HHsearch results for GI: 254780720 and protein with PDBid: 1jgc_A

>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1
Probab=100.00  E-value=9.9e-32  Score=211.22  Aligned_cols=145  Identities=12%  Similarity=0.131  Sum_probs=139.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCC
Q ss_conf             98999999999999999999999999998159947899999999999999999999999953997143782257204889
Q gi|254780720|r    2 TNTRDRVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISAND   81 (164)
Q Consensus         2 s~~~~~~Ln~qi~~El~as~~Yl~~a~~~~~~~~~g~a~~f~~~a~EE~~HA~~l~~yi~~rgg~~~~~~i~~p~~~~~~   81 (164)
                      ++++.++||++++.|++|+++|+++|.||++++++|+++||+.+|.||++||.+|++||+.|||.|.++.++ |+..+.+
T Consensus         4 ~~~ii~~Ln~~l~~E~~a~~~Y~~~a~~~~~~~~~~la~~f~~~a~eE~~Ha~~l~e~i~~lGg~p~~~~~~-~~~~~~~   82 (161)
T 1jgc_A            4 DAKVIEFLNAALRSELTAISQYWVHFRLQEDWGLAKMAKKSREESIEEMGHADKIIARILFLEGHPNLQKLD-PLRIGEG   82 (161)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCSCCC-CCCCCSS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCC
T ss_conf             899999999999999999999999999983588799999999999999999999999998579998766557-6767899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             899999999999999999999999999709988999999999999999999999999999528875
Q gi|254780720|r   82 VEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSGP  147 (164)
Q Consensus        82 ~~e~~~~al~~E~~vt~~~~~l~~~A~~~~D~~t~~fl~~fl~EQ~eee~~~~~ll~~l~~~g~~~  147 (164)
                      +.++|+.++++|+.+++.|++++++|.+.+|+.|.+||+||+.+|.++..++...++.++++|.++
T Consensus        83 ~~~~l~~~l~~E~~~~~~~~~~i~~a~~~~D~~t~~~L~~~l~eEe~h~~~le~~l~~i~~~G~~~  148 (161)
T 1jgc_A           83 PRETLECDLAGEHDALKLYREARDYCAEVGDIVSKNIFESLITDEEGHVDFLETQISLYDRLGPQG  148 (161)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999998849999999999999999999999999999999978999