RPSBLAST alignment for GI: 254780716 and conserved domain: PLN02350

>gnl|CDD|177984 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating). Length = 493
 Score =  399 bits (1027), Expect = e-112
 Identities = 184/485 (37%), Positives = 288/485 (59%), Gaps = 13/485 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFI---KKISGLSQKVIVTK 57
              + IG+ GL  MG NL+LNI +KGF ++VYN+     D  +   KK   L   +   K
Sbjct: 4   AALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNL--PLYGFK 61

Query: 58  NLEQMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQL 117
           + E  V ++ KPR ++++V  G PVDQ I  L   + P D ++DGGN  + +T+ R  + 
Sbjct: 62  DPEDFVLSIQKPRSVIILVKAGAPVDQTIKALSEYMEPGDCIIDGGNEWYENTERRIKEA 121

Query: 118 SEKGIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPD 177
           +EKG+ ++G+GVSGG +GAR+G SLM GG+ +AY  +E+IL  ++A+  + PC   +GP 
Sbjct: 122 AEKGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKNIEDILEKVAAQVDDGPCVTYIGPG 181

Query: 178 GSGHFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITA 237
           G+G+FVKM+HNGIEY +MQLI++ Y +L+     +  E++ +F++W+ G+L S+LI+ITA
Sbjct: 182 GAGNFVKMVHNGIEYGDMQLISEAYDVLKSVGGLSNEELAEVFAEWNKGELESFLIEITA 241

Query: 238 EILSSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE 297
           +I S  D      ++D I DK   KGTG  ++ +  +LS +      ++ AR LS  ++E
Sbjct: 242 DIFSVKDDKGDGYLVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDARYLSGLKEE 301

Query: 298 ----SKKMQSFFNPSSHFPLKCFDS--FVKDLENALYASTILSFTQGFWVI-GKSSEKYS 350
               +K  +              D    + D+  ALYAS I S+ QG  +I  KS EK  
Sbjct: 302 RVAAAKVFKEAGLEDILSADSGVDKKQLIDDVRQALYASKICSYAQGMNLIRAKSVEK-G 360

Query: 351 WSLSLATIARIWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIV 410
           W+L+L  +ARIW+ GCIIR+  L+ I K+   +P   +LL  P  ++++ +   + RR+V
Sbjct: 361 WNLNLGELARIWKGGCIIRAVFLDRIKKAYDRNPDLASLLVDPEFAKEMVERQAAWRRVV 420

Query: 411 VTCTENGYPVPSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQK 470
                 G   P +SA+L+YFDT+   R  ANL+QAQRD+FG+H ++R D+    H  W K
Sbjct: 421 SLAINAGISTPGMSASLAYFDTYRRARLPANLVQAQRDYFGAHTYERVDRPGSFHTEWTK 480

Query: 471 VSTES 475
           ++ +S
Sbjct: 481 LARKS 485