RPSBLAST alignment for GI: 254780716 and conserved domain: PRK12490

>gnl|CDD|183555 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed. Length = 299
 Score =  192 bits (489), Expect = 2e-49
 Identities = 98/300 (32%), Positives = 160/300 (53%), Gaps = 19/300 (6%)

Query: 6   IGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLEQMVEA 65
           +G+IGLG MG N++  + + G  +  Y+ + E  DV           +    +LE++V  
Sbjct: 3   LGLIGLGKMGGNMAERLREDGHEVVGYDVNQEAVDV------AGKLGITARHSLEELVSK 56

Query: 66  VCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEKGIYFI 125
           +  PR I +MV  G+  + +I  L PLLSP DI++DGGNS + D   R+ +L+E+GI+++
Sbjct: 57  LEAPRTIWVMVPAGEVTESVIKDLYPLLSPGDIVVDGGNSRYKDDLRRAEELAERGIHYV 116

Query: 126 GIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSGHFVKM 185
             G SGGV G R+G  LMVGG+++ Y+R+E +  +++ +    P     GP GSGHF+KM
Sbjct: 117 DCGTSGGVWGLRNGYCLMVGGDKEIYDRLEPVFKALAPE---GPGYVHAGPVGSGHFLKM 173

Query: 186 IHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGK-LSSYLIKITAEILSSSD 244
           +HNGIEY  MQ  A+   +L  S     +E   +   W  G  + S+L+ +T + L+   
Sbjct: 174 VHNGIEYGMMQAYAEGLELLDKSDFDFDVE--DVARLWRNGSVIRSWLLDLTVKALAEDP 231

Query: 245 TITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDE-SKKMQS 303
            + G      I    +  G G  ++ E  +L+ +  +   ++F R  S   D    K+ S
Sbjct: 232 KLAG------IKGYVNDSGEGRWTVEEAIELAVAAPVIAASLFMRFASQEDDSFHMKVVS 285