BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780716|ref|YP_003065129.1| 6-phosphogluconate
dehydrogenase [Candidatus Liberibacter asiaticus str. psy62]
         (475 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 475

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/475 (100%), Positives = 475/475 (100%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE
Sbjct: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120
           QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK
Sbjct: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDGGNSHFCDTQIRSLQLSEK 120

Query: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180
           GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG
Sbjct: 121 GIYFIGIGVSGGVKGARSGASLMVGGNEKAYNRVENILLSISAKYQNSPCCALLGPDGSG 180

Query: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240
           HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL
Sbjct: 181 HFVKMIHNGIEYANMQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEIL 240

Query: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300
           SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK
Sbjct: 241 SSSDTITGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTITETAIFARNLSLYRDESKK 300

Query: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360
           MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR
Sbjct: 301 MQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYSWSLSLATIAR 360

Query: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420
           IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV
Sbjct: 361 IWRAGCIIRSQILNDIVKSLTEDPSSTNLLNIPSISEKVKKTIPSLRRIVVTCTENGYPV 420

Query: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475
           PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES
Sbjct: 421 PSLSAALSYFDTFIHDRGTANLIQAQRDFFGSHGFDRKDKISEPHGPWQKVSTES 475


>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 384

 Score = 26.6 bits (57), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 3/102 (2%)

Query: 1   MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKDFELTDVFIKKISGLSQKVIVTKNLE 60
           M   D+ IIG G  GS  ++    KGF  A+ +    L D+    + G     +   N+ 
Sbjct: 1   MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVW 60

Query: 61  QMVEAVCKPRKILMMVTDGDPVDQLIDKLKPLLSPEDILLDG 102
             ++ + +P     +V   D  D+LI     +    +I LD 
Sbjct: 61  DFLQDIAEPVSSFRLV---DITDRLITAPDAIFHSSEIGLDA 99


>gi|254780158|ref|YP_003064571.1| phosphoribosylaminoimidazole carboxylase ATPase subunit
          [Candidatus Liberibacter asiaticus str. psy62]
          Length = 354

 Score = 25.8 bits (55), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 1  MKQADIGIIGLGSMGSNLSLNILDKGFRLAVYNKD 35
          MK+  IGIIG G +   LS++    GF   + + D
Sbjct: 1  MKKKTIGIIGGGQLARMLSMSAARLGFCTVILDPD 35


>gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 101

 Score = 25.4 bits (54), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 389 LLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           L ++ S ++++ + IP+++  VVT TEN  P
Sbjct: 55  LQSLRSNAQQIIQNIPTVKNAVVTLTENKNP 85


>gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 101

 Score = 25.4 bits (54), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 389 LLNIPSISEKVKKTIPSLRRIVVTCTENGYP 419
           L ++ S ++++ + IP+++  VVT TEN  P
Sbjct: 55  LQSLRSNAQQIIQNIPTVKNAVVTLTENKNP 85


>gi|254780831|ref|YP_003065244.1| hypothetical protein CLIBASIA_03620 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 341

 Score = 25.4 bits (54), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 17/24 (70%)

Query: 396 SEKVKKTIPSLRRIVVTCTENGYP 419
           ++++ + IP+++  VVT TEN  P
Sbjct: 62  AQQIIQNIPTVKNAVVTLTENKNP 85


>gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 341

 Score = 25.4 bits (54), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 226 GKLSSYLIKITAEILSSSDTI----TGMPIIDVICDKASQKGTGIRSIIEGHKLSSSMTI 281
           GKL +  +   ++++ S D+I     G P+ID I   + ++   +  + EG KL     I
Sbjct: 211 GKLGTLFV-CASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKG--II 267

Query: 282 TETAIFARNL 291
           TE  IF RN 
Sbjct: 268 TEGDIF-RNF 276


>gi|254780615|ref|YP_003065028.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 478

 Score = 25.0 bits (53), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 86  IDKLKPLLSPEDILLDGGN----SHFCDTQIRSLQLSEKGIY 123
           I  ++ +  P D L D       +H   T + S Q+SEKGIY
Sbjct: 309 ITSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIY 350


>gi|254780773|ref|YP_003065186.1| zinc metallopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 349

 Score = 24.3 bits (51), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 77/197 (39%), Gaps = 32/197 (16%)

Query: 294 YRDESKKMQSFFNPSSHFPLKCFDSFVKDLENALYASTILSFTQGFWVIGKSSEKYS--W 351
           + ++ K M+SFF  +     K        L N + A  IL FT  F+  G      S   
Sbjct: 71  FSEDEKDMRSFFCAAPW--KKILTVLAGPLANCVMA--ILFFTFFFYNTGVMKPVVSNVS 126

Query: 352 SLSLATIARIWRAGCII-----RSQILNDIVKSLTEDPSSTNLLNIPSISEKVK----KT 402
             S A IA + +  CII           ++   + E+P   + +++    E V     K 
Sbjct: 127 PASPAAIAGVKKGDCIISLDGITVSAFEEVAPYVRENP--LHEISLVLYREHVGVLHLKV 184

Query: 403 IPSLRRIVVTCTENGYP--VPSLSAALSYFDTFIH--------DRGTANLIQAQRDFFG- 451
           +P L+    T    G    VPS+  + SY +T +H         RG   +    R F G 
Sbjct: 185 MPRLQD---TVDRFGIKRQVPSVGISFSYDETKLHSRTVLQSFSRGLDEISSITRGFLGV 241

Query: 452 -SHGFDRKDKISEPHGP 467
            S  F +  ++++  GP
Sbjct: 242 LSSAFGKDTRLNQISGP 258


>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 249

 Score = 23.9 bits (50), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 16/24 (66%)

Query: 157 ILLSISAKYQNSPCCALLGPDGSG 180
           I+  ++ K + S   A++GP+GSG
Sbjct: 18  IIRGLNLKVEPSEVVAIMGPNGSG 41


>gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62]
          Length = 976

 Score = 23.9 bits (50), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 195 MQLIADIYGILRDSLNKNPLEISHLFSKWDTGKLSSYLIKITAEILSSSDTITGMP 250
           MQL++     L D++ +  ++I H+  KW  G     ++ + A    S D I G+P
Sbjct: 145 MQLVSPT-TCLYDTVKEEKIDIEHVIKKW--GIPPEKMVCLQALTGDSIDNIPGIP 197


>gi|254780359|ref|YP_003064772.1| GTP cyclohydrolase II protein (riboflavin biosynthesis) [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 210

 Score = 23.9 bits (50), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 246 ITGMPIIDVICDKASQKGT 264
           ITG+P I VIC+  +  GT
Sbjct: 159 ITGLPPIAVICELVNDDGT 177


>gi|254780423|ref|YP_003064836.1| S-adenosylmethionine synthetase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 413

 Score = 23.5 bits (49), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 4/35 (11%)

Query: 214 LEISHLFSKWDTGKLSS----YLIKITAEILSSSD 244
           L I H    WD GK+ S    Y++K   +I  S D
Sbjct: 211 LSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPD 245


>gi|254780217|ref|YP_003064630.1| DNA polymerase III subunit delta' [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 347

 Score = 23.1 bits (48), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 34/91 (37%), Gaps = 8/91 (8%)

Query: 323 LENALYASTILSFTQGFW---VIGKSSEKYSWSLSLATIARIWRAGCI-----IRSQILN 374
           L + LY S  L+   G W   +      +  + LSL      WR   I     +     N
Sbjct: 89  LHDFLYLSYSLNPKTGKWRTVITVDEIRRIRYFLSLTANTGYWRVIMIDPVDGMNRNAAN 148

Query: 375 DIVKSLTEDPSSTNLLNIPSISEKVKKTIPS 405
            ++KSL E P     + I   S  +  TI S
Sbjct: 149 ALLKSLEEPPQKVLFILISHASPTILSTIRS 179


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:3