>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transpo

Probab=97.03 E-value=0.017 Score=31.74 Aligned_cols=107 Identities=16% Similarity=0.180 Sum_probs=58.9 Q ss_pred HHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHH-H---HHHHHH---HHHHHHHHHHHHHHHHH--CCHHHHH Q ss_conf 2456654128889999808981067769999999999999-9---998899---99999999999999741--9989999 Q gi|254780719|r 145 IWKPLLATTVNYELAKAEGMQPEKIKLIFIMITSLMISVS-I---KFIGIT---LITSLLILPTVTARRFS--TSPENMA 215 (260) Q Consensus 145 ~~r~l~~~~fD~~~A~~~Gi~v~~~~~l~~~l~al~v~~~-v---~~vG~l---lv~allv~Paa~A~~l~--~~~~~~~ 215 (260) T Consensus 147 ~G~~irAvg~n~~aA~~~GInv~rv~~~~f~isg~laglaG~l~~~~~~~~~p~~~g~~~~~~~~~~~vlGG~gsi~Ga~ 226 (268) T cd06581 147 FGRALRAIRENEVAAEALGINVTRYKLLAFALSAALAGLAGALYAHYLGFVSPESFGFALSIELLLMVVLGGLGSLLGPV 226 (268) T ss_pred CCEEHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHEEECCCCHHHHH T ss_conf 66358875328599997796899999999999999999999999987166180130189999999886154887659999 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHC Q ss_conf 99999999999999999999558808999999999999998723 Q gi|254780719|r 216 ILATIIGILGIIIGLYGSLIFDTPSGPSIIITSLFLFILSFFYK 259 (260) Q Consensus 216 ~~s~~~g~~~~~~G~~lS~~~~lp~g~~Iv~~~~~~f~~~~~~~ 259 (260) T Consensus 227 iG~lilg~~~~~~~~~~~~~~~--------~~~~~ili~vll~r 262 (268) T cd06581 227 LGAALLVLLPELLRSLGPGLRL--------LVFGLLLILVVLFL 262 (268) T ss_pred HHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHC T ss_conf 9999999999999986078999--------99999999999985

HHsearch alignment for GI: 254780719 and conserved domain: cd06581