PSIBLAST alignment of GI: 254780720 and protein with PDB id: 2za8

>gi|166007296|pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal Deletion Mutant (Residues 1-8) Length = 167
 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 59/160 (36%), Gaps = 6/160 (3%)

Query: 2   TNTRDRVLNELMNMEYVAQYHYMQAAAWAASHN--LDGCCNFLLKHAMEEHSHVIRIFKH 59
           +   +  +N L+N+   A Y Y+    +    +  L+G C+F  + A E+     R+ K 
Sbjct: 2   STEVEAAVNRLVNLYLRASYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKM 61

Query: 60  LTDLGVEAKFSSIEAP-VISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQF 118
               G  A F  ++ P                  E  +  A  D      A+ D     F
Sbjct: 62  QNQRGGRALFQDLQKPSQDEWGTTPDAMKAAIVLEKSLNQALLDLHALGSAQADPHLCDF 121

Query: 119 LQWF-VKEQHEEMALFRRILDKI-RLIGSG-PHSRYMFDL 155
           L+   + E+ + +      L  I RL+GS      Y+F+ 
Sbjct: 122 LESHFLDEEVKLIKKMGDHLTNIQRLVGSQAGLGEYLFER 161