDCGNSLFTDTIRREKWAAERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG   +Y+R+  +  +I+  Y   PCC  +G +G+GHFV
Sbjct: 130 FVGAGVSGGEEGALWGPSIMPGGTPASYDRLGPMFEAIAGTYDGVPCCTYIGANGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+IA+ Y +LR+ L   P EI+ +F+ W+ G+L+SYL++IT E+L   
Sbjct: 190 KMVHNGIEYADMQVIAEAYTLLREGLGATPAEIADIFAAWNEGELNSYLMEITVEVLRQV 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D ASQKGTG  ++     L+  +T    A FAR  S    +    Q+
Sbjct: 250 DAETGKPLVDLIVDAASQKGTGKWTVQTALDLAVPVTAIGEATFARGASSEPAQRAAGQA 309

Query: 304 FFNPSSHFPLKCFD---SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               ++   ++  +   +F++D+  AL+AS I++++QGF  I   +++Y W +    +AR
Sbjct: 310 LVGNATALVIESDEARAAFIEDVRQALFASKIVAYSQGFDEIEAGAKEYEWGIDKGALAR 369

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+DI ++   DP+   LL     + + ++  P+LRR+V      G P+
Sbjct: 370 IWRAGCIIRAAFLDDITRAYEADPNLPLLLAAEPFATRFQECTPALRRVVAQAALAGVPI 429

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  +++L+YFD     R  A LIQ QRDFFGSH + R DK    H  W
Sbjct: 430 PVFASSLAYFDQIRAKRLPAALIQGQRDFFGSHTYHRVDKEGVFHTLW 477


>gi|69247351|ref|ZP_00604315.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium DO]
 gi|257880265|ref|ZP_05659918.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,230,933]
 gi|257883064|ref|ZP_05662717.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,502]
 gi|257891352|ref|ZP_05671005.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,410]
 gi|257893651|ref|ZP_05673304.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,408]
 gi|260560437|ref|ZP_05832611.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium C68]
 gi|293560678|ref|ZP_06677162.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1162]
 gi|293569251|ref|ZP_06680549.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1071]
 gi|294623215|ref|ZP_06702090.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium U0317]
 gi|314937955|ref|ZP_07845268.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133a04]
 gi|314940987|ref|ZP_07847889.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133C]
 gi|314947556|ref|ZP_07850968.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0082]
 gi|314953135|ref|ZP_07856090.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133A]
 gi|314993017|ref|ZP_07858411.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133B]
 gi|314995300|ref|ZP_07860410.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133a01]
 gi|68194874|gb|EAN09346.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium DO]
 gi|257814493|gb|EEV43251.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,230,933]
 gi|257818722|gb|EEV46050.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,502]
 gi|257827712|gb|EEV54338.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,410]
 gi|257830030|gb|EEV56637.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,231,408]
 gi|260073439|gb|EEW61767.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium C68]
 gi|291587957|gb|EFF19807.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1071]
 gi|291597372|gb|EFF28548.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium U0317]
 gi|291605352|gb|EFF34802.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1162]
 gi|313590485|gb|EFR69330.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133a01]
 gi|313592468|gb|EFR71313.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133B]
 gi|313594803|gb|EFR73648.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133A]
 gi|313600179|gb|EFR79022.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133C]
 gi|313642678|gb|EFS07258.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0133a04]
 gi|313645999|gb|EFS10579.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium TX0082]
          Length = 473

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYALVAPILEQISAKAEDGAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ LN +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILNLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +S+++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKELVEKIREALYFSKIMSYAQGFAQLRVASKEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYDKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|47094401|ref|ZP_00232091.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes str. 4b H7858]
 gi|47017222|gb|EAL08065.1| 6-phosphogluconate dehydrogenase, decarboxylating [Listeria
           monocytogenes str. 4b H7858]
          Length = 459

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/460 (41%), Positives = 284/460 (61%), Gaps = 3/460 (0%)

Query: 14  MGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEAVCKPRKIL 73
           MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE+ VE++  PR+IL
Sbjct: 1   MGRNLALNIESRGHTVSIFNRSTEKTKAVMEE--NADKKLVPTYSLEEFVESLEVPRRIL 58

Query: 74  MMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFIGIGVSGGV 133
           +MV  GD  D +I+ +KP L+  DIL+DGGN+ F DT  R+ +LSE+G  FIG GVSGG 
Sbjct: 59  IMVKAGDATDMMIEAVKPFLNEGDILIDGGNAFFKDTIRRNKELSEEGFNFIGTGVSGGE 118

Query: 134 KGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKMIHNGIEYA 193
           +GA  G S+M GG  KAY+ V  IL  I+A     PC   +GPDG+GH+VKM+HNGIEY 
Sbjct: 119 EGALKGPSIMPGGQRKAYDLVAPILREIAAVADGEPCVTYIGPDGAGHYVKMVHNGIEYG 178

Query: 194 NMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMPIID 253
           +MQLIA+ Y IL++    +  E++ +F +W+ G+L SYLI+IT  IL   D  TG PI+D
Sbjct: 179 DMQLIAEAYTILKEIGGLSHDELADVFEEWNNGELDSYLIEITKNILKVKDEETGKPIVD 238

Query: 254 VICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFFNPSSHFPL 313
           VI DKA QKGTG  +      L   +++   ++FAR +S  +DE     +  +  S++  
Sbjct: 239 VILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKDERVYASTVLSGPSNYRF 298

Query: 314 KC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRAGCIIRSQI 372
           +    +FV+ +  ALY S I S+ QGF  +  +SE+  W L    IA+I+RAGCIIR++ 
Sbjct: 299 EGDKKAFVESVRRALYFSKIASYAQGFAQMRAASEENDWDLQYGEIAKIFRAGCIIRARF 358

Query: 373 LNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLSAALSYFDT 432
           L  I  +  +D +  NLL  P   +        LR +V    + G PVP+ +AA+SY+D+
Sbjct: 359 LQKITDAYNKDKNLKNLLLDPYFKDIAHNYQGDLRTVVAEAVKAGIPVPTFTAAISYYDS 418

Query: 433 FIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVS 472
           +  +  +ANLIQAQRD+FG+H ++R DK    H  W +V 
Sbjct: 419 YRSEVLSANLIQAQRDYFGAHTYERVDKPGVFHTEWPQVE 458


>gi|238024189|ref|YP_002908421.1| 6-phosphogluconate dehydrogenase [Burkholderia glumae BGR1]
 gi|237878854|gb|ACR31186.1| 6-phosphogluconate dehydrogenase, decarboxylating [Burkholderia
           glumae BGR1]
          Length = 469

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/470 (41%), Positives = 291/470 (61%), Gaps = 4/470 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G  ++VYN+  + TD  I +     ++++ T  LE
Sbjct: 1   MGKQAIGVVGMAVMGRNLALNIESRGHAVSVYNRSRDKTDELIAEFP--DRQLVPTYTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PRKIL+MV  G+  D  I  LKPLL   D+L+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLETPRKILLMVKAGEATDATIAALKPLLGKGDVLIDGGNTHFTDTIRRNQELAQS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G++FIG GVSGG +GA  G S+M GG   AY+ VE IL  I+AK  +  PC A +GPDG+
Sbjct: 119 GLHFIGTGVSGGEEGALHGPSIMPGGQRDAYDLVEPILKQIAAKAPDGEPCVAYMGPDGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GHFVKM+HNGIEY +MQLIA+ Y +L+     +  E+  ++++W+ G+L SYLI+IT++I
Sbjct: 179 GHFVKMVHNGIEYGDMQLIAESYAVLKQVAGLSNEELGRVYTEWNQGELDSYLIEITSKI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
               D  TG  ++DVI D+A+QKGTG  +      L   + +   ++FAR LS  + +  
Sbjct: 239 FGKKDDETGEYLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKTQRV 298

Query: 300 KMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                 +  +   L     +F++ +  ALY S ++S+ QGF  +  +S++Y W L+L  I
Sbjct: 299 AASKVLSGPAAGKLDGDRAAFIEAVRRALYLSKVISYAQGFAQLDTASKEYGWKLNLGEI 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           ARI+RAGCIIR++ L  I  + T +P   NLL  P   E       +LR +VV   + G 
Sbjct: 359 ARIFRAGCIIRARFLQKITDAYTANPELANLLLDPYFKEISANYQAALRDVVVAAVKAGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           PVP+ S+A++YFD++   R  ANL+QAQRDFFG+H F+R DK    H  W
Sbjct: 419 PVPAFSSAIAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHANW 468


>gi|326437550|gb|EGD83120.1| 6-phosphogluconate dehydrogenase [Salpingoeca sp. ATCC 50818]
          Length = 484

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/461 (40%), Positives = 287/461 (62%), Gaps = 10/461 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +ADI +IGL  MG N  LN+ D GF +  YN+  E  D F+         VI  +++E+M
Sbjct: 6   KADIALIGLAVMGQNFILNMNDHGFVVTAYNRTVEKVDRFMAN-EAKGTNVIGARSIEEM 64

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PR+++M+V  G  VD  ID++ P L   DI++DGGNS + DT  R+  L EKGI
Sbjct: 65  VKSLKRPRRVMMLVKAGPVVDTFIDQIVPHLEKGDIIIDGGNSEYADTTRRTKTLKEKGI 124

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            FIG G+SGG +GAR G SLM GGN +A+  V+ I    +A+    PCC  +G +G+GH+
Sbjct: 125 LFIGTGISGGEEGARYGPSLMPGGNPEAWPHVKEIFQKCAAQVDGEPCCDWVGDEGAGHY 184

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQL  + Y ++++ L  +  E+S +F++W+ G+L S+LI+IT +IL+ 
Sbjct: 185 VKMVHNGIEYGDMQLCCEAYHLMKECLGMSCKEMSSVFAEWNKGELDSFLIEITRDILAF 244

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE----S 298
            +   G P+++ I DKA QKGTG  + I    +   +T+   ++FAR LS  +DE    S
Sbjct: 245 EE--DGEPLLEKIMDKAGQKGTGKWTAISALDMGMPVTLIGESVFARCLSAIKDERVAAS 302

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K++     P+S +      +FV+D+  ALYAS I+S+ QGF ++ +++ +Y W L+   I
Sbjct: 303 KRLPG--PPTSKYDGDK-KAFVEDIRQALYASKIVSYAQGFMLMRQAATEYGWKLNFPAI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCIIRS  L +I  +  ++P  TNLL     +  + K   + RR+V      G 
Sbjct: 360 ALMWRGGCIIRSVFLGNIRDAFKKNPELTNLLMDDFFANAITKCQAAWRRVVAAGVTLGV 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           P P+ S AL+++D +  +R  ANLIQAQRDFFG+H ++R D
Sbjct: 420 PTPAFSTALAFYDGYRSERLPANLIQAQRDFFGAHTYERLD 460


>gi|259507201|ref|ZP_05750101.1| 6-phosphogluconate dehydrogenase, decarboxylating [Corynebacterium
           efficiens YS-314]
 gi|259165216|gb|EEW49770.1| 6-phosphogluconate dehydrogenase, decarboxylating [Corynebacterium
           efficiens YS-314]
          Length = 488

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 287/478 (60%), Gaps = 11/478 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  + TD  I   +      I TK +E  V
Sbjct: 12  AQIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYA-TDGNFIPTKTVEDFV 70

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ KPR+ ++MV  G   D +I++L   +   DI++DGGN+ + DT  R  +++ +G +
Sbjct: 71  AALEKPRRAIVMVQAGAATDAVINQLADAMEEGDIIIDGGNALYTDTVCREKEMAARGRH 130

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG ++++  +  +L SI+AK    PC   +GPDG+GHFV
Sbjct: 131 FVGAGISGGEEGALNGPSIMPGGPKESWEALGPLLESIAAKVDGVPCVTHIGPDGAGHFV 190

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P EI+ +F++W+ G L SYLI+ITAE+L   
Sbjct: 191 KMVHNGIEYADMQVIGEAYQLLRFGAGMEPAEIADVFAEWNKGDLDSYLIEITAEVLRQV 250

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D A QKGTG  ++ E   L   +T    A+FAR LS   D+ K  Q 
Sbjct: 251 DAETGKPLVDVILDAAGQKGTGRWTVKEALDLGVPVTGIGEAVFARALSSSLDQRKAAQG 310

Query: 304 FFNPSSHFPLKCFD-------SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                +   L  F+        FV+D+  ALYAS +++++QGF  I   S++++W +   
Sbjct: 311 NLPTGA---LTTFEELGLDKAEFVEDVRRALYASKLVAYSQGFDEIKAGSDEHNWGVDPR 367

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            +A IWR GCIIR++ LN IV++   DP   +LL  P    +++  + S RRIV+  T+ 
Sbjct: 368 DLATIWRGGCIIRAKFLNRIVEAYDNDPELPSLLLDPYFKGELEDLMDSWRRIVIYVTQL 427

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           G P P  +++L+Y+D+   +R  A +IQ QRDFFG+H + R DK    H  W    +E
Sbjct: 428 GLPAPVFTSSLAYYDSLRAERLPAAIIQGQRDFFGAHTYHRIDKPGSFHTLWSGDRSE 485


>gi|227515220|ref|ZP_03945269.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           fermentum ATCC 14931]
 gi|227086411|gb|EEI21723.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           fermentum ATCC 14931]
          Length = 479

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/475 (39%), Positives = 296/475 (62%), Gaps = 11/475 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + A IG+IGL  MG NL+LNI  +GF + VYN+  E TD  ++  S   +K++ +  +E 
Sbjct: 4   QTAQIGVIGLAVMGKNLALNIESRGFTVGVYNRHRERTDEMMRDHS--EKKLVPSYTIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ILMMV  G   D +I++L PLL   D+L+DGGN++F DT  R+ +L E G
Sbjct: 62  FVNSLEKPRRILMMVQAGKGTDAVINELLPLLDKGDVLIDGGNTNFHDTMARNAKLDESG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK ++  PC + +GP+G+G
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILTQIAAKAEDGKPCVSYIGPNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y ++R+ L  +  E++ +F++W+ G+L SYL++ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEELIDESYNVMRNVLGLSVDEMADIFAEWNKGELDSYLVEITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +     +PI+D I D+ + KGTG  S        +  ++   A++AR +S+ +DE
Sbjct: 242 TRKDDLGDDKNLPIVDAILDRGANKGTGKWSSETALDGGAPQSVITEAVYARYISMLKDE 301

Query: 298 ----SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSL 353
               SK++       + F       +++ +  ALY   ++S+ QGF  +   SE+Y W+L
Sbjct: 302 RVAASKELPEDVEKVT-FSDDEKKEYIEKVRQALYFGKVMSYAQGFEQMRIDSERYDWNL 360

Query: 354 SLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTC 413
               +A+IWR GCIIR+Q L  I  +  ++P+  NLL      +  KK   ++R +V   
Sbjct: 361 QYGELAQIWREGCIIRAQFLQKITDAFEKNPALKNLLLDDYFKDIAKKYQKAIREVVALS 420

Query: 414 TENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            + G PVPSL+AA++Y+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 421 VKAGIPVPSLAAAINYYDSYRAEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 475


>gi|254671258|emb|CBA08537.1| 6-phosphogluconate dehydrogenase, decarboxylating [Neisseria
           meningitidis alpha153]
          Length = 482

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/459 (40%), Positives = 283/459 (61%), Gaps = 3/459 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           + DIG+IGL  MG NL LN+ D GF++  YN+     D F+   +     ++   +L+ +
Sbjct: 2   KGDIGVIGLAVMGQNLILNMNDCGFKVVAYNRTIGKVDEFLNG-AAKGTDIVGAYSLQDL 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+ + KPRKI+MMV  G  VD  I++L PLL   DI++DGGN+++ DT  R+  L+EKGI
Sbjct: 61  VDKLAKPRKIMMMVRAGSVVDDFIEQLLPLLEEGDIIIDGGNANYPDTTRRTHYLAEKGI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDGSGH 181
            F+G GVSGG +GAR G S+M GG+++A++ V+ I  +I+AK  Q  PCC  +G DG+GH
Sbjct: 121 LFVGAGVSGGEEGARHGPSIMPGGDKRAWDAVKPIFQAIAAKTPQGEPCCDWVGKDGAGH 180

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEY +MQLI + Y  ++D L  +  E+  +F++W+  +L SYLI+ITA IL 
Sbjct: 181 FVKMVHNGIEYGDMQLICEAYQFMKDGLGLSYDEMHRVFAEWNKTELDSYLIEITAAILG 240

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D   G P+++ I D A QKGTG  + I    L   +T+   A+FAR +S ++++  +M
Sbjct: 241 YKDE-GGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLISEAVFARCVSSFKEQRVRM 299

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              F   +         +V DL  AL AS I+S+ QGF +I ++ E Y W L     A +
Sbjct: 300 GGLFARQALPVGGDKKQWVGDLRQALLASKIISYAQGFMLIREAGESYGWDLDYGNTALL 359

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIRS  L++I  +   +P    L   P     ++  +P+ R++V    E G P+P
Sbjct: 360 WREGCIIRSAFLSNIRDAYENNPDLVFLGTDPYFKNILENCLPAWRKVVAKAVECGIPMP 419

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            +++A+++ D +  +R  ANL+QAQRD+FG+H ++R DK
Sbjct: 420 CMASAITFLDGYTTERLPANLLQAQRDYFGAHTYERTDK 458


>gi|15618275|ref|NP_224560.1| 6-phosphogluconate dehydrogenase [Chlamydophila pneumoniae CWL029]
 gi|15835893|ref|NP_300417.1| 6-phosphogluconate dehydrogenase [Chlamydophila pneumoniae J138]
 gi|16752680|ref|NP_444947.1| 6-phosphogluconate dehydrogenase [Chlamydophila pneumoniae AR39]
 gi|33241702|ref|NP_876643.1| 6-phosphogluconate dehydrogenase [Chlamydophila pneumoniae TW-183]
 gi|6831430|sp|Q9Z8I3|6PGD_CHLPN RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|4376636|gb|AAD18504.1| 6-Phosphogluconate Dehydrogenase [Chlamydophila pneumoniae CWL029]
 gi|7189322|gb|AAF38243.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           pneumoniae AR39]
 gi|8978732|dbj|BAA98568.1| 6-phosphogluconate dehydrogenase [Chlamydophila pneumoniae J138]
 gi|33236211|gb|AAP98300.1| phosphogluconate dehydrogenase [Chlamydophila pneumoniae TW-183]
          Length = 479

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 293/460 (63%), Gaps = 4/460 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           Q +IG+IGL  MG NL LN++D GF ++VYN+  E T  F+K+     ++++  ++LE  
Sbjct: 2   QTNIGLIGLAVMGKNLVLNMIDHGFSVSVYNRTPEKTRDFLKEYPN-HRELVGFESLEDF 60

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++ +PRKI++M+  G PVDQ I  L P L P D+++DGGNS+F D++ R  +L EKGI
Sbjct: 61  VNSLERPRKIMLMIQAGKPVDQSIHALLPFLEPGDVIIDGGNSYFKDSERRCKELQEKGI 120

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            F+G+G+SGG +GAR G S+M GGN +A+  V  I  SI+AK Q  PCC+ +G  G+GH+
Sbjct: 121 LFLGVGISGGEEGARHGPSIMPGGNPEAWPLVAPIFQSIAAKVQGRPCCSWVGTGGAGHY 180

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VK +HNGIEY ++QLI + YGILRD L  +   ++ +  +W+T +L SYLI+I +E+L+ 
Sbjct: 181 VKAVHNGIEYGDIQLICEAYGILRDFLKLSATAVATILKEWNTLELESYLIRIASEVLAL 240

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD-ESKKM 301
            D   G+P+ID I D   QKGTG  + I+       +++   A+ AR LS +++   +  
Sbjct: 241 KDP-EGIPVIDTILDVVGQKGTGKWTAIDALNSGVPLSLIIGAVLARFLSSWKEIREQAA 299

Query: 302 QSFFNPSSHFPLKCFDS-FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           +++      F +    S F++D+ +ALYAS I+S+ QGF ++G++S++Y+W L L  IA 
Sbjct: 300 RNYPGTPLIFEMPHDPSVFIQDVFHALYASKIISYAQGFMLLGEASKEYNWGLDLGEIAL 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCII+S  L+ I K    +P +T+L+        ++      RR VVT    G P+
Sbjct: 360 MWRGGCIIQSAFLDVIHKGFAANPENTSLIFQEYFRGALRHAEMGWRRTVVTAIGAGLPI 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           P L+AA++++D +     + +L Q  RD+FG+H ++R D+
Sbjct: 420 PCLAAAITFYDGYRTASSSMSLAQGLRDYFGAHTYERNDR 459


>gi|145295586|ref|YP_001138407.1| 6-phosphogluconate dehydrogenase [Corynebacterium glutamicum R]
 gi|140845506|dbj|BAF54505.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 492

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 282/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  + TD  I    G     I +  +E+ V
Sbjct: 16  AQIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLIAD-HGSEGNFIPSATVEEFV 74

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G+  D +I++L   +   DI++DGGN+ + DT  R  ++S +G++
Sbjct: 75  ASLEKPRRAIIMVQAGNATDAVINQLADAMDEGDIIIDGGNALYTDTIRREKEISARGLH 134

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  K+Y  +  +L SI+A    +PC   +GPDG+GHFV
Sbjct: 135 FVGAGISGGEEGALNGPSIMPGGPAKSYESLGPLLESIAANVDGTPCVTHIGPDGAGHFV 194

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F +W+ G L SYLI+ITAE+LS  
Sbjct: 195 KMVHNGIEYADMQVIGEAYHLLRYAAGMQPAEIAEVFKEWNAGDLDSYLIEITAEVLSQV 254

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P+IDVI D A QKGTG  ++     L  + T    A+FAR LS    +    Q 
Sbjct: 255 DAETGKPLIDVIVDAAGQKGTGRWTVKAALDLGIATTGIGEAVFARALSGATSQRAAAQG 314

Query: 304 FFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                    L+        FV+D+  ALYAS ++++ QGF  I   S++ +W +    +A
Sbjct: 315 NLPAGVLTDLEALGVDKAQFVEDVRRALYASKLVAYAQGFDEIKAGSDENNWDVDPRDLA 374

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN IV++   +    +LL  P    ++   I S RR++VT T+ G P
Sbjct: 375 TIWRGGCIIRAKFLNRIVEAYDANAELESLLLDPYFKSELGDLIDSWRRVIVTATQLGLP 434

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           +P  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 435 IPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRIDKDGSFHTEWSGDRSE 489


>gi|299822983|ref|ZP_07054869.1| phosphogluconate dehydrogenase (decarboxylating) [Listeria grayi
           DSM 20601]
 gi|299816512|gb|EFI83750.1| phosphogluconate dehydrogenase (decarboxylating) [Listeria grayi
           DSM 20601]
          Length = 472

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/472 (41%), Positives = 288/472 (61%), Gaps = 3/472 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M + +IG+IG+G MG NL+LNI  +G  ++++N+  E T   +++     +K++ T +LE
Sbjct: 1   MAKQEIGVIGMGVMGRNLALNIESRGHSVSIFNRSSEKTKAVMEE--NADKKLVPTYSLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++  PR+IL+MV  G+  D +ID LKP L   DIL+DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVGSLEIPRRILIMVKAGEATDMMIDALKPFLDEGDILIDGGNAFFEDTIRRNKELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG  +AY+ V  IL  I+A     PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQRRAYDLVAPILQEIAAVADGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y IL+D    +  E++ +F +W+ G+L SYLI+IT  IL
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYHILKDVAGLSHEELADVFEEWNEGELDSYLIEITKNIL 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D  TG PI+D+I DKA QKGTG  +      L   +++   ++FAR +S  + E   
Sbjct: 239 KVKDPETGKPIVDIILDKAGQKGTGKWTSQSALDLGVPLSLITESVFARYISALKTERVH 298

Query: 301 MQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
             S    P          +F++ +  ALY S I S+ QGF  +  +S++Y+W L    IA
Sbjct: 299 ASSILKGPKKAAFSGDKKAFIESVRRALYFSKIASYAQGFAQMKSASDEYNWDLQYGEIA 358

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR++ L  I  +   D +  NLL  P  ++        LR ++    + G P
Sbjct: 359 KIFRAGCIIRARFLQKITDAYNNDKNLNNLLLDPYFTDIADNYQDDLRNVIAEAVKAGIP 418

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKV 471
           VP+ +AA+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W ++
Sbjct: 419 VPTFAAAISYYDSYRAEVLPANLIQAQRDYFGAHTYERVDKEGIFHTEWPEI 470


>gi|94676911|ref|YP_588840.1| 6-phosphogluconate dehydrogenase, decarboxylating [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94220061|gb|ABF14220.1| 6-phosphogluconate dehydrogenase, decarboxylating [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 468

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/472 (40%), Positives = 296/472 (62%), Gaps = 10/472 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LN+   GFR++++N+  E T+  + +  G++  +    +L 
Sbjct: 1   MLRQQIGVVGMAVMGRNLALNMAKNGFRVSIFNRSREKTEHVMAENPGIN--LFPYFSLR 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + + ++ KPR+IL+MV  G+  DQ I+ LK  +   DIL+DGGNS + DT  R+ +LS+ 
Sbjct: 59  EFINSLEKPRRILLMVKAGEATDQTINALKSFIDKGDILIDGGNSFYHDTIRRNQELSKD 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G YFIG G+SGG +GA  G S+M GG ++AYN +  I  +I+A+     C A +GPDGSG
Sbjct: 119 GFYFIGTGISGGEEGALKGPSIMPGGQKEAYNFISPIFETIAARANGEACVAYIGPDGSG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  L  N  E++++F +W+ G+LSSYL+ IT +I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAETYALLKIILGMNNDELANIFYEWNQGELSSYLMDITHKIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE--- 297
           +  D ITG  +IDVI D+A+ K TG  +      L   + +  TA+FAR LS  + +   
Sbjct: 239 TQKD-ITGKYLIDVIADEATHKETGKWTSQSALDLGEPLNLITTAVFARYLSSLKQQRIC 297

Query: 298 -SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
            SK ++    P++ +      +F++++  ALY   I+S+ QGF  +  +S K++W+L+  
Sbjct: 298 ASKVLKG---PTTKYFSIDKPAFIENMRRALYLGKIISYAQGFSQLKAASAKFNWNLNYG 354

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA+I+R+GCIIR+Q L +I  + T++   TNLL  P    K      +LR +V     N
Sbjct: 355 DIAKIFRSGCIIRAQFLQNITDAYTQNTFITNLLLSPYFKAKANDYHQALREVVTHAIHN 414

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G PVP+LSAA++Y+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 415 GIPVPTLSAAITYYDSYRSLMLPANLIQAQRDYFGAHTYKRIDKEGIFHTEW 466


>gi|25028144|ref|NP_738198.1| 6-phosphogluconate dehydrogenase [Corynebacterium efficiens YS-314]
 gi|23493428|dbj|BAC18398.1| putative 6-phosphogluconate dehydrogenase [Corynebacterium
           efficiens YS-314]
          Length = 490

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 287/478 (60%), Gaps = 11/478 (2%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  + TD  I   +      I TK +E  V
Sbjct: 14  AQIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYA-TDGNFIPTKTVEDFV 72

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ KPR+ ++MV  G   D +I++L   +   DI++DGGN+ + DT  R  +++ +G +
Sbjct: 73  AALEKPRRAIVMVQAGAATDAVINQLADAMEEGDIIIDGGNALYTDTVCREKEMAARGRH 132

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG ++++  +  +L SI+AK    PC   +GPDG+GHFV
Sbjct: 133 FVGAGISGGEEGALNGPSIMPGGPKESWEALGPLLESIAAKVDGVPCVTHIGPDGAGHFV 192

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR      P EI+ +F++W+ G L SYLI+ITAE+L   
Sbjct: 193 KMVHNGIEYADMQVIGEAYQLLRFGAGMEPAEIADVFAEWNKGDLDSYLIEITAEVLRQV 252

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++DVI D A QKGTG  ++ E   L   +T    A+FAR LS   D+ K  Q 
Sbjct: 253 DAETGKPLVDVILDAAGQKGTGRWTVKEALDLGVPVTGIGEAVFARALSSSLDQRKAAQG 312

Query: 304 FFNPSSHFPLKCFD-------SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                +   L  F+        FV+D+  ALYAS +++++QGF  I   S++++W +   
Sbjct: 313 NLPTGA---LTTFEELGLDKAEFVEDVRRALYASKLVAYSQGFDEIKAGSDEHNWGVDPR 369

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            +A IWR GCIIR++ LN IV++   DP   +LL  P    +++  + S RRIV+  T+ 
Sbjct: 370 DLATIWRGGCIIRAKFLNRIVEAYDNDPELPSLLLDPYFKGELEDLMDSWRRIVIYVTQL 429

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           G P P  +++L+Y+D+   +R  A +IQ QRDFFG+H + R DK    H  W    +E
Sbjct: 430 GLPAPVFTSSLAYYDSLRAERLPAAIIQGQRDFFGAHTYHRIDKPGSFHTLWSGDRSE 487


>gi|330444440|ref|YP_004377426.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           pecorum E58]
 gi|328807550|gb|AEB41723.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           pecorum E58]
          Length = 480

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/462 (40%), Positives = 290/462 (62%), Gaps = 4/462 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MKQ DIG+IGL  MG NL  N+ D GF +++YN+  E T   +K+    SQ ++  ++L+
Sbjct: 1   MKQTDIGLIGLAVMGKNLVFNMRDHGFSVSIYNRTPEKTRNCLKERPNDSQ-LLGFESLK 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ +PRK+++M+  G PVDQ+I  L PLL P D+++DGGNS+F D++ R  +L + 
Sbjct: 60  EFVLSLKRPRKVMLMIQAGAPVDQMIQLLLPLLEPGDVIIDGGNSYFKDSERRYRELKQS 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GI F+G+G+SGG +GAR G S+M GGN +A+  V  I  +I+AK Q  PCC  +G  G+G
Sbjct: 120 GILFLGVGISGGEEGARHGPSIMPGGNPEAWPLVAPIFQAIAAKVQGQPCCVWVGQGGAG 179

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VK +HNGIEY ++QLI + YG+L+  L  +  EIS +F +W+  +L SYLI+ITAE+L
Sbjct: 180 HYVKAVHNGIEYGDIQLICEAYGLLKSFLGLSAEEISEIFKEWNEQELESYLIRITAEVL 239

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  +    +P+ID I D A QKGTG    I+   +   +++   ++ AR LS +++  ++
Sbjct: 240 ALKNE-NNIPVIDTILDTAGQKGTGKWVAIDALDIGVPLSLIIESVLARFLSSWKESREQ 298

Query: 301 MQSFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
               F   P      +   +FV D+ +ALYAS I+S+ QGF ++ ++S +YSW L+L  +
Sbjct: 299 ASQEFPGVPLIFEKPRDVSAFVHDVFHALYASKIISYAQGFMLLSEASREYSWDLNLGEL 358

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCII+S  L+ I K   +DP + +L+        +K      RR V+     G 
Sbjct: 359 ALLWRGGCIIQSVFLDAIYKGFCQDPENPSLIFQEFFKSALKNAEAGWRRTVIAGIGVGV 418

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           P+P L+A LS++D +     +A L Q  RD+FGSH ++RKD+
Sbjct: 419 PIPCLAAGLSFYDGYRTADSSAALAQGLRDYFGSHFYERKDR 460


>gi|237721153|ref|ZP_04551634.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_2_4]
 gi|229449988|gb|EEO55779.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_2_4]
          Length = 491

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 302/472 (63%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+E+A+  V+ IL SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEQAWPEVKPILQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYLI+ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLIEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D        +      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKDLRHLASRQYQCQHTQPIYNKVELVKNIFSALYASKLVSYAQGFAVLQRASDAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 357 DWHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKNL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|15639322|ref|NP_218771.1| 6-phosphogluconate dehydrogenase [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189025564|ref|YP_001933336.1| 6-phosphogluconate dehydrogenase [Treponema pallidum subsp.
           pallidum SS14]
 gi|5902692|sp|O83351|6PGD_TREPA RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|3322609|gb|AAC65319.1| phosphogluconate dehydrogenase (gnd) [Treponema pallidum subsp.
           pallidum str. Nichols]
 gi|189018139|gb|ACD70757.1| phosphogluconate dehydrogenase [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059722|gb|ADD72457.1| 6-phosphogluconate dehydrogenase, decarboxylating [Treponema
           pallidum subsp. pallidum str. Chicago]
          Length = 488

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/463 (40%), Positives = 282/463 (60%), Gaps = 9/463 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG IGL  MG NL LNI   GF +AV+N+   + D F+       +++    ++ ++V
Sbjct: 3   ADIGFIGLAVMGENLVLNIERNGFSVAVFNRTTTVVDRFLAG-RAHGKRITGAHSIAELV 61

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + +PRKI++MV  G  VD +ID++ PLL   D+++DGGNSH+ DT  R   L   GI+
Sbjct: 62  SLLARPRKIMLMVKAGSAVDAVIDQILPLLEKGDLVIDGGNSHYQDTIRRMHALEAAGIH 121

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           FIG GVSGG +GA  G SLM GG+ +A+  V  I  +I+AK  + +PCC  +G DG+GH+
Sbjct: 122 FIGTGVSGGEEGALRGPSLMPGGSAQAWPLVSPIFCAIAAKADDGTPCCDWVGSDGAGHY 181

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKMIHNGIEY +MQ+IA+ Y  ++ +L  +   + H F++W+TG+L SYLI+ITA IL+ 
Sbjct: 182 VKMIHNGIEYGDMQIIAEGYWFMKHALGMSYEHMHHTFTRWNTGRLHSYLIEITAAILAH 241

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            DT  G P+++ I D A QKGTG  + +   +  S +T+   ++ AR+LS  +    K  
Sbjct: 242 QDT-DGTPLLEKILDAAGQKGTGRWTCVAALEEGSPLTLITESVMARSLSAQKQARCKAH 300

Query: 303 SFF------NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             F      + +     +  +  V  LE+ALY + I+S+ QGF ++  ++++  W+L  +
Sbjct: 301 RVFGSPVKVSKAETLSAQQREELVSALEDALYCAKIVSYAQGFELLSHTAKRRGWTLDFS 360

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA +WR GCIIRS  L+ I  +  +     NL+  P  +E++K+  P  R IV      
Sbjct: 361 RIASLWRGGCIIRSGFLSKISAAFAQQHDLENLVLAPFFAEELKRACPGWRTIVAESVRQ 420

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
             PVP+LSAAL++FD F      ANL+QAQRD+FG+H ++R D
Sbjct: 421 ALPVPALSAALAWFDGFTGAALPANLLQAQRDYFGAHTYERTD 463


>gi|293556339|ref|ZP_06674921.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1039]
 gi|291601507|gb|EFF31777.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E1039]
          Length = 473

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYALVAPILEQISAKAEDGAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ LN +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILNLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +S+++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKGLVEKIREALYFSKIMSYAQGFAQLRVASKEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYDKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|293191174|ref|ZP_06609107.1| 6-phosphogluconate dehydrogenase, decarboxylating [Actinomyces
           odontolyticus F0309]
 gi|292820595|gb|EFF79564.1| 6-phosphogluconate dehydrogenase, decarboxylating [Actinomyces
           odontolyticus F0309]
          Length = 488

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 279/468 (59%), Gaps = 4/468 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+ GLG MG+NL+ N+   G+  AV+N+    T+  + +  G     +    LE  V
Sbjct: 11  ADIGVYGLGVMGANLARNLARNGYATAVFNRTQARTEKLMAE-HGDEATFVPASTLEDFV 69

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++  PR  +MMV  G   D ++++L  L+   DI++D GNS F DT  R    +E+G++
Sbjct: 70  ASLRAPRVAIMMVQAGPSTDAVMEQLADLMDEGDIIVDCGNSLFTDTIRREKWAAERGLH 129

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG +GA  G S+M GG   +Y+R+  +  +I+  Y   PCC  +G +G+GHFV
Sbjct: 130 FVGAGVSGGEEGALWGPSIMPGGTPASYDRLGPMFEAIAGTYDGVPCCTYIGANGAGHFV 189

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+IA+ Y +LR+ L   P EI+ +F+ W+ G+L+SYL++IT E+L   
Sbjct: 190 KMVHNGIEYADMQVIAEAYTLLREGLGATPAEIADIFAAWNEGELNSYLMEITVEVLRQV 249

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P++D+I D ASQKGTG  ++     L+  +T    A FAR  S    +    Q+
Sbjct: 250 DAETGKPLVDLIVDAASQKGTGKWTVQTALDLAVPVTAIGEATFARGASSEPAQRAAGQA 309

Query: 304 FFNPSSHFPLKCFD---SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               ++   ++  +   +F++D+  AL+AS I++++QGF  I   +++Y W +    +AR
Sbjct: 310 LAGNATALVIESDEARAAFIEDVRQALFASKIVAYSQGFDEIEAGAKEYEWGIDKGALAR 369

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+DI ++   DP    LL     + + ++  P+LRR+V      G P+
Sbjct: 370 IWRAGCIIRAAFLDDITRAYEADPDLPLLLAAEPFATRFQECTPALRRVVAQAALAGVPI 429

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  +++L+YFD     R  A LIQ QRDFFGSH + R DK    H  W
Sbjct: 430 PVFASSLAYFDQIRAKRLPAALIQGQRDFFGSHTYHRVDKEGVFHTLW 477


>gi|300767182|ref|ZP_07077094.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
 gi|308180401|ref|YP_003924529.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           plantarum subsp. plantarum ST-III]
 gi|300495001|gb|EFK30157.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
 gi|308045892|gb|ADN98435.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           plantarum subsp. plantarum ST-III]
          Length = 478

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/476 (40%), Positives = 294/476 (61%), Gaps = 14/476 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++  IG+IG+  MG NL+LNI  +G+++A++N+    T+  +K  +   ++++ +  +E 
Sbjct: 4   EKPQIGVIGMAVMGKNLALNIESRGYKVAIFNRTGAKTEKVVKDHA--DKQLVPSYKIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR+I+MMV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVASLETPRRIIMMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFNDTMARNARLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  ISAK     +PC   +GP+G+
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKISAKAPQDGAPCVTYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y I+R+    +  E+S +F+ W+ G+LSSYLI+ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNIMRNVAGLSVDEMSDIFTDWNKGELSSYLIEITADI 241

Query: 240 LSSSDTITG---MPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           LS  D +      PI+D+I D+ + KGTG  S  +   +    ++   A++AR +S+ ++
Sbjct: 242 LSRKDDLGADKTKPIVDMILDRGNNKGTGKWSSEDALNVQVPQSVITEAVYARYISMMKN 301

Query: 297 E----SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWS 352
           E    SKK+     P++   L      V+ +  ALY S I+S+ QGF  +  +SE Y W 
Sbjct: 302 ERVAASKKLAG---PTADVDLPAKKELVEKIRQALYFSKIMSYAQGFEQLRFASEHYGWD 358

Query: 353 LSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVT 412
           L    +A+IWRAGCIIR+Q L +I  +  + P   NLL     ++   K   S R ++  
Sbjct: 359 LKFGELAQIWRAGCIIRAQFLQNITDAFDKKPDLNNLLMDDYFADIAAKYQQSTREVLSL 418

Query: 413 CTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             + G PVPS SAALSY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 419 AIQAGVPVPSFSAALSYYDSYRAEVLPANLLQAQRDYFGAHTYERTDREGLYHYSW 474


>gi|182434562|ref|YP_001822281.1| 6-phosphogluconate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178463078|dbj|BAG17598.1| putative 6-phosphogluconate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 479

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/473 (39%), Positives = 280/473 (59%), Gaps = 3/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   ++   G     + T + E  V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVALHNRTAARTRELVEHF-GDEGDFVATGSAEDFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +I +  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVIMVKAGEATDAVIGEFAPLLENGDVIIDGGNAHFEDTRRRERELRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA  G S+M GG+E++Y  +  +L  ISAK ++ +PC   +GPDG+GHF
Sbjct: 124 FVGTGISGGEEGALDGPSIMPGGSEESYASLGPMLEKISAKAKDGAPCVTHVGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM HNGIEYA+MQLI + Y +LRD    +P  I+ +F  W+TG+L SYLI+ITAE+LS 
Sbjct: 184 VKMTHNGIEYADMQLIGEAYQLLRDVAGYSPARIADIFRTWNTGRLESYLIEITAEVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR++S + D     +
Sbjct: 244 VDGATGKPFVDVVLDRAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSVSGHADLRDASR 303

Query: 303 SFFNPSSH-FPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               P++         +F   +E ALYAS I+++TQGF  I   SE+Y W++ L  +A I
Sbjct: 304 HLAGPAARTLGEDEAAAFADRVEQALYASKIVAYTQGFHEIAAGSEQYGWNIDLGAVASI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+  L+ I  +    P    LL     +E++       R +V T    G P P
Sbjct: 364 WRGGCIIRAAFLDRITGAYEARPRMVGLLADRGFAEEIAAAQDDWRTVVATAVTQGVPTP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           + +AAL+Y+D+   +R  A L Q QRD+FG+H + R D+    H  W    TE
Sbjct: 424 AFAAALAYYDSLRAERLPAALTQGQRDYFGAHTYRRTDRDGTFHTLWGGDRTE 476


>gi|329942784|ref|ZP_08291563.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           psittaci Cal10]
 gi|332287376|ref|YP_004422277.1| 6-phosphogluconate dehydrogenase [Chlamydophila psittaci 6BC]
 gi|325507306|gb|ADZ18944.1| 6-phosphogluconate dehydrogenase [Chlamydophila psittaci 6BC]
 gi|328815044|gb|EGF85033.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           psittaci Cal10]
 gi|328914624|gb|AEB55457.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           psittaci 6BC]
          Length = 483

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/459 (40%), Positives = 289/459 (62%), Gaps = 4/459 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN++D GF ++VYN+  E T  F+++ S  S ++   + LE  V
Sbjct: 7   ADIGLIGLAVMGKNLVLNMIDHGFSVSVYNRSPEKTREFLQEHS-QSPELQGHEKLESFV 65

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRKI++M+  G PVDQ ID L P L   DI++DGGNS++ D++ R   L EKGI 
Sbjct: 66  RSLKRPRKIMLMIKAGTPVDQSIDSLLPYLEAGDIIIDGGNSYYKDSERRCRDLKEKGIL 125

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           FIG+G+SGG +GAR G ++M GGN  A+  +  I  SISAK   +PCC  +GP G+GH+V
Sbjct: 126 FIGMGISGGEEGARHGPAIMPGGNSDAWPEIAPIFQSISAKVNGNPCCCWVGPGGAGHYV 185

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEY ++QLI + YG+LR  L+ +P  +S +F++W+T +L SYL++I+ E+LS  
Sbjct: 186 KTVHNGIEYGDIQLICEAYGLLRSRLDISPEAVSSIFAEWNTRELESYLMRISVEVLSLK 245

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D+  G P+ID I D A QKGTG  + I+       +++   ++ AR LS ++   ++   
Sbjct: 246 DS-NGFPVIDTILDVAGQKGTGRWTAIDAIDSGVPLSLIIESVLARFLSSWKTIRERAAQ 304

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                     K  D   F++D+  ALYAS I+S+ QGF ++ ++SE++ W+L+   +A +
Sbjct: 305 ELPGIPIVFEKPRDPHLFIEDVFQALYASKIISYAQGFMLLNQASEEHQWNLNFGELALL 364

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCII+S  L+ I K    +P + +L+        ++ + P  RR V     +GYP+P
Sbjct: 365 WRGGCIIQSVFLDAIHKGFENEPEAPSLILQTYFKTVLQNSEPGWRRTVAYGVGSGYPIP 424

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            L+AAL+++D +     +  L Q  RD+FG+H ++RKD+
Sbjct: 425 CLAAALTFYDGYRTKDSSIALAQGLRDYFGAHTYERKDR 463


>gi|313847957|emb|CBY16953.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           psittaci RD1]
          Length = 484

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/459 (40%), Positives = 289/459 (62%), Gaps = 4/459 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN++D GF ++VYN+  E T  F+++ S  S ++   + LE  V
Sbjct: 8   ADIGLIGLAVMGKNLVLNMIDHGFSVSVYNRSPEKTREFLQEHS-QSPELQGHEKLESFV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRKI++M+  G PVDQ ID L P L   DI++DGGNS++ D++ R   L EKGI 
Sbjct: 67  RSLKRPRKIMLMIKAGTPVDQSIDSLLPYLEAGDIIIDGGNSYYKDSERRCRDLKEKGIL 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           FIG+G+SGG +GAR G ++M GGN  A+  +  I  SISAK   +PCC  +GP G+GH+V
Sbjct: 127 FIGMGISGGEEGARHGPAIMPGGNSDAWPEIAPIFQSISAKVNGNPCCCWVGPGGAGHYV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEY ++QLI + YG+LR  L+ +P  +S +F++W+T +L SYL++I+ E+LS  
Sbjct: 187 KTVHNGIEYGDIQLICEAYGLLRSRLDISPEAVSSIFAEWNTRELESYLMRISVEVLSLK 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D+  G P+ID I D A QKGTG  + I+       +++   ++ AR LS ++   ++   
Sbjct: 247 DS-NGFPVIDTILDVAGQKGTGRWTAIDAIDSGVPLSLIIESVLARFLSSWKTIRERAAQ 305

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                     K  D   F++D+  ALYAS I+S+ QGF ++ ++SE++ W+L+   +A +
Sbjct: 306 ELPGIPIVFEKPRDPHLFIEDVFQALYASKIISYAQGFMLLNQASEEHQWNLNFGELALL 365

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCII+S  L+ I K    +P + +L+        ++ + P  RR V     +GYP+P
Sbjct: 366 WRGGCIIQSVFLDAIHKGFENEPEAPSLILQTYFKTVLQNSEPGWRRTVAYGVGSGYPIP 425

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            L+AAL+++D +     +  L Q  RD+FG+H ++RKD+
Sbjct: 426 CLAAALTFYDGYRTKDSSIALAQGLRDYFGAHTYERKDR 464


>gi|269214176|ref|ZP_05983772.2| 6-phosphogluconate dehydrogenase, decarboxylating [Neisseria
           cinerea ATCC 14685]
 gi|269144319|gb|EEZ70737.1| 6-phosphogluconate dehydrogenase, decarboxylating [Neisseria
           cinerea ATCC 14685]
          Length = 488

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/460 (41%), Positives = 289/460 (62%), Gaps = 5/460 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           + ++G+IGL  MG NL LN+ D GF++  YN+     D F+K  +     VI   +L+ +
Sbjct: 8   KGNLGLIGLAVMGQNLILNMNDHGFKVVAYNRTVSKVDEFLKG-AAQGTDVIGAYSLQDL 66

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+ + KPRKI++MV  G  VD  I++L PLL   DI++DGGN+++ DT  R+  LSEKGI
Sbjct: 67  VDKLEKPRKIMLMVKAGSVVDDFIEQLLPLLDKGDIIIDGGNANYPDTTRRTRYLSEKGI 126

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDGSGH 181
            F+G+GVSGG +GAR G S+M GG+E+A+  V+ I  +I+AK  Q  PCC  +G DG+GH
Sbjct: 127 LFVGMGVSGGEEGARHGPSIMPGGDERAWEAVKPIFQAIAAKTPQGEPCCDWVGRDGAGH 186

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEY +MQLI + Y  ++D L  +  E+  +F++W+  +L+SYLI+ITA IL+
Sbjct: 187 FVKMVHNGIEYGDMQLICEAYQFMKDGLGMSHEEMHQVFAEWNQTELNSYLIEITASILA 246

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D   G P+++ I D A QKGTG  + I    L   +T+   A+FAR +S  +++  + 
Sbjct: 247 YKDE-GGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLISEAVFARCVSSLKEQRTQN 305

Query: 302 QSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
              F     FP+      +V +L  AL AS I+S+ QGF +I ++ E Y+W+L+    A 
Sbjct: 306 SKLFG-QKVFPVDGDKKQWVDNLRQALLASKIISYAQGFMLIREAGETYNWNLNYGKTAL 364

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           +WR GCIIRS  L++I  +   +P    L   P     ++  +P+ R++V    E G P+
Sbjct: 365 LWREGCIIRSAFLSNIRDAYENNPDLVFLGTDPYFKNILETCLPAWRKVVAKAIECGIPM 424

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           P +++A+++ D +  +R  ANL+QAQRD+FG+H ++R DK
Sbjct: 425 PCMASAVTFLDGYTSERLPANLLQAQRDYFGAHTYERTDK 464


>gi|118472260|ref|YP_887935.1| 6-phosphogluconate dehydrogenase [Mycobacterium smegmatis str. MC2
           155]
 gi|118173547|gb|ABK74443.1| 6-phosphogluconate dehydrogenase, decarboxylating [Mycobacterium
           smegmatis str. MC2 155]
          Length = 488

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 282/460 (61%), Gaps = 5/460 (1%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           IG+ GL  MGSN++ N    G+ +A++N+    TD  + +  G   K + ++ + + ++A
Sbjct: 16  IGVTGLAVMGSNIARNFARHGYTVALHNRSIAKTDALLAE-HGSEGKFVRSETIAEFIDA 74

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + KPRK+L+MV  G+  D +ID+L   + P DI++DGGN+ + DT  R   +  +G++F+
Sbjct: 75  LEKPRKVLIMVKAGEATDAVIDELADAMEPGDIIIDGGNALYTDTIRREAAIRARGLHFV 134

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDG+GHFVKM
Sbjct: 135 GAGISGGEEGALNGPSIMPGGPAESYESLGPLLEEISAHVDGVPCCTHIGPDGAGHFVKM 194

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDT 245
           +HNGIEY++MQLI + Y +LRD L  +  EI+ +F +W+ G L S+L++ITA++L  +D 
Sbjct: 195 VHNGIEYSDMQLIGEAYQLLRDGLGMSAGEIADVFEEWNRGDLDSFLVEITAKVLRQTDA 254

Query: 246 ITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSFF 305
            TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    + K      
Sbjct: 255 KTGKPLVDVIVDEAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVPQRKATVGLA 314

Query: 306 NPS-SHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           + +    P    D F++ +  ALYAS I+++ QGF  I   S +Y+W+L+   +A IWR 
Sbjct: 315 SGALGATPSDAAD-FIEAVRRALYASKIVAYAQGFNQIQAGSAEYNWNLTPGDLATIWRG 373

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR++ LN I  +   +P    LL  P   + V+  I S RR+VVT T+ G PVP  +
Sbjct: 374 GCIIRAKFLNRIKDAYDAEPDLPTLLAAPYFRDAVEAGIDSWRRVVVTATQLGIPVPGFA 433

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEP 464
           +ALSY+D    +R  A LIQ  RD+FG+H + R D  +EP
Sbjct: 434 SALSYYDALRTERLPAALIQGLRDYFGAHTYGRID--AEP 471


>gi|50955312|ref|YP_062600.1| 6-phosphogluconate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951794|gb|AAT89495.1| 6-phosphogluconate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 486

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/475 (40%), Positives = 279/475 (58%), Gaps = 6/475 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           QA+IG++GL  MGSNL+ N+  + G  +AVYN+ F  T+  +   +      + +++++ 
Sbjct: 7   QANIGVVGLAVMGSNLARNLASREGNTVAVYNRTFARTEDLVG--AHPEAGFVASESIDD 64

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++  PR  ++MV  G   D +ID+L     P DI++DGGN++F DT  R  ++S  G
Sbjct: 65  FVASLATPRTAIIMVQAGKGTDAVIDQLVERFEPGDIIVDGGNANFLDTIEREKRVSATG 124

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++F+G G+SGG +GA  G S+M GG  ++Y  +  IL SI+A  +  PC   +G DG+GH
Sbjct: 125 VHFVGAGISGGEEGALKGPSIMPGGTAESYKTLGPILASIAAIAEGEPCVTHIGTDGAGH 184

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKMIHNGIEYA+MQLIA+ Y +LR      P  I+ +F++W+TG L SYLI+ITA++L 
Sbjct: 185 FVKMIHNGIEYADMQLIAEAYDLLRMVGGLEPAAIADVFAEWNTGSLESYLIEITAKVLR 244

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P +D++ D+A  KGTG+ ++     L   +     A+FAR +S    +   +
Sbjct: 245 QVDAETGKPFVDIVLDQAGSKGTGVWTVQNALDLGIPVGGIAEAVFARAVSSKPAQRTAV 304

Query: 302 QSFFN--PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
           Q      P +  P +   +F  D+  ALYAS I+++ QGF  I   +EKY W L    IA
Sbjct: 305 QRVITSRPEAQRP-EDLAAFADDVSKALYASKIVAYAQGFDAIVAGAEKYGWKLDKDKIA 363

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +IWR GCIIR+Q L  I  +  E+     LL  P  ++ +++   + RRIV T   +G P
Sbjct: 364 KIWRGGCIIRAQFLGRIADAYEENADIATLLEAPYFADALREGEAAWRRIVATAALSGVP 423

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           VP   AALSY+D+    R  A L+Q QRDFFG+H + R DK    H  W    TE
Sbjct: 424 VPGFGAALSYYDSLASGRLPAALVQGQRDFFGAHTYKRVDKDGTFHTLWSGDRTE 478


>gi|160863316|gb|ABX51883.1| 6-phosphogluconate dehydrogenase [Cronobacter sakazakii]
          Length = 468

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/471 (39%), Positives = 286/471 (60%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++V+N+  + T+  I +  G  +K++    ++
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSRDKTEEVIAENPG--KKLVPYYTVQ 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  G   D  ID LKP L   DI++DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLETPRRILLMVKAGAGTDAAIDSLKPYLEKGDIIIDGGNTFFQDTIRRNRELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+A  +  PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAVAEGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  LN +  +++  F++W+ G+LSSYLI IT +I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKHGLNLSNEDLAKTFAEWNEGELSSYLIDITKDIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D   G  ++DVI D+A+ KGTG  +      L   +++   ++FAR +S  +++   
Sbjct: 239 TKKDE-DGNYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKEQRVA 297

Query: 301 MQSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P       F++ +  ALY   I+S+ QGF  +  +SE+Y+W L+   IA
Sbjct: 298 ASKVLSGPQAKPFAGDKGEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGQIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E+PS  NLL  P   +       +LR +V    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITDAYAENPSIANLLLAPYFKKAADDYQQALRDVVAYAVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+ SAA++Y+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 418 TPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWME 468


>gi|203284467|ref|YP_002222207.1| phosphogluconate dehydrogenase, decarboxylating (gnd) [Borrelia
           duttonii Ly]
 gi|201083910|gb|ACH93501.1| phosphogluconate dehydrogenase, decarboxylating (gnd) [Borrelia
           duttonii Ly]
          Length = 464

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 294/473 (62%), Gaps = 18/473 (3%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-----KKISGLSQKVIVTKNL 59
           DIGI GLG MGSNL+LNI D GF + VYN+D E T+VF+     KKISG+S       ++
Sbjct: 2   DIGIYGLGVMGSNLALNIADNGFNVYVYNRDNEKTEVFLANNSHKKISGVS-------DI 54

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E  + ++ KPRKI++MV++   VD++I+++ P +   DI++DGGNS++ DT  R  +LS 
Sbjct: 55  ETFIRSLKKPRKIILMVSNS-AVDEVIEQILPFVEKFDIIIDGGNSYYKDTIRREQELSS 113

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDG 178
           + IYF+G+G+SGG +GAR GAS M GGN+KAY  +E IL  I+AK  +   C A LG DG
Sbjct: 114 RDIYFVGLGISGGERGARFGASFMYGGNKKAYELIEPILNKIAAKTNEGDVCSAYLGKDG 173

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
            GH+VKM+HNGIEYA+MQLI + Y  ++ + N + L I+ +F KW  G+LSSYLI+IT++
Sbjct: 174 VGHYVKMVHNGIEYADMQLIGEAYFFMKRAFNLDNLRIAEVFDKWSEGELSSYLIEITSK 233

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           IL   +      +ID I D A+QKGTG    IE   L+    +   ++FAR+LS+ + E 
Sbjct: 234 ILKYKEN--NEYLIDKILDVANQKGTGKWVSIEALHLNVPANLIFESMFARSLSILKHER 291

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                       F       ++ DL  +L  + IL+++QGF ++  +S  Y W L+L  I
Sbjct: 292 VIASDILKMDVDFVEFDLSDWILDLYYSLLVAKILAYSQGFMILKNASANYLWDLNLGKI 351

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           + IWR GCII+S  L+ I  +  ++P   NLL      + +K    SLRRIV   +E G 
Sbjct: 352 SLIWREGCIIKSVFLDKIKLAYDKNPHLINLLFDDYFLDIIKNHHKSLRRIVSKASEIGI 411

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD--KISEPHGPWQ 469
           P+P+  A+LS+ D++  +   ANLIQAQRDFFG+H F+R D  +    H  W+
Sbjct: 412 PLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFERIDSNRGEFFHSSWE 464


>gi|296394191|ref|YP_003659075.1| 6-phosphogluconate dehydrogenase, decarboxylating [Segniliparus
           rotundus DSM 44985]
 gi|296181338|gb|ADG98244.1| 6-phosphogluconate dehydrogenase, decarboxylating [Segniliparus
           rotundus DSM 44985]
          Length = 479

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/473 (40%), Positives = 287/473 (60%), Gaps = 4/473 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG+ GLG MG+NL+ N+   G  +A++N+    TD  ++   G     + T+ + + 
Sbjct: 7   KAQIGVTGLGVMGANLARNLARHGHTVALHNRSPGRTDALLQA-HGSEGSFVRTETIREF 65

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           ++A+ +PR+ L+MV  G   D +I++L   +   DI++DGGNS F DT  R   L E+G+
Sbjct: 66  LDALERPRRALIMVQAGAATDAVIEQLAEEMEQGDIIIDGGNSLFTDTVRREAALRERGL 125

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G+GVSGG  GA  G S+M GG  ++Y  +  +L SISA     PCC  +GPDG+GHF
Sbjct: 126 HFVGMGVSGGEVGALEGPSIMPGGPAESYKSLGPLLESISAHVDGVPCCTHIGPDGAGHF 185

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY++MQ+IA+ Y +L+D L+ +  +I+ +F +W+T  L SYLI+ITAE+LS 
Sbjct: 186 VKMVHNGIEYSDMQVIAEAYQLLKDVLDLSADQIADIFREWNTTDLESYLIEITAEVLSH 245

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS  R + K   
Sbjct: 246 KDPRTGKPLVDVIVDEAEQKGTGRWTVQSALDLGIPVTGIAEAVFARALSGSRAQRKAAV 305

Query: 303 SFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
              + P +  P    + FV+D+  AL+AS I+++ QGF  I   S+++ W +    +A I
Sbjct: 306 RLTSGPLAEKP--DTEGFVEDVRQALFASKIVAYAQGFDQIKAGSDEHGWGVKPGDLATI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++   DP   NLL  P  ++ V+K + S R++V T    G P P
Sbjct: 364 WRGGCIIRARFLNKIKEAYDTDPDLPNLLLAPYFTDAVEKALGSWRKVVSTAVGLGIPAP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           S S+ L+Y+D     R  A+LIQ  RD+FGSH + R D   + H  W    +E
Sbjct: 424 SFSSTLAYYDGLRAKRLPASLIQGLRDYFGSHTYARVDDEGKWHTLWSADGSE 476


>gi|295084541|emb|CBK66064.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           xylanisolvens XB1A]
          Length = 491

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/464 (43%), Positives = 298/464 (64%), Gaps = 6/464 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTD--VFIKKISGLSQKVIVT--KN 58
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+     +  V  + ++G ++   +    +
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVGRFMNGRAKGKNIEGFTD 65

Query: 59  LEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLS 118
           ++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT  R     
Sbjct: 66  IKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTNRRVKLAE 125

Query: 119 EKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPD 177
            KG  F+G GVSGG +GA +GAS+M GG+EKA+  V+ IL SI+AK  + +PCC  +GP 
Sbjct: 126 SKGFLFVGSGVSGGEEGALNGASIMPGGSEKAWPEVKPILQSIAAKAPDGTPCCQWVGPA 185

Query: 178 GSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA 237
           GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL SYLI+ITA
Sbjct: 186 GSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLRSYLIEITA 245

Query: 238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
            IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R+LS  +D 
Sbjct: 246 NILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFERSLSAQKDL 304

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                  +      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ + W L LA+
Sbjct: 305 RHLASRQYQCQHTQPIYNKVELVKNIFSALYASKLVSYAQGFAVLQRASDAFDWHLDLAS 364

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +V    +  
Sbjct: 365 IARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKNLVAEAMKEE 424

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
            PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 425 LPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|183598283|ref|ZP_02959776.1| hypothetical protein PROSTU_01669 [Providencia stuartii ATCC 25827]
 gi|188020454|gb|EDU58494.1| hypothetical protein PROSTU_01669 [Providencia stuartii ATCC 25827]
          Length = 468

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/472 (40%), Positives = 289/472 (61%), Gaps = 10/472 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  + TD  I +  G  +K++ +  +E
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSKDKTDEVIAENPG--KKLVPSYTIE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G+  D+ I  L P L   DIL+DGGN+ + DT  R+ +LSE+
Sbjct: 59  EFVDSLEKPRRILLMVKAGEATDKTIAALTPHLDKGDILIDGGNTLYKDTIRRNRELSEQ 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+AK +  PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAKAEGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+ +LN +   ++ +F+ W+ G+LSSYLI+ITA+I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKGALNLSNEALAEIFADWNQGELSSYLIEITADIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
              D   G   +DVI D+A+ KGTG  +      L   +T+   ++FAR +S  +D+   
Sbjct: 239 KKKDE-DGKYFVDVILDEAANKGTGKWTSQSSLDLGIPVTLITESVFARYISFLKDQRVA 297

Query: 301 MQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
                   +   LK  +     F++ +  ALY   I+S+ QGF  +  +S++Y+W L+  
Sbjct: 298 ASKVLTGPA---LKAVEGDKKQFIEKVRRALYLGKIVSYAQGFQQLKAASDEYNWDLNYG 354

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            IA+I+RAGCIIR+Q L  I  +  E+    NLL  P   +   +   +LR +V    +N
Sbjct: 355 EIAKIFRAGCIIRAQFLQKITDAYNENAQIANLLLAPYFKQIADEYQQALRDVVCYGVQN 414

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G P P+ SAA+SY+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 415 GIPTPTFSAAISYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEW 466


>gi|237716159|ref|ZP_04546640.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           D1]
 gi|262407771|ref|ZP_06084319.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_22]
 gi|294647248|ref|ZP_06724846.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           ovatus SD CC 2a]
 gi|294809636|ref|ZP_06768328.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           xylanisolvens SD CC 1b]
 gi|229443806|gb|EEO49597.1| 6-phosphogluconate dehydrogenase,decarboxylating [Bacteroides sp.
           D1]
 gi|262354579|gb|EEZ03671.1| 6-phosphogluconate dehydrogenase [Bacteroides sp. 2_1_22]
 gi|292637428|gb|EFF55848.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           ovatus SD CC 2a]
 gi|294443179|gb|EFG11954.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Bacteroides
           xylanisolvens SD CC 1b]
          Length = 491

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/472 (43%), Positives = 302/472 (63%), Gaps = 22/472 (4%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFE-----LTDVFI------KKISGLSQ 51
           + DIG+IGL  MG NL+LN+  KG+ ++VYN+        + D F+      K I G + 
Sbjct: 6   KTDIGLIGLAVMGENLALNMESKGWHVSVYNRTVPGVEEGVVDRFMNGRAKGKNIEGFT- 64

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
                 +++  V+++  PRKI+MMV  G PVD+L+D+L PLLSP DIL+DGGNS++ DT 
Sbjct: 65  ------DIKAFVDSIAIPRKIMMMVRAGSPVDELMDQLFPLLSPGDILIDGGNSNYEDTN 118

Query: 112 IRSLQLSE-KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SP 169
            R ++L+E KG  F+G GVSGG +GA +GAS+M GG+E+A+  V+ IL SI+AK  + +P
Sbjct: 119 -RRVKLAESKGFLFVGSGVSGGEEGALNGASIMPGGSEQAWPEVKPILQSIAAKAPDGTP 177

Query: 170 CCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLS 229
           CC  +GP GSGHFVKMIHNGIEY +MQLIA+ Y +++  L+    E++ +F++W+ GKL 
Sbjct: 178 CCQWVGPAGSGHFVKMIHNGIEYGDMQLIAEAYWVMKKLLDLTNEEMADVFARWNEGKLR 237

Query: 230 SYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFAR 289
           SYL++ITA IL   D  +G  +ID I D A QKGTG  S+I   +L   + +  TA+F R
Sbjct: 238 SYLVEITANILRHKDK-SGGYLIDKILDAAGQKGTGKWSVINAMELGMPLGLIATAVFER 296

Query: 290 NLSLYRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
           +LS  +D        +      P+      VK++ +ALYAS ++S+ QGF V+ ++S+ +
Sbjct: 297 SLSAQKDLRHLASRQYQCQHTQPIYNKVELVKNIFSALYASKLVSYAQGFAVLQRASDAF 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W L LA+IAR+WR GCIIRS  LNDI  +        +LL  P   E++K  +P  + +
Sbjct: 357 DWHLDLASIARMWRGGCIIRSIFLNDIAAAFEATDKPKHLLLAPYFKEEMKTLLPGWKNL 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKI 461
           V    +   PVP+ S+AL+YF +       ANL+QAQRD+FG+H F+RKD++
Sbjct: 417 VAEAMKEELPVPAFSSALNYFYSLTSADLPANLVQAQRDYFGAHTFERKDEL 468


>gi|156933376|ref|YP_001437292.1| 6-phosphogluconate dehydrogenase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531630|gb|ABU76456.1| hypothetical protein ESA_01189 [Cronobacter sakazakii ATCC BAA-894]
 gi|160863330|gb|ABX51896.1| 6-phosphogluconate dehydrogenase [Cronobacter sakazakii]
          Length = 468

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/471 (39%), Positives = 286/471 (60%), Gaps = 4/471 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++V+N+  + T+  I +  G  +K++    ++
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSRDKTEEVIAENPG--KKLVPYYTVQ 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  G   D  ID LKP L   DI++DGGN+ F DT  R+ +LSE+
Sbjct: 59  EFVESLETPRRILLMVKAGAGTDAAIDSLKPYLEKGDIIIDGGNTFFQDTIRRNRELSEE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+A  +  PC   +GPDG+G
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKEIAAVAEGEPCVTYIGPDGAG 178

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY +MQLIA+ Y +L+  LN +  +++  F++W+ G+LSSYLI IT +I 
Sbjct: 179 HYVKMVHNGIEYGDMQLIAEAYSLLKHGLNLSNEDLAKTFAEWNEGELSSYLIDITKDIF 238

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           +  D   G  ++DVI D+A+ KGTG  +      L   +++   ++FAR +S  +++   
Sbjct: 239 TKKDE-DGNYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKEQRVA 297

Query: 301 MQSFFNPSSHFPLKCFD-SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                +     P       F++ +  ALY   I+S+ QGF  +  +SE+Y+W L+   IA
Sbjct: 298 ASKVLSGPQAKPFAGDKGEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E+PS  NLL  P   +       +LR +V    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITDAYAENPSIANLLLAPYFKKAADDYQQALRDVVAYAVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+ SAA++Y+D++      ANLIQAQRD+FG+H + R DK    H  W +
Sbjct: 418 TPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWME 468


>gi|260662466|ref|ZP_05863361.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           fermentum 28-3-CHN]
 gi|260553157|gb|EEX26100.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           fermentum 28-3-CHN]
          Length = 479

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/479 (39%), Positives = 297/479 (62%), Gaps = 19/479 (3%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + A IG+IGL  MG NL+LNI  +GF + VYN+  E TD  ++  S   +K++ +  +E 
Sbjct: 4   QTAQIGVIGLAVMGKNLALNIESRGFTVGVYNRHRERTDEMMRDHS--EKKLVPSYTIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ILMMV  G   D +I++L PLL   D+L+DGGN++F DT  R+ +L E G
Sbjct: 62  FVNSLEKPRRILMMVQAGKGTDAVINELLPLLDKGDVLIDGGNTNFHDTMARNAKLDESG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK ++  PC + +GP+G+G
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILTQIAAKAEDGKPCVSYIGPNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y ++R+ L  +  E++ +F++W+ G+L SYLI+ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEELIDESYNVMRNVLGLSVDEMADIFAEWNKGELDSYLIEITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +     +PI+D I D+ + KGTG  S        +  ++   A++AR +S+ +DE
Sbjct: 242 TRKDDLGDDKNLPIVDAILDRGANKGTGKWSSETALDGGAPQSVITEAVYARYISMLKDE 301

Query: 298 ----SKKMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
               SK++     P     +   D     +++ +  ALY   ++S+ QGF  +   SE+Y
Sbjct: 302 RVAASKEL-----PEDVEKVTLSDDEKKEYIEKVRQALYFGKVMSYAQGFEQMRIDSERY 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L    +A+IWR GCIIR+Q L  I  +  ++P+  NLL      +  KK   ++R +
Sbjct: 357 DWNLQYGELAQIWREGCIIRAQFLQKITDAFEKNPALKNLLLDDYFKDIAKKYQKAIREV 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSL+AA++Y+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 417 VALSVKAGIPVPSLAAAINYYDSYRAEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 475


>gi|167518822|ref|XP_001743751.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777713|gb|EDQ91329.1| predicted protein [Monosiga brevicollis MX1]
          Length = 484

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/461 (40%), Positives = 288/461 (62%), Gaps = 9/461 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           Q+DI +IGL  MG N  LN+ D GF++  YN+  E  D F+         V+   ++E+M
Sbjct: 5   QSDIALIGLAVMGQNFILNMNDHGFKVTAYNRTTEKVDRFMAN-EAAGTNVVGVHSIEEM 63

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PR+++++V  GD VD+ ID + P L   DI++DGGNS + D+  R   L EKGI
Sbjct: 64  VKSLKRPRRVMLLVKAGDVVDKFIDAIVPHLEKGDIIIDGGNSEYVDSNRRCKALEEKGI 123

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
            FIG GVSGG +GAR G SLM GG+  A+  V++I  + +AK  + PCC  +G +G+GH+
Sbjct: 124 LFIGTGVSGGEEGARYGPSLMPGGHPDAWPHVKDIFQACAAKADDEPCCDWVGKEGAGHY 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEY +MQL  + Y +++D+L  +  E+S +FS+W+ G+L S+LI+IT +IL+ 
Sbjct: 184 VKMVHNGIEYGDMQLCCEAYQLMKDALGMSCKEMSQVFSEWNKGELDSFLIEITRDILAF 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE----S 298
           +DT  G P+++ I DKA QKGTG  + I    L   +T+   ++FAR LS  + E    S
Sbjct: 244 NDT-DGEPLLEKILDKAGQKGTGKWTAISSLSLGMPVTLIGESVFARCLSALKSERTLAS 302

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
           K +Q    P+        D FV+ +  ALYAS I+S+ QGF ++ ++S+++ W L+   I
Sbjct: 303 KHLQG---PAERRYKGDKDEFVEHIRQALYASKIVSYAQGFMLMREASKEFGWELNYPAI 359

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCIIRS  L +I  +  ++P  TNL+     +  + +   S R +V      G 
Sbjct: 360 ALMWRGGCIIRSVFLGNIRDAFKKNPELTNLMLDDFFAAALHRCQESWRIVVSQAALLGI 419

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
           P P+ S AL+++D +  +R  ANLIQAQRD+FG+H ++R D
Sbjct: 420 PTPAFSTALAFYDGYRSERLPANLIQAQRDYFGAHTYERLD 460


>gi|312868589|ref|ZP_07728784.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           oris PB013-T2-3]
 gi|311095886|gb|EFQ54135.1| phosphogluconate dehydrogenase (decarboxylating) [Lactobacillus
           oris PB013-T2-3]
          Length = 478

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/473 (39%), Positives = 293/473 (61%), Gaps = 10/473 (2%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A IG++GL  MG NL+LNI  +GF + VYN+    TD  +K  S   +K++ +  ++  
Sbjct: 5   KAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDEMMKDHS--DKKLVPSYTIKDF 62

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ KPR+IL+MV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + GI
Sbjct: 63  VDSLEKPRRILLMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFHDTMERNAKLDKSGI 122

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS--PCCALLGPDGSG 180
            FIG+GVSGG  GA  G +LM GG ++AY+ V  IL  I+AK +    PC A +GP+G+G
Sbjct: 123 NFIGMGVSGGELGALHGPALMPGGQKEAYDLVAPILTQIAAKAEEDGKPCVAYIGPNGAG 182

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y I+R+ L     +I+  F++W+ G+LSSYL+ ITA+IL
Sbjct: 183 HYVKMVHNGIEYGDEELIDESYNIMRNVLKMPVDDIAKTFAEWNKGELSSYLVDITADIL 242

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +DE
Sbjct: 243 TRKDDLGDDKSKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKDE 302

Query: 298 SKKMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
                    P     +   D    ++ +  ALY   ++S+ QGF  +   S++Y W+L +
Sbjct: 303 RVAASKVL-PEVTDSISIDDKKEMIEKVRQALYFGKVMSYAQGFEQMRIDSDRYGWNLKM 361

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             +A+IWRAGCIIR+Q L +I  +  ++P   NLL      +  KK   ++R +V    +
Sbjct: 362 GELAQIWRAGCIIRAQFLQNITDAFDKNPDLKNLLLDDYFKDIAKKYQKAIRDVVALAVK 421

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            G PVPS+SAA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 422 AGIPVPSMSAAISYYDSYRAEVLPANLLQAQRDYFGAHTYERVDRPGNYHYSW 474


>gi|257896997|ref|ZP_05676650.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium Com12]
 gi|257833562|gb|EEV59983.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium Com12]
          Length = 473

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQISAKAEDGAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ L+ +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILDLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +S+++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKELVEKIREALYFSKIMSYAQGFAQLRVASKEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYEKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|116511415|ref|YP_808631.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107069|gb|ABJ72209.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Lactococcus
           lactis subsp. cremoris SK11]
          Length = 472

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 285/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + ++ TK LE
Sbjct: 1   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKEHQ--DKNLVFTKTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDKGDILIDGGNTHFPDTMRRNAELADS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 119 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKE 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 239 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+  F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 299 VKASKVLSGPALDFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 358 IAQIWRAGCIIRAEFLQNITDAFNKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 418 IPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 468


>gi|295835459|ref|ZP_06822392.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces sp.
           SPB74]
 gi|197696449|gb|EDY43382.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces sp.
           SPB74]
          Length = 479

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/468 (39%), Positives = 281/468 (60%), Gaps = 5/468 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   +++  G     + T++ E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARHGYTVALHNRTAAKTHALVEEF-GEEGAFVPTESAEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +I +  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVVMVKAGEATDAVIAEFAPLLEEGDMIVDGGNAHFADTRRRERELRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA  G S+M GG++++Y  +  +L  I+A+ ++ SPC   +GPDG+GHF
Sbjct: 124 FVGTGISGGEEGALHGPSIMPGGSKESYASLGPMLEKIAAQAEDGSPCVTHIGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLI + Y +LRD    +P  I+ +F  W+TG+L SYLI+ITAE+L  
Sbjct: 184 VKMVHNGIEYADMQLIGEAYQLLRDVAGYSPARIADVFRTWNTGRLDSYLIEITAEVLQH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +DV+ D A QKGTG  ++     L   ++    A+FAR LS +    +   
Sbjct: 244 TDPKTGKPFVDVVADAAEQKGTGRWTVQIALDLGVPVSGIAEAVFARGLSGHTALREASG 303

Query: 303 SFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
               P+   PL+  ++  F   +E ALYAS I+S+TQGF  I     +Y W + +  +A 
Sbjct: 304 HLSGPTPE-PLEEAEAARFADRVEQALYASKIVSYTQGFHEIAAGGAEYDWDIDIGAVAS 362

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIR+  L+ I  +  ++P   +LL+ P  + +V+      R +V T    G P 
Sbjct: 363 IWRAGCIIRAAFLDRITAAYAKEPGLPSLLSDPRFASEVEGAQDDWRDVVATAVRQGVPT 422

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           P  S AL+Y+D     R  A L Q QRD+FG+H + R D+    H  W
Sbjct: 423 PGFSTALAYYDALRAPRLPAALTQGQRDYFGAHTYQRADREGTFHTLW 470


>gi|184156237|ref|YP_001844577.1| 6-phosphogluconate dehydrogenase [Lactobacillus fermentum IFO 3956]
 gi|183227581|dbj|BAG28097.1| 6-phosphogluconate dehydrogenase [Lactobacillus fermentum IFO 3956]
 gi|299783686|gb|ADJ41684.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           fermentum CECT 5716]
          Length = 479

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/479 (39%), Positives = 297/479 (62%), Gaps = 19/479 (3%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           + A IG+IGL  MG NL+LNI  +GF + VYN+  E TD  ++  S   +K++ +  +E 
Sbjct: 4   QTAQIGVIGLAVMGKNLALNIESRGFTVGVYNRHRERTDEMMRDHS--EKKLVPSYTIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V ++ KPR+ILMMV  G   D +I++L PLL   D+L+DGGN++F DT  R+ +L E G
Sbjct: 62  FVNSLEKPRRILMMVQAGKGTDAVINELLPLLDKGDVLIDGGNTNFHDTMARNAKLDESG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK ++  PC + +GP+G+G
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILTQIAAKAEDGKPCVSYIGPNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y ++R+ L  +  E++ +F++W+ G+L SYL++ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEELIDESYNVMRNVLGLSVDEMADIFAEWNKGELDSYLVEITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +     +PI+D I D+ + KGTG  S        +  ++   A++AR +S+ +DE
Sbjct: 242 TRKDDLGDDKNLPIVDAILDRGANKGTGKWSSETALDGGAPQSVITEAVYARYISMLKDE 301

Query: 298 ----SKKMQSFFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKY 349
               SK++     P     +   D     +++ +  ALY   ++S+ QGF  +   SE+Y
Sbjct: 302 RVAASKEL-----PEDVEKVTLSDDEKKEYIEKVRQALYFGKVMSYAQGFEQMRIDSERY 356

Query: 350 SWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRI 409
            W+L    +A+IWR GCIIR+Q L  I  +  ++P+  NLL      +  KK   ++R +
Sbjct: 357 DWNLQYGELAQIWREGCIIRAQFLQKITDAFEKNPALKNLLLDDYFKDIAKKYQKAIREV 416

Query: 410 VVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           V    + G PVPSL+AA++Y+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 417 VALSVKAGIPVPSLAAAINYYDSYRAEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 475


>gi|227550601|ref|ZP_03980650.1| phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium TX1330]
 gi|257888625|ref|ZP_05668278.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,141,733]
 gi|257898938|ref|ZP_05678591.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium Com15]
 gi|293378689|ref|ZP_06624847.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium PC4.1]
 gi|293571127|ref|ZP_06682166.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E980]
 gi|227180309|gb|EEI61281.1| phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium TX1330]
 gi|257824679|gb|EEV51611.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium 1,141,733]
 gi|257836850|gb|EEV61924.1| 6-phosphogluconate dehydrogenase [Enterococcus faecium Com15]
 gi|291608809|gb|EFF38092.1| 6-phosphogluconate dehydrogenase, decarboxylating [Enterococcus
           faecium E980]
 gi|292642617|gb|EFF60769.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Enterococcus
           faecium PC4.1]
          Length = 473

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/471 (40%), Positives = 291/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T   +++    + K   T  +E
Sbjct: 1   MSKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGAKTTAVVEEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVESIEKPRRILLMVKAGPATDATIQELLPHLDKGDILIDGGNTFFKDTMRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQISAKAEDGAPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ L+ +  E++ +F +W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMKNILDLSVEEMADIFKEWNQGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG P++DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDEGTGKPVVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFFNPSSHFPLKC-FDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            +     + ++ F         V+ +  ALY S I+S+ QGF  +  +S+++ W L    
Sbjct: 299 VQASKILSRTNDFEFTGDKKELVEKIREALYFSKIMSYAQGFAQLRVASKEFDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L  I  +  ++P   NLL      E  KK   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRARFLQKITDAYDKNPEIENLLLDDYFVEITKKYQQSVRDVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  +R  AN+IQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRAERLPANIIQAQRDYFGAHTYERVDKEGIFHYSW 469


>gi|218699382|ref|YP_002407011.1| 6-phosphogluconate dehydrogenase [Escherichia coli IAI39]
 gi|218369368|emb|CAR17126.1| gluconate-6-phosphate dehydrogenase, decarboxylating [Escherichia
           coli IAI39]
          Length = 468

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 285/469 (60%), Gaps = 4/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  E T+  I +  G  +K++    ++
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPG--KKLVPYYTVK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  G   D  ID LKP L   DI++DGGN+ F DT  R+ +LS +
Sbjct: 59  EFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+A  ++  PC   +G DG+
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAQILTKIAAVAEDGEPCVTYIGADGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+  LN +  E++  F++W+ G+LSSYLI IT +I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLSNEELAQTFTEWNNGELSSYLIDITKDI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            +  D   G  ++DVI D+A+ KGTG  +      L   +++   ++FAR +S  +D+  
Sbjct: 239 FTKKDE-DGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRV 297

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                 +     P    D F++ +  ALY   I+S+ QGF  +  +SE+Y+W L+   IA
Sbjct: 298 AASKVLSGPQAQPAGDKDEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E+P   NLL  P   +       +LR +V    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ +AA++Y+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 418 VPTFAAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW 466


>gi|297626013|ref|YP_003687776.1| 6-phosphogluconate dehydrogenase, decarboxylating
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|76556235|emb|CAD48943.1| 6-phosphogluconic dehydrogenase 1 [Propionibacterium freudenreichii
           subsp. shermanii]
 gi|296921778|emb|CBL56336.1| 6-phosphogluconate dehydrogenase, decarboxylating
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 485

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/474 (39%), Positives = 285/474 (60%), Gaps = 3/474 (0%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +A+IG++G+  MGSNL+ N+    + +AV+N+ +  T   I +  G     I ++ +E  
Sbjct: 11  KANIGVVGMAVMGSNLARNLAHHDYTVAVFNRTYARTQKLIAE-HGNEGSFIPSEKIEDF 69

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V ++  PR I++MV  G P D  ID+L PLLSP DI++DGGNS+F DT  R   ++ KG 
Sbjct: 70  VNSIATPRSIILMVKAGAPTDATIDELLPLLSPGDIIMDGGNSYFGDTIRREKAIAAKGF 129

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHF 182
           +F+G G+SGG  GA  G S+M GG+ ++Y  +  +L +ISA Y   PCCA +GP+G+GHF
Sbjct: 130 HFVGAGISGGETGALEGPSIMPGGSPESYKILGPMLETISAHYHGDPCCAWMGPNGAGHF 189

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKMIHNGIEY++MQ+I + Y +LR  +     E + +F++W+ G L SYLI+IT+ +L  
Sbjct: 190 VKMIHNGIEYSDMQVIGEAYELLR-GVGLTNAECADVFAEWNKGDLDSYLIEITSIVLRQ 248

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG  +IDVI D+A  KGTG  ++    +L         A+FAR  S + D     +
Sbjct: 249 KDPRTGADLIDVIKDRAQMKGTGTWTVQTALELGVPTNGIAEAVFARAESSHDDLRAAAR 308

Query: 303 SFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
            +   P     +    +F++D+  AL+ S ++S+ QGF  I    ++Y W++++A  A+I
Sbjct: 309 KYLAGPDGTVSVDDRTAFIEDVRKALWCSKVVSYAQGFDEIRTGGQEYDWNINVAEAAKI 368

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WRAGCIIR+++L  I ++ T+DP   +L+   S+S +++    + RR+V    E+G P P
Sbjct: 369 WRAGCIIRAKLLERIRQAYTDDPDLVSLMAASSVSAEMEANQSAWRRVVSKAAESGVPAP 428

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
             SA L+Y+D     R  A L QA RD+FGSH ++R D     H  W    +E+
Sbjct: 429 VFSATLAYYDMARAPRVNAALTQAMRDYFGSHTYERVDDHGHFHIEWTGDHSET 482


>gi|62390335|ref|YP_225737.1| 6-phosphogluconate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|21324220|dbj|BAB98845.1| 6-phosphogluconate dehydrogenase, family 1 [Corynebacterium
           glutamicum ATCC 13032]
 gi|41325672|emb|CAF21461.1| 6-PHOSPHOGLUCONATE DEHYDROGENASE [Corynebacterium glutamicum ATCC
           13032]
          Length = 492

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 282/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  + TD  I    G     I +  +E+ V
Sbjct: 16  AQIGVVGLAVMGSNLARNFARNGNTVAVYNRSTDKTDKLIAD-HGSEGNFIPSATVEEFV 74

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G+  D +I++L   +   DI++DGGN+ + DT  R  ++S +G++
Sbjct: 75  ASLEKPRRAIIMVQAGNATDAVINQLADAMDEGDIIIDGGNALYTDTIRREKEISARGLH 134

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  K+Y  +  +L SI+A    +PC   +GPDG+GHFV
Sbjct: 135 FVGAGISGGEEGALNGPSIMPGGPAKSYESLGPLLESIAANVDGTPCVTHIGPDGAGHFV 194

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F +W+ G L SYLI+ITAE+LS  
Sbjct: 195 KMVHNGIEYADMQVIGEAYHLLRYAAGMQPAEIAEVFKEWNAGDLDSYLIEITAEVLSQV 254

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P+IDVI D A QKGTG  ++     L  + T    A+FAR LS    +    Q 
Sbjct: 255 DAETGKPLIDVIVDAAGQKGTGRWTVKAALDLGIATTGIGEAVFARALSGATSQRAAAQG 314

Query: 304 FFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                    L+        FV+D+  ALYAS ++++ QGF  I   S++ +W +    +A
Sbjct: 315 NLPAGVLTDLEALGVDKAQFVEDVRRALYASKLVAYAQGFDEIKAGSDENNWDVDPRDLA 374

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN IV++   +    +LL  P    ++   I S RR++VT T+ G P
Sbjct: 375 TIWRGGCIIRAKFLNRIVEAYDANAELESLLLDPYFKSELGDLIDSWRRVIVTATQLGLP 434

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           +P  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 435 IPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRIDKDGSFHTEWSGDRSE 489


>gi|238632076|gb|ACR50761.1| 6-phosphogluconate 1-dehydrogenase [Streptomyces longisporoflavus]
          Length = 479

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 280/467 (59%), Gaps = 3/467 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    GF +A++N+    T   +++  G     +   + E+ V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGFTVALHNRTASKTHALVEEF-GEEGAFVAADSAEEFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  GD  D +I +  PLL   D+++DGGN+HF DT+ R  +L E+GI+
Sbjct: 64  AALERPRRLVIMVKAGDATDAVIQEFAPLLEEGDVIIDGGNAHFADTRRREKELRERGIH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDGSGHF 182
           F+G+G+SGG +GA  G S+M GG++++Y  +  +L  I+AK   ++P  A +GPDG+GHF
Sbjct: 124 FVGVGISGGEEGALHGPSIMPGGSKESYESLGPLLERIAAKAPDDTPTVAHIGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM+HNGIEYA+MQLIA+ Y +LR     +P +I+  F  W+TG+L SYLI+ITAE+L+ 
Sbjct: 184 VKMVHNGIEYADMQLIAEAYHLLRAVAGYSPEKIAETFRTWNTGRLDSYLIEITAEVLAH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
            D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR+LS +       Q
Sbjct: 244 QDAATGKPFVDVVVDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSLSGHAALRDVSQ 303

Query: 303 SFFNP-SSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
           +   P ++    +    F   +E ALYAS I+S+TQGF  I   SE+Y W++ L ++A I
Sbjct: 304 TLPGPTATALSEEEAARFADRVEQALYASKIVSYTQGFHQIQAGSEEYGWNIDLGSVAAI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WRAGCIIR+  L+ I  +        +LL     +E++       R ++ T    G P P
Sbjct: 364 WRAGCIIRAAFLDRIRGAYDAQRDLPSLLADKQFAEEIGAAQDDWREVIATAVRQGVPTP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
             +AALSY+D    +R  A L Q QRDFFG+H + R D+    H  W
Sbjct: 424 GFAAALSYYDALRAERLPAALTQGQRDFFGAHTYRRTDREGSFHTLW 470


>gi|203288001|ref|YP_002223016.1| phosphogluconate dehydrogenase, decarboxylating (gnd) [Borrelia
           recurrentis A1]
 gi|201085221|gb|ACH94795.1| phosphogluconate dehydrogenase, decarboxylating (gnd) [Borrelia
           recurrentis A1]
          Length = 464

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 293/473 (61%), Gaps = 18/473 (3%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI-----KKISGLSQKVIVTKNL 59
           DIGI GLG MGSNL+LNI D GF + VYN+D E T+VF+     KKISG+S       ++
Sbjct: 2   DIGIYGLGVMGSNLALNIADNGFNVYVYNRDNEKTEVFLANNSHKKISGVS-------DI 54

Query: 60  EQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSE 119
           E  + ++ KPRKI++MV++   VD++I+++ P +   DI++DGGNS++ DT  R  +LS 
Sbjct: 55  ETFIRSLKKPRKIILMVSNS-AVDEVIEQILPFVEKFDIIIDGGNSYYKDTIRREQELSS 113

Query: 120 KGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY-QNSPCCALLGPDG 178
           + IYF+G+G+SGG +GAR GAS M GGN+KAY  +E IL  I+AK  +   C A LG DG
Sbjct: 114 RDIYFVGLGISGGERGARFGASFMYGGNKKAYELIEPILNKIAAKTNEGDVCSAYLGKDG 173

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
            GH+VKM+HNGIEYA+MQLI + Y  ++ + N + L I+ +F KW  G+LSSYLI+IT++
Sbjct: 174 VGHYVKMVHNGIEYADMQLIGEAYFFMKRAFNLDNLRIAEVFDKWSEGELSSYLIEITSK 233

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           IL   +      +ID I D A+QKGTG    IE   L+    +   ++FAR LS+ + E 
Sbjct: 234 ILKYKEN--NEYLIDKILDVANQKGTGKWVSIEALHLNVPANLIFESMFARFLSILKHER 291

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                       F       ++ DL  +L  + IL+++QGF ++  +S  Y W L+L  I
Sbjct: 292 VIASDILKMDVDFVEFDLSDWILDLYYSLLVAKILAYSQGFMILKNASANYLWDLNLGKI 351

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           + IWR GCII+S  L+ I  +  ++P   NLL      + +K    SLRRIV   +E G 
Sbjct: 352 SLIWREGCIIKSVFLDKIKLAYDKNPHLINLLFDDYFLDIIKNHHKSLRRIVSKASEIGI 411

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD--KISEPHGPWQ 469
           P+P+  A+LS+ D++  +   ANLIQAQRDFFG+H F+R D  +    H  W+
Sbjct: 412 PLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFERIDSNRGEFFHSSWE 464


>gi|19552667|ref|NP_600669.1| 6-phosphogluconate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
          Length = 484

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 282/475 (59%), Gaps = 5/475 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG++GL  MGSNL+ N    G  +AVYN+  + TD  I    G     I +  +E+ V
Sbjct: 8   AQIGVVGLAVMGSNLARNFARNGNTVAVYNRSTDKTDKLIAD-HGSEGNFIPSATVEEFV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ KPR+ ++MV  G+  D +I++L   +   DI++DGGN+ + DT  R  ++S +G++
Sbjct: 67  ASLEKPRRAIIMVQAGNATDAVINQLADAMDEGDIIIDGGNALYTDTIRREKEISARGLH 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G G+SGG +GA +G S+M GG  K+Y  +  +L SI+A    +PC   +GPDG+GHFV
Sbjct: 127 FVGAGISGGEEGALNGPSIMPGGPAKSYESLGPLLESIAANVDGTPCVTHIGPDGAGHFV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEYA+MQ+I + Y +LR +    P EI+ +F +W+ G L SYLI+ITAE+LS  
Sbjct: 187 KMVHNGIEYADMQVIGEAYHLLRYAAGMQPAEIAEVFKEWNAGDLDSYLIEITAEVLSQV 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D  TG P+IDVI D A QKGTG  ++     L  + T    A+FAR LS    +    Q 
Sbjct: 247 DAETGKPLIDVIVDAAGQKGTGRWTVKAALDLGIATTGIGEAVFARALSGATSQRAAAQG 306

Query: 304 FFNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                    L+        FV+D+  ALYAS ++++ QGF  I   S++ +W +    +A
Sbjct: 307 NLPAGVLTDLEALGVDKAQFVEDVRRALYASKLVAYAQGFDEIKAGSDENNWDVDPRDLA 366

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            IWR GCIIR++ LN IV++   +    +LL  P    ++   I S RR++VT T+ G P
Sbjct: 367 TIWRGGCIIRAKFLNRIVEAYDANAELESLLLDPYFKSELGDLIDSWRRVIVTATQLGLP 426

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
           +P  +++LSY+D+   +R  A LIQ QRDFFG+H + R DK    H  W    +E
Sbjct: 427 IPVFASSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRIDKDGSFHTEWSGDRSE 481


>gi|307152863|ref|YP_003888247.1| 6-phosphogluconate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306983091|gb|ADN14972.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cyanothece sp.
           PCC 7822]
          Length = 473

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/474 (40%), Positives = 295/474 (62%), Gaps = 12/474 (2%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
            G+IGL  MG NL+LN+  +GF +AVYN+ +E T+ F+    G  + ++  + LE+ V+A
Sbjct: 5   FGVIGLAVMGENLALNVESRGFPIAVYNRTYEKTEEFMN-TRGKGKDIVGPRTLEEFVQA 63

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           + +PRKIL+MV  G PVD +I +LKPLL   D+++DGGNS + DT+ R+ +L   G+ F+
Sbjct: 64  LERPRKILVMVKAGGPVDAVIQQLKPLLDEGDMIIDGGNSLYDDTERRTKELEPTGLGFV 123

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
           G+GVSGG +GA  G SLM GG E AY  +E IL +I+A+  + PC   +GP G+GH+VKM
Sbjct: 124 GMGVSGGEEGALHGPSLMPGGTEFAYRDLEPILKAIAAQVDDGPCVTYIGPGGAGHYVKM 183

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWD-TGKLSSYLIKITAEILSSSD 244
           +HNGIEY +MQLIA+ Y ILR  L  +  ++  +F++W+ T +L+SYLI+ITA+I    D
Sbjct: 184 VHNGIEYGDMQLIAEAYDILRYGLGLSNEQLHQIFAEWNTTDELNSYLIEITADIFKQKD 243

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
             T   ++D+I D A QKGTG  +++   +L   +     A+ AR +S Y+ E       
Sbjct: 244 PGTNEYLVDLILDSAGQKGTGRWTVLSSLELGVPIPTIYAAVNARVMSAYKAERVAASKE 303

Query: 305 FNPSSHFPLKCFD----SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
            N     P++ +D     FV  + +ALY S + S+ QG  +I K+S ++ ++++L   AR
Sbjct: 304 LNGR---PIR-YDGDTAGFVNKVRDALYCSKMCSYAQGMALIAKASAEFKYNINLPETAR 359

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IW+ GCIIR+  L+ I K+  E+P+  NLL  P   + +     + R +++   + G  V
Sbjct: 360 IWKGGCIIRAGFLDKIKKAYLENPNLPNLLLAPEFKQSILDRQEAWRDVLILANKIGIGV 419

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK-ISE-PHGPWQKVS 472
           P+ SA+L YFD++   R   NL QAQRD+FG+H ++R DK + E  H  W  VS
Sbjct: 420 PAFSASLDYFDSYRRSRLPQNLTQAQRDYFGAHTYERIDKPLGEFFHTEWAGVS 473


>gi|126030879|pdb|2IZ0|A Chain A, Pex Inhibitor-Home Data
 gi|126030880|pdb|2IZ0|B Chain B, Pex Inhibitor-Home Data
 gi|126030881|pdb|2IZ0|C Chain C, Pex Inhibitor-Home Data
 gi|126030882|pdb|2IZ1|A Chain A, 6pdh Complexed With Pex Inhibitor Synchrotron Data
 gi|126030883|pdb|2IZ1|B Chain B, 6pdh Complexed With Pex Inhibitor Synchrotron Data
 gi|126030884|pdb|2IZ1|C Chain C, 6pdh Complexed With Pex Inhibitor Synchrotron Data
          Length = 474

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 285/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + ++ TK LE
Sbjct: 3   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVFKEHQ--DKNLVFTKTLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 61  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADS 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 121 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 180

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 181 AGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKE 240

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 241 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 300

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+  F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 301 VKASKVLSGPALDFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 359

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 360 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 419

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 420 TPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 470


>gi|256833164|ref|YP_003161891.1| 6-phosphogluconate dehydrogenase, decarboxylating [Jonesia
           denitrificans DSM 20603]
 gi|256686695|gb|ACV09588.1| 6-phosphogluconate dehydrogenase, decarboxylating [Jonesia
           denitrificans DSM 20603]
          Length = 481

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/479 (38%), Positives = 291/479 (60%), Gaps = 16/479 (3%)

Query: 3   QADIGIIGLGSMGSNLSLNILDK-GFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           QA+IG++G+  MGSNL+ N+  + G  +A+YN+  +         +      +V +++++
Sbjct: 5   QANIGVVGMAVMGSNLARNLASREGNTVAIYNRSVDKARAVAD--AHPEAGFLVAESVQE 62

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
             +++ +PR  ++MV  G P D +I++L  +  P DI++DGGN+ F DT  R   + + G
Sbjct: 63  FADSLARPRTAIIMVKAGGPTDAVINQLVEVFEPGDIIVDGGNALFTDTIRREQAVRDTG 122

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           I+F+G G+SGG +GA +G S+M GG  ++Y  +  IL +I+A  +  PC   +G DG+GH
Sbjct: 123 IHFVGAGISGGEEGALNGPSIMPGGTAESYATLGPILATIAAVAEGEPCVTHVGTDGAGH 182

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKMIHNGIEYA+MQLIA+ Y +LR+    +  EI+ +F +W+ G+L SYLI+ITAE+L 
Sbjct: 183 FVKMIHNGIEYADMQLIAEAYDLLRNVAGLSAPEIADVFDEWNRGELESYLIEITAEVLR 242

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
             D  TG P++DVI D+A  KGTG+ ++     L   ++    A+FAR LS     SK  
Sbjct: 243 QVDAATGQPLVDVILDQAGSKGTGVWTVQTALGLGVPVSGIAEAVFARALS-----SKPA 297

Query: 302 QSFFNPSSHFP------LKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSL 355
           Q     S + P      +   D+F++D+  ALYAS I++++QGF  I + +++Y W +  
Sbjct: 298 QR--AASRNLPGGGTVTVDNRDAFIEDVRQALYASKIVAYSQGFDAIIEGAKEYGWDIKK 355

Query: 356 ATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTE 415
             IA+IWR GCIIR+Q LN I ++  +DP+   LL  P   + V +   + RR ++T  +
Sbjct: 356 GDIAKIWRGGCIIRAQFLNRITEAYAQDPNLVVLLAAPYFRDAVTQAQDAWRRTIITAVQ 415

Query: 416 NGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
            G P P+ S++L+Y+D    +R  A+L+Q QRDFFG+H + R D+    H  W    +E
Sbjct: 416 AGLPTPAFSSSLAYYDGLRAERLPASLVQGQRDFFGAHTYKRTDRDGTFHTLWSGDRSE 474


>gi|320007098|gb|ADW01948.1| 6-phosphogluconate dehydrogenase, decarboxylating [Streptomyces
           flavogriseus ATCC 33331]
          Length = 479

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/467 (38%), Positives = 283/467 (60%), Gaps = 3/467 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MG NL+ N    G+ +A++N+    T   +++  G     I T++ E  V
Sbjct: 5   AQIGVTGLAVMGRNLARNFARNGYTVALHNRTAARTRELVEQF-GDEGDFIATESAEDFV 63

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            A+ +PR++++MV  G+  D +I +  PLL P D+++DGGN+HF DT+ R  +L E+G++
Sbjct: 64  AALERPRRLVVMVKAGEATDAVIAEFAPLLEPGDVIIDGGNAHFADTRRRERELRERGLH 123

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGHF 182
           F+G G+SGG +GA  G S+M GG+ ++Y+ +  +L  ISAK ++ +PC   +GPDG+GHF
Sbjct: 124 FVGTGISGGEEGALDGPSIMPGGSRESYDSLGPMLEQISAKAKDGAPCVTHIGPDGAGHF 183

Query: 183 VKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSS 242
           VKM HNGIEYA+MQLI + Y +LRD    +P +I+ +F  W+TG+L SYLI+ITA++LS 
Sbjct: 184 VKMAHNGIEYADMQLIGEAYQLLRDVAGYSPAQIADIFRTWNTGRLDSYLIEITADVLSH 243

Query: 243 SDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           +D  TG P +DV+ D+A QKGTG  ++     L   ++    A+FAR++S +       +
Sbjct: 244 TDAATGKPFVDVVLDQAEQKGTGRWTVQIALDLGVPVSGIAEAVFARSVSGHAALRAASR 303

Query: 303 SFFNPSSHFPLK-CFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               P++    K    +F   +E ALYAS I+++TQGF  I   SE+Y W++ L  +A I
Sbjct: 304 HLAGPTARPRGKDEAAAFADQVEQALYASKIVAYTQGFHEIAAGSEQYDWNIDLGRVAAI 363

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR+  L+ I  +    P   +LL+    +E++       R ++ T    G P P
Sbjct: 364 WRGGCIIRAAFLDRITSAYEAQPRMPSLLSDKGFAEEIAAAQDDWRSVIATAVTQGVPTP 423

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + +  L+Y+D+   +R  A L Q QRD+FG+H + R D+    H  W
Sbjct: 424 AFATTLAYYDSLRAERLPAALTQGQRDYFGAHTYHRVDRDGTFHTLW 470


>gi|296122544|ref|YP_003630322.1| 6-phosphogluconate dehydrogenase, decarboxylating [Planctomyces
           limnophilus DSM 3776]
 gi|296014884|gb|ADG68123.1| 6-phosphogluconate dehydrogenase, decarboxylating [Planctomyces
           limnophilus DSM 3776]
          Length = 490

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 277/473 (58%), Gaps = 13/473 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI---------KKISGLSQ 51
           M Q DIG+IGL  MG NL LN+ + GF + VYN+    TD F+         K  +G   
Sbjct: 1   MSQHDIGLIGLAVMGQNLVLNMANHGFSVGVYNRTTATTDEFVGGLKNEPADKVHAGTID 60

Query: 52  KVIVTKNLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQ 111
           +V     LE  V+++  PR+I++MV  G PVD +ID+L+PLL   DI++DGGNS F DT 
Sbjct: 61  RVKGYHTLEDFVKSLKAPRRIMIMVKAGKPVDAVIDQLEPLLDKGDIIIDGGNSDFVDTN 120

Query: 112 IRSLQLSEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY---QNS 168
            R   L EKG+ FIG GVSGG +GA  G S+M GG+  A+  V++I  +ISAK     + 
Sbjct: 121 RRDKDLREKGLRFIGTGVSGGEEGALKGPSIMPGGHADAWPFVKDIFQAISAKVGPNNDI 180

Query: 169 PCCALLGPDGSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKL 228
           PCC  +G  G+GH+VKM+HNGIEY +MQLI + Y IL+ +L  +  E+  +F  W+ G+L
Sbjct: 181 PCCEWVGDAGAGHYVKMVHNGIEYGDMQLICEAYFILKHALGLSNEELYQVFKSWNEGEL 240

Query: 229 SSYLIKITAEILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFA 288
            SYLI+IT +I +  D  TG  ++D I D A+QKGTG         L    T+   A++A
Sbjct: 241 ESYLIEITRDIFTVKDGNTGEYLVDKILDTAAQKGTGKWMSQHALDLGVPTTLITEAVYA 300

Query: 289 RNLSLYRDES-KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSE 347
           R LS  +D   +  Q    P           F+ D+  ALYAS + S+ QG+  +  +++
Sbjct: 301 RCLSAQKDARVRASQILEGPKDAKFTGDKQQFIDDVRQALYASKLCSYAQGYVQLDAAAK 360

Query: 348 KYSWSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLR 407
           ++ W L+   IA +WR GCIIRS  L DI  +  + P+  NLL        V K  PS R
Sbjct: 361 EFGWKLNNGNIALLWRGGCIIRSAFLGDIKTAFDKSPTLENLLLDDFFKSAVAKAQPSWR 420

Query: 408 RIVVTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           R++ T  + G P P  SAALSY+D +   R  ANL+QAQRD+FG+H ++R DK
Sbjct: 421 RVISTAVQLGLPTPVFSAALSYYDGYRQGRLPANLLQAQRDYFGAHTYERTDK 473


>gi|126030875|pdb|2IYO|A Chain A, Structural Characterization Of A Bacterial 6pdh Reveals
           Aspects Of Specificity, Mechanism And Mode Of Inhibition
 gi|3033358|gb|AAC12804.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp.
           cremoris MG1363]
          Length = 472

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 285/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + ++ TK LE
Sbjct: 1   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVFKEHQ--DKNLVFTKTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 119 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKE 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 239 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+  F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 299 VKASKVLSGPALDFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 358 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 418 TPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 468


>gi|323333405|gb|EGA74801.1| Gnd2p [Saccharomyces cerevisiae AWRI796]
          Length = 493

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/471 (42%), Positives = 276/471 (58%), Gaps = 7/471 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
            D+G++GL  MG NL LN  D GF +  YN+     D F+       + +I   ++E +V
Sbjct: 6   GDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLAN-EAKGKSIIGATSIEDLV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
             + KPRKI++++  G PVD LI +L P L   DI++DGGNS+F DT  R  +L+++GI 
Sbjct: 65  AKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSYFPDTNRRYEELTKQGIL 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           F+G GVSGG  GAR G SLM GG+ +A+  ++NI  SI+AK    PCC  +GP GSGH+V
Sbjct: 125 FVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKSNGEPCCEWVGPAGSGHYV 184

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           KM+HNGIEY +MQLI + Y I++        EIS +F KW+TG L S+LI+IT +IL   
Sbjct: 185 KMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFD 244

Query: 244 DTITGMPII-DVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQ 302
           D + G P++     D A QKGTG  + I    L   +T+   A+FAR LS  +DE K+  
Sbjct: 245 D-VDGKPLVGKKXMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRAS 303

Query: 303 SFFNPSSHFPLKCF---DSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                 +  P       + FV DLE ALYAS I+S+ QGF +I +++  Y W L+   IA
Sbjct: 304 KLLAAPT-VPKDAIHDREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIA 362

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
            +WR GCIIRS  L +I K+  +DP   NLL     +  V K     RR +      G P
Sbjct: 363 LMWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIP 422

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            P+ S AL+++D +  +R  ANL+QAQRD+FG+H F    + +  H P  K
Sbjct: 423 TPAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDK 473


>gi|184201112|ref|YP_001855319.1| 6-phosphogluconate dehydrogenase [Kocuria rhizophila DC2201]
 gi|183581342|dbj|BAG29813.1| 6-phosphogluconate dehydrogenase [Kocuria rhizophila DC2201]
          Length = 485

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 296/462 (64%), Gaps = 6/462 (1%)

Query: 3   QADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQM 62
           +ADIG+ GL  MG+NL+ N    G+ +A++N+    TD  I++  G   + I T+ ++++
Sbjct: 6   KADIGVTGLAVMGANLARNFAHHGYTVALHNRSVAKTDALIEE-HGSEGEFIRTETMQEL 64

Query: 63  VEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGI 122
           V+++ +PR++L+MV  G PVD +I++L PLL   DI++DGGNS+F DT+ R  + +E G+
Sbjct: 65  VDSLERPRRVLIMVKAGAPVDSVIEQLTPLLDEGDIIIDGGNSYFQDTRRRERECAENGL 124

Query: 123 YFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGSGH 181
           +F+G+GVSGG +GA +G S+M GG+E++Y  +  +L  ISAK  + +PCCA +G DG+GH
Sbjct: 125 HFVGVGVSGGEEGALNGPSIMPGGSEESYRTLGPMLEDISAKADDGAPCCAWIGTDGAGH 184

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEYA+MQ+I + + +LR      P E + +F +W+T +LSSYLI+ITA++L 
Sbjct: 185 FVKMVHNGIEYADMQVIGEAHELLRSVAGLEPAEQADVFDRWNTTELSSYLIEITAQVLR 244

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLS----LYRDE 297
             D  TG P ID++ D A QKGTG  ++ E  +L S +T    ++FAR LS      R E
Sbjct: 245 QVDPKTGKPFIDIVADAAGQKGTGRWTVQEALELGSPVTAIAESVFARALSSSEPAMRKE 304

Query: 298 SKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
           ++++       +   +     FV+D+  ALYAS ++++ QG  ++  +  +Y W+L LAT
Sbjct: 305 AQEVLPAGIGDTTEDVVKDPGFVEDVRKALYASKLVAYAQGLDMLTMAGREYGWTLDLAT 364

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA +WR GCIIR+ +LN I+K+   D +  NLL  P     ++  +P+ RR+V    E G
Sbjct: 365 IASLWRNGCIIRADLLNVIMKAYEGDKAPLNLLFAPEFVNSIEDALPAWRRVVARAVERG 424

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKD 459
            P P  S+AL+Y+D     R  A L Q  RD+FG+H + R D
Sbjct: 425 IPAPVFSSALAYYDGLRRPRLNAALTQGLRDYFGAHTYKRID 466


>gi|62185047|ref|YP_219832.1| 6-phosphogluconate dehydrogenase [Chlamydophila abortus S26/3]
 gi|62148114|emb|CAH63871.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydophila
           abortus S26/3]
          Length = 484

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/459 (40%), Positives = 288/459 (62%), Gaps = 4/459 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN++D GF ++VYN+  E T  F+++ S  S ++   + LE  V
Sbjct: 8   ADIGLIGLAVMGKNLVLNMIDHGFSVSVYNRSPEKTREFLQEHS-QSPELQGHETLESFV 66

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRKI++M+  G PVDQ ID L P L   DI++DGGNS++ D++ R   L EKGI 
Sbjct: 67  RSLKRPRKIMLMIKAGTPVDQSIDSLLPYLEAGDIIIDGGNSYYKDSERRCRDLKEKGIL 126

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFV 183
           FIG+G+SGG +GAR G S+M GGN  A+  +  I  SISAK   +PCC  +GP G+GH+V
Sbjct: 127 FIGMGISGGEEGARHGPSIMPGGNSDAWPAIAPIFQSISAKVNGNPCCCWVGPGGAGHYV 186

Query: 184 KMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSS 243
           K +HNGIEY ++QLI + YG+LR  L+ +P  +S +F++W+T +L SYL++I+ E+LS  
Sbjct: 187 KTVHNGIEYGDIQLICEAYGLLRARLDLSPEAVSVIFAEWNTRELESYLMRISVEVLSLK 246

Query: 244 DTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQS 303
           D+  G P+ID I D A QKGTG  + I+       +++   ++ AR LS ++   ++   
Sbjct: 247 DS-NGFPVIDTILDVAGQKGTGRWTAIDAIDSGVPLSLIIESVLARFLSSWKTIRERASQ 305

Query: 304 FFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
                     K  D   F++D+  ALYAS I+S+ QGF ++ ++SE++ W+L+   +A +
Sbjct: 306 ELPGVPIVFEKPRDPHLFIEDVFQALYASKIISYAQGFMLLKQASEEHQWNLNFGELALL 365

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCII+S  L+ I K    +P + +L+        ++ + P  RR V     +GYP+P
Sbjct: 366 WRGGCIIQSVFLDAIHKGFENEPEAPSLILQSYFKTVLQHSEPGWRRTVAYGVGSGYPMP 425

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
            L+AAL+++D +        L Q  RD+FG+H ++RKD+
Sbjct: 426 CLAAALTFYDGYRTKDSPIALAQGLRDYFGAHTYERKDR 464


>gi|126030876|pdb|2IYP|A Chain A, Product Rup
 gi|126030877|pdb|2IYP|B Chain B, Product Rup
 gi|126030878|pdb|2IYP|C Chain C, Product Rup
          Length = 473

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 285/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + ++ TK LE
Sbjct: 2   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVFKEHQ--DKNLVFTKTLE 59

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 60  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADS 119

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 120 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 179

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 180 AGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKE 239

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 240 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 299

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+  F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 300 VKASKVLSGPALDFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 359 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 TPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 469


>gi|331702504|ref|YP_004399463.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           buchneri NRRL B-30929]
 gi|329129847|gb|AEB74400.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           buchneri NRRL B-30929]
          Length = 477

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/474 (39%), Positives = 297/474 (62%), Gaps = 11/474 (2%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           ++A+IG++G+  MG NL+LNI  +G+ + ++N+    T+  +K      +K++ +  +E 
Sbjct: 4   QKANIGVVGMAVMGKNLALNIESRGYTVGIFNRTGSKTEAVMKDHG--DKKLVPSYKIED 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++  PR+I++MV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVKSLETPRRIILMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFHDTMARNARLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKY--QNSPCCALLGPDGS 179
           I FIG+GVSGG  GA  G SLM GG ++AY+ VE IL  I+AK      PC   +GP+G+
Sbjct: 122 INFIGMGVSGGELGALQGPSLMPGGQKEAYDLVEPILKQIAAKAPADGEPCVTYIGPNGA 181

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY + +LI + Y ILR+    +  E++ +F  W+ G+L SYLI+ITA+I
Sbjct: 182 GHYVKMVHNGIEYGDEELIDESYNILRNLAGYSVDELADIFKDWNKGELDSYLIEITADI 241

Query: 240 LSSSDTITG---MPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRD 296
           L+  D I      PI+D+I D+ + KGTG  S  +  ++    ++   A++AR +S+ ++
Sbjct: 242 LTHKDDIGADKTKPIVDMILDRGANKGTGKWSSQDALEVGVDQSVITEAVYARYISMIKN 301

Query: 297 ESKKMQSFFNPSSHFPLKCFD--SFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLS 354
           E +   S   P     +  FD    V+ +  ALY   ++S+ QGF  +  +SE+Y W + 
Sbjct: 302 E-RVAASKVLPKPEGKVD-FDKKEIVEKVREALYFGKVMSYAQGFAQLKAASEQYKWDIQ 359

Query: 355 LATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCT 414
           L  +A+IWRAGCIIR++ L +I  +  ++P   NLL  P  ++  KK   S R +V   T
Sbjct: 360 LGEMAKIWRAGCIIRARFLQNITDAYDKNPDLQNLLLDPYFTDIAKKYQESARDVVALAT 419

Query: 415 ENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           + G PVPSL+AA+SY+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 420 KAGVPVPSLAAAVSYYDSYRSEVVPANLLQAQRDYFGAHTYERVDRPGSFHYTW 473


>gi|257867606|ref|ZP_05647259.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus EC30]
 gi|257873936|ref|ZP_05653589.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus EC10]
 gi|325571256|ref|ZP_08146756.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
 gi|257801662|gb|EEV30592.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus EC30]
 gi|257808100|gb|EEV36922.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus EC10]
 gi|325155732|gb|EGC67928.1| 6-phosphogluconate dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
          Length = 473

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/471 (40%), Positives = 289/471 (61%), Gaps = 5/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ +A++N+    T+  +K+    + K   T  +E
Sbjct: 1   MTKQQIGVVGMAVMGKNLALNIESRGYSVALFNRTGSKTEEVVKEHPDKNFKATYT--IE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V+++ KPR+IL+MV  G   D  I +L P L   DIL+DGGN+ F DT  R+ +L+  
Sbjct: 59  EFVQSIEKPRRILLMVKAGFATDATIQELLPHLDKGDILIDGGNTFFKDTVRRNEELANS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           GI FIG GVSGG +GA  G S+M GG ++AY  V  IL  ISAK ++ +PC   +GP+G+
Sbjct: 119 GINFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEQISAKAEDGTPCVTYIGPNGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y ++++ L  +  E++ +F++W+ G+L SYLI+ITA+I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAESYDLMQNILGLSVDEMADIFAEWNKGELDSYLIEITADI 238

Query: 240 LSSSDTI-TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           L+  D   TG PI+DVI D A  KGTG  +      L   + +   ++FAR +S Y++E 
Sbjct: 239 LTRKDDQGTGKPIVDVILDAAGNKGTGKWTSQSALDLGVPLPLITESVFARYISAYKEER 298

Query: 299 KKMQSFF-NPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
                    P +       + F+  +  ALY S I+S+ QGF  +  +S++Y W L    
Sbjct: 299 VNASKVLPKPEAVAFEGNKEEFINKIREALYFSKIMSYAQGFAQLRTASKEYDWDLPFGE 358

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR+Q L  I  +  ++    NLL      +  K+   S+R +V    + G
Sbjct: 359 IAKIWRAGCIIRAQFLQKITDAYDKNADIENLLLDDYFKDITKRYQSSVREVVALAVQAG 418

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            PVP+ S+A++YFD++  DR  ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 419 VPVPTFSSAIAYFDSYRSDRLPANLIQAQRDYFGAHTYERTDKEGIFHYSW 469


>gi|168702634|ref|ZP_02734911.1| 6-phosphogluconate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 490

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/462 (42%), Positives = 282/462 (61%), Gaps = 6/462 (1%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           ADIG+IGL  MG NL LN+   GF  AVYN+     D F+    G  +K +   +L+  V
Sbjct: 6   ADIGLIGLAVMGENLVLNMESHGFTCAVYNRTTAKVDEFVNG-RGAGKKFVGAHSLKDFV 64

Query: 64  EAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIY 123
            ++ +PRKI+MMV  G  VD  I+ + P L   DIL+DGGN+HF DT  R   L EKGI 
Sbjct: 65  ASIKRPRKIMMMVKAGKAVDDTIESVLPYLEAGDILIDGGNTHFPDTSRRMKSLKEKGIR 124

Query: 124 FIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-----SPCCALLGPDG 178
           FIG GVSGG +GA  G S+M GG E A+  V+ I  +I+AK ++     + CC  +GP+G
Sbjct: 125 FIGSGVSGGEEGALKGPSIMPGGEESAWPEVKPIFQAIAAKVKDTDGSEAACCDWVGPEG 184

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GHFVKM+HNGIEY +MQLI + Y +L+D     P E+S +F KW+ G L SYL++IT +
Sbjct: 185 AGHFVKMVHNGIEYGDMQLICESYNLLKDLCGMAPAEMSQVFGKWNKGVLDSYLVEITTD 244

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           IL+  D  TG P++DVI D A QKGTG  ++    +    +T+   A+F+R LS  + E 
Sbjct: 245 ILAFVDPETGKPMVDVILDTAGQKGTGKWTVDSATENGVPLTLIAEAVFSRCLSAQKAER 304

Query: 299 KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATI 358
                     +  P+     FV D+E ALYA+ I+S+ QG+ ++   ++   W+L+   I
Sbjct: 305 VAAAPLLAGPTAQPVADKAQFVADVEMALYAAKIVSYAQGYALMAAQAKANGWTLNNGGI 364

Query: 359 ARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGY 418
           A +WR GCIIRS  L  I ++  ++PS  NLL  P  + ++ K     RR+V     +G 
Sbjct: 365 ALMWRGGCIIRSAFLGKIKEAFDKNPSLVNLLVDPYFAGELGKAQAGWRRVVGAAAASGI 424

Query: 419 PVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDK 460
           P+P++S+AL+Y+D +   R  ANL+QAQRD+FG+H ++R DK
Sbjct: 425 PLPAISSALAYYDGYRTARLPANLLQAQRDYFGAHTYERLDK 466


>gi|125623448|ref|YP_001031931.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|146345353|sp|P96789|6PGD_LACLM RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating
 gi|124492256|emb|CAL97186.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300070196|gb|ADJ59596.1| 6-phosphogluconate dehydrogenase [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 472

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/471 (40%), Positives = 285/471 (60%), Gaps = 6/471 (1%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M QA+ G++G+  MG NL+LN+  +G+ +A+YN+    T+   K+     + ++ TK LE
Sbjct: 1   MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKEHQ--DKNLVFTKTLE 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + V ++ KPR+I++MV  G   D  I  L PLL   DIL+DGGN+HF DT  R+ +L++ 
Sbjct: 59  EFVGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADS 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAK--YQNSPCCALLGPDG 178
           GI FIG GVSGG KGA  G S+M GG ++AY+ V  I   I+AK      PC A +G +G
Sbjct: 119 GINFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANG 178

Query: 179 SGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAE 238
           +GH+VKM+HNGIEY +MQLIA+ Y +L+  L  +  EI  +F +W+ G+L SYLI+IT E
Sbjct: 179 AGHYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKE 238

Query: 239 ILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDES 298
           +L   D      I+D I DKA  KGTG  +      L   + +   ++FAR +S Y+DE 
Sbjct: 239 VLKRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDER 298

Query: 299 KKMQSFFN-PSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLAT 357
            K     + P+  F        ++ +  ALY S I+S+ QGF  + K+SE++ W L   T
Sbjct: 299 VKASKVLSGPALDFSGDK-KEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGT 357

Query: 358 IARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENG 417
           IA+IWRAGCIIR++ L +I  +  +D    NLL      +  K+   ++R +V    + G
Sbjct: 358 IAQIWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAG 417

Query: 418 YPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
            P+P+ ++A+SY+D++  +   ANLIQAQRD+FG+H ++R DK    H  W
Sbjct: 418 TPIPTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDW 468


>gi|256847611|ref|ZP_05553056.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           coleohominis 101-4-CHN]
 gi|256715300|gb|EEU30276.1| 6-phosphogluconate dehydrogenase, decarboxylating [Lactobacillus
           coleohominis 101-4-CHN]
          Length = 477

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/472 (39%), Positives = 293/472 (62%), Gaps = 7/472 (1%)

Query: 2   KQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQ 61
           K+A IG++GL  MG NL+LNI  +GF + VYN+    TD  +K  S   +K+I +  ++ 
Sbjct: 4   KKAQIGVVGLAVMGKNLALNIESRGFTVGVYNRHRNRTDEMMKDHS--DKKLIPSYTIKD 61

Query: 62  MVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            V+++ KPR+IL+MV  G P D +ID+L PLL   D+L+DGGN++F DT  R+ +L + G
Sbjct: 62  FVDSLEKPRRILLMVKAGGPTDAVIDELLPLLDKGDVLIDGGNTNFHDTMERNAKLDKSG 121

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNS-PCCALLGPDGSG 180
           I FIG+GVSGG  GA  G SLM GG ++AY+ V  IL  I+AK ++  PC A +GP+G+G
Sbjct: 122 INFIGMGVSGGELGALHGPSLMPGGQKEAYDLVAPILTKIAAKAEDGKPCVAYIGPNGAG 181

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           H+VKM+HNGIEY + +LI + Y ++R+ L  +  +++ +F +WD G+L S+LI ITA+IL
Sbjct: 182 HYVKMVHNGIEYGDEELIDESYNVMRNVLGLSVDDMAKIFHEWDQGELDSFLINITADIL 241

Query: 241 SSSDTI---TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +  D +      PI+D+I D+ + KGTG  S +      +  ++   A++AR +S+ +DE
Sbjct: 242 TRKDDLGDDKNKPIVDMILDRGANKGTGKWSSMTALDGGAPQSVITEAVYARYISMMKDE 301

Query: 298 S-KKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLA 356
             K  +     +    +   ++ ++ +  ALY   ++S+ QGF  +   S++Y W+L   
Sbjct: 302 RVKASKELPVETEAISIDDKEAMIEKIRQALYFGKVMSYAQGFEQMRIDSDRYDWNLKYG 361

Query: 357 TIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTEN 416
            +A+IWR GCIIR+Q L  I  +  ++P   NLL      +  KK   + R +V    + 
Sbjct: 362 ELAQIWREGCIIRAQFLQKITDAFDKNPELKNLLLDDYFKDIAKKYQKATRDVVALTVKA 421

Query: 417 GYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           G P PSLSAA++Y+D++  +   ANL+QAQRD+FG+H ++R D+    H  W
Sbjct: 422 GVPTPSLSAAINYYDSYRAEVLPANLLQAQRDYFGAHTYERTDRPGNFHYSW 473


>gi|57116925|ref|YP_177848.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis H37Rv]
 gi|148661650|ref|YP_001283173.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis H37Ra]
 gi|306776063|ref|ZP_07414400.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu001]
 gi|306972173|ref|ZP_07484834.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu010]
 gi|307079882|ref|ZP_07489052.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu011]
 gi|307084460|ref|ZP_07493573.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu012]
 gi|7431250|pir||D70664 probable gnd protein - Mycobacterium tuberculosis (strain H37RV)
 gi|38490290|emb|CAE55437.1| PROBABLE 6-PHOSPHOGLUCONATE DEHYDROGENASE GND1 [Mycobacterium
           tuberculosis H37Rv]
 gi|148505802|gb|ABQ73611.1| 6-phosphogluconate dehydrogenase [Mycobacterium tuberculosis H37Ra]
 gi|308215436|gb|EFO74835.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu001]
 gi|308358314|gb|EFP47165.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu010]
 gi|308362275|gb|EFP51126.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu011]
 gi|308365893|gb|EFP54744.1| 6-phosphogluconate dehydrogenase gnd1 [Mycobacterium tuberculosis
           SUMu012]
          Length = 485

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 279/473 (58%), Gaps = 3/473 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMV 63
           A IG+ GL  MGSN++ N    G+ +AV+N+    TD  +K+ S    K + ++ + + +
Sbjct: 11  AQIGVTGLAVMGSNIARNFARHGYTVAVHNRSVAKTDALLKEHSS-DGKFVRSETIPEFL 69

Query: 64  EAVCKPRKILMMVTDGDP--VDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKG 121
            A+ KPR++L+MV  G+    D +I++L   + P DI++DGGN+ + DT  R   + E+G
Sbjct: 70  AALEKPRRVLIMVKAGEATDADAVINELADAMEPGDIIIDGGNALYTDTMRREKAMRERG 129

Query: 122 IYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGH 181
           ++F+G G+SGG +GA +G S+M GG  ++Y  +  +L  ISA     PCC  +GPDGSGH
Sbjct: 130 LHFVGAGISGGEEGALNGPSIMPGGPAESYQSLGPLLEEISAHVDGVPCCTHIGPDGSGH 189

Query: 182 FVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILS 241
           FVKM+HNGIEY++MQLI + Y ++RD L      I+ +F++W+ G L SYL++ITAE+L 
Sbjct: 190 FVKMVHNGIEYSDMQLIGEAYQLMRDGLGLTAPAIADVFTEWNNGDLDSYLVEITAEVLR 249

Query: 242 SSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKM 301
            +D  TG P++DVI D+A QKGTG  ++     L   +T    A+FAR LS    +    
Sbjct: 250 QTDAKTGKPLVDVIVDRAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGSVGQRSAA 309

Query: 302 QSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARI 361
               +           +F +D+  ALYAS I+++ QGF  I   S ++ W ++   +A I
Sbjct: 310 SGLASGKLGEQPADPATFTEDVRQALYASKIVAYAQGFNQIQAGSAEFGWDITPGDLATI 369

Query: 362 WRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVP 421
           WR GCIIR++ LN I ++    P+  +L+  P     V+  I S RR+V T  + G P P
Sbjct: 370 WRGGCIIRAKFLNHIKEAFDASPNLASLIVAPYFRGAVESAIDSWRRVVSTAAQLGIPTP 429

Query: 422 SLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTE 474
             S+ALSY+D     R  A L QAQRDFFG+H + R D+  + H  W    TE
Sbjct: 430 GFSSALSYYDALRTARLPAALTQAQRDFFGAHTYGRIDEPGKFHTLWSSDRTE 482


>gi|332293625|ref|YP_004432234.1| 6-phosphogluconate dehydrogenase, decarboxylating [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332171711|gb|AEE20966.1| 6-phosphogluconate dehydrogenase, decarboxylating [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 469

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/466 (40%), Positives = 278/466 (59%), Gaps = 2/466 (0%)

Query: 5   DIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVE 64
           D G++GLG MG N  LN+ D GF     + D E     I++  G  ++V  T ++    +
Sbjct: 6   DFGLVGLGVMGRNFILNVADNGFSAMGNDLDPEKVQALIEE-GGDPKRVDATVDVSAFAK 64

Query: 65  AVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYF 124
           A+  PRKI+++V  G  VD +I+ L P L   DI++DGGNS F DT  R   LSE GI+F
Sbjct: 65  ALSSPRKIMLLVPAGKVVDIVIESLLPHLDKGDIIIDGGNSFFTDTDRREAYLSENGIHF 124

Query: 125 IGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVK 184
            G GVSGG KGAR G S+M GG++  Y  V+ I  ++SAKY   PC A LGP  +G++VK
Sbjct: 125 FGAGVSGGAKGARIGPSIMPGGSKPGYAAVQPIFEAVSAKYNGEPCVAYLGPKSAGNYVK 184

Query: 185 MIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSD 244
           M+HNGIEY  MQL ++IY +L+ + N +  E+   +  W+ G+L S+L++IT+EI +  D
Sbjct: 185 MVHNGIEYGLMQLTSEIYDVLKKAGNLSNQELHETYKSWNEGRLQSFLVEITSEIFAEKD 244

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKKMQSF 304
           T+T   ++D I DKA QKGTG  +      L   +   + A+  R +S  +DE     S 
Sbjct: 245 TLTSSDLVDQILDKAKQKGTGKWTSQNAMDLGIPVPSIDIAVSMREISALKDERTIADSL 304

Query: 305 FNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIARIWRA 364
           ++      +   +   K  E ALY S I+++ QG   +  +S++Y + L +A IA+IWRA
Sbjct: 305 YDRPEVATMDK-EKLTKLTEEALYFSYIITYAQGLHQLADASKEYGYDLDIAVIAKIWRA 363

Query: 365 GCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPVPSLS 424
           GCIIR+++L DI  + TED    NLL  PS  +K++ T+ S R +V     NG P+P +S
Sbjct: 364 GCIIRAKLLADITDAFTEDTELPNLLLSPSFIKKIQSTVDSARELVAYGAINGIPLPGVS 423

Query: 425 AALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
            +L+YFD +   R   NLIQAQRD+FGSH ++R D+    H  W+K
Sbjct: 424 NSLTYFDAYTSTRLPLNLIQAQRDYFGSHTYERLDREGIFHTEWEK 469


>gi|253773042|ref|YP_003035873.1| 6-phosphogluconate dehydrogenase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162017|ref|YP_003045125.1| 6-phosphogluconate dehydrogenase [Escherichia coli B str. REL606]
 gi|297517638|ref|ZP_06936024.1| 6-phosphogluconate dehydrogenase [Escherichia coli OP50]
 gi|300930452|ref|ZP_07145857.1| 6-phosphogluconate dehydrogenase, decarboxylating [Escherichia coli
           MS 187-1]
 gi|242377674|emb|CAQ32434.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Escherichia
           coli BL21(DE3)]
 gi|253324086|gb|ACT28688.1| 6-phosphogluconate dehydrogenase, decarboxylating [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973918|gb|ACT39589.1| 6-phosphogluconate dehydrogenase [Escherichia coli B str. REL606]
 gi|253978112|gb|ACT43782.1| 6-phosphogluconate dehydrogenase [Escherichia coli BL21(DE3)]
 gi|300461664|gb|EFK25157.1| 6-phosphogluconate dehydrogenase, decarboxylating [Escherichia coli
           MS 187-1]
          Length = 468

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 284/469 (60%), Gaps = 4/469 (0%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M +  IG++G+  MG NL+LNI  +G+ ++++N+  E T+  I +  G  +K++    ++
Sbjct: 1   MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPG--KKLVPYYTVK 58

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           + VE++  PR+IL+MV  G   D  ID LKP L   DI++DGGN+ F DT  R+ +LS +
Sbjct: 59  EFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAE 118

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQN-SPCCALLGPDGS 179
           G  FIG GVSGG +GA  G S+M GG ++AY  V  IL  I+A  ++  PC   +G DG+
Sbjct: 119 GFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGA 178

Query: 180 GHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEI 239
           GH+VKM+HNGIEY +MQLIA+ Y +L+  LN +  E++  F++W+ G+LSSYLI IT +I
Sbjct: 179 GHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLSNEELAQTFTEWNNGELSSYLIDITKDI 238

Query: 240 LSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESK 299
            +  D   G  ++DVI D+A+ KGTG  +      L   +++   ++FAR +S  +D+  
Sbjct: 239 FTKKDE-DGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRV 297

Query: 300 KMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIA 359
                 +     P    D F++ +  ALY   I+S+ QGF  +  +SE+Y+W L    IA
Sbjct: 298 AASKVLSGPQAQPAGDKDEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLDYGEIA 357

Query: 360 RIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           +I+RAGCIIR+Q L  I  +  E+P   NLL  P   +       +LR +V    +NG P
Sbjct: 358 KIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIP 417

Query: 420 VPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPW 468
           VP+ +AA++Y+D++      ANLIQAQRD+FG+H + R DK    H  W
Sbjct: 418 VPTFAAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW 466


>gi|194307292|gb|ACF42141.1| 6-phosphogluconate dehydrogenase [Mycobacterium lepromatosis]
          Length = 482

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/471 (39%), Positives = 285/471 (60%), Gaps = 1/471 (0%)

Query: 4   ADIGIIGLGSMGSNLSLNILDKGFRL