RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780720|ref|YP_003065133.1| Ferroxidase [Candidatus Liberibacter asiaticus str. psy62] (164 letters) >gnl|CDD|153113 cd01055, Nonheme_Ferritin, nonheme-containing ferritins. Nonheme Ferritin domain, found in archaea and bacteria, is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The ferritin protein shell is composed of 24 protein subunits arranged in 432 symmetry. Each protein subunit, a four-helix bundle with a fifth short terminal helix, contains a dinuclear ferroxidase center (H type). Unique to this group of proteins is a third metal site in the ferroxidase center. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite. Length = 156 Score = 175 bits (446), Expect = 5e-45 Identities = 65/149 (43%), Positives = 85/149 (57%) Query: 9 LNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAK 68 LNE +N+E + Y Y+ AAW S LDG NF A EE H ++ F +L D G + Sbjct: 8 LNEQINLELYSSYLYLAMAAWFDSKGLDGFANFFRVQAQEEREHAMKFFDYLNDRGGRVE 67 Query: 69 FSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQHE 128 +IEAP + +F EHE KVT + ++ ++ L EKD+ TF FLQWFVKEQ E Sbjct: 68 LPAIEAPPSEFESLLEVFEAALEHEQKVTESINNLVDLALEEKDYATFNFLQWFVKEQVE 127 Query: 129 EMALFRRILDKIRLIGSGPHSRYMFDLEI 157 E AL R ILDK++L G YM D E+ Sbjct: 128 EEALARDILDKLKLAGDDGGGLYMLDKEL 156 >gnl|CDD|31717 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism]. Length = 167 Score = 131 bits (331), Expect = 9e-32 Identities = 64/156 (41%), Positives = 92/156 (58%) Query: 8 VLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEA 67 +LNE MN+E+ A Y+Q AAW +S +L G FL A EE +H +++F +L + G Sbjct: 9 LLNEQMNLEFYASNLYLQMAAWCSSESLPGFAKFLRAQAQEELTHAMKLFNYLNERGARP 68 Query: 68 KFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQH 127 + +IEAP + ++ LF EHE KVT + ++ E EKD+ TF FLQWFV EQ Sbjct: 69 ELKAIEAPPNKFSSLKELFEKTLEHEQKVTSSINELAEVAREEKDYATFNFLQWFVAEQV 128 Query: 128 EEMALFRRILDKIRLIGSGPHSRYMFDLEIEKIANK 163 EE LF+ ILDK+ L G+ Y+ D E++ A+ Sbjct: 129 EEEKLFKTILDKLELAGNDGEGLYLIDKELKNRASS 164 >gnl|CDD|143967 pfam00210, Ferritin, Ferritin-like domain. This family contains ferritins and other ferritin-like proteins such as members of the DPS family and bacterioferritins. Length = 142 Score = 106 bits (268), Expect = 2e-24 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 4/139 (2%) Query: 9 LNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAK 68 LNE + E A Y Y+Q A + L G F + A EE H ++ + + LG + Sbjct: 4 LNEQLADELTASYQYLQMAWYFDGPGLPGLAEFFDEQAEEEREHADKLAERILALGGKPV 63 Query: 69 FSSIEAPVISA----NDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVK 124 + +E I V EHE +VT + + IE E D+ T FL+WF++ Sbjct: 64 LTPVELLKIEPPDEFGSVLEALEAALEHEKEVTESLRELIELAEEEGDYATADFLEWFLE 123 Query: 125 EQHEEMALFRRILDKIRLI 143 EQ E + +L+K++ I Sbjct: 124 EQEEHEWMLEALLEKLKRI 142 >gnl|CDD|153098 cd00904, Ferritin, Ferritin iron storage proteins. Ferritins are the primary iron storage proteins of most living organisms and members of a broad superfamily of ferritin-like diiron-carboxylate proteins. The iron-free (apoferritin) ferritin molecule is a protein shell composed of 24 protein chains arranged in 432 symmetry. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the dinuclear ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite; the protein shell can hold up to 4500 iron atoms. In vertebrates, two types of chains (subunits) have been characterized, H or M (fast) and L (slow), which differ in rates of iron uptake and mineralization. Bacterial non-heme ferritins are composed only of H chains. Fe(II) oxidation in the H/M subunits take place initially at the ferroxidase center, a carboxylate-bridged diiron center, located within the subunit four-helix bundle. In a complementary role, negatively charged residues on the protein shell inner surface of the L subunits promote ferrihydrite nucleation. Most plant ferritins combine both oxidase and nucleation functions in one chain: they have four interior glutamate residues as well as seven ferroxidase center residues. Length = 160 Score = 59.6 bits (144), Expect = 4e-10 Identities = 42/152 (27%), Positives = 61/152 (40%), Gaps = 6/152 (3%) Query: 9 LNELMNMEYVAQYHYMQAAAW--AASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVE 66 +N +N+E A Y Y+ A + L G +F + A EE H + +K+ + G Sbjct: 8 VNRQLNLELYASYTYLSMATYFDRDDVALKGVAHFFKEQAQEEREHAEKFYKYQNERGGR 67 Query: 67 AKFSSIEAPVISA-NDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQW-FVK 124 + IE P + E V A D E EKD FL+ F+ Sbjct: 68 VELQDIEKPPSDEWGGTLDAMEAALKLEKFVNQALLDLHELASEEKDPHLCDFLESHFLD 127 Query: 125 EQHEEMALFRRILDKI-RLIGSGPHS-RYMFD 154 EQ +E+ IL + RL G S Y+FD Sbjct: 128 EQVKEIKQVGDILTNLERLNGQQAGSGEYLFD 159 >gnl|CDD|153114 cd01056, Euk_Ferritin, eukaryotic ferritins. Eukaryotic Ferritin (Euk_Ferritin) domain. Ferritins are the primary iron storage proteins of most living organisms and members of a broad superfamily of ferritin-like diiron-carboxylate proteins. The iron-free (apoferritin) ferritin molecule is a protein shell composed of 24 protein chains arranged in 432 symmetry. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the dinuclear ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite; the protein shell can hold up to 4500 iron atoms. In vertebrates, two types of chains (subunits) have been characterized, H or M (fast) and L (slow), which differ in rates of iron uptake and mineralization. Fe(II) oxidation in the H/M subunits take place initially at the ferroxidase center, a carboxylate-bridged diiron center, located within the subunit four-helix bundle. In a complementary role, negatively charged residues on the protein shell inner surface of the L subunits promote ferrihydrite nucleation. Most plant ferritins combine both oxidase and nucleation functions in one chain: they have four interior glutamate residues as well as seven ferroxidase center residues. Length = 161 Score = 46.4 bits (111), Expect = 3e-06 Identities = 38/156 (24%), Positives = 62/156 (39%), Gaps = 14/156 (8%) Query: 9 LNELMNMEYVAQYHYMQAAAWAASH--NLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVE 66 LN+ +N+E A Y Y+ AA+ L G F K + EE H ++ K+ G Sbjct: 8 LNKQINLELNASYVYLSMAAYFDRDDVALPGFAKFFRKLSDEEREHAEKLIKYQNKRGGR 67 Query: 67 AKFSSIEAPVISANDVEGLFSLMY--EHENKVTIAYDDAIETILAEKDHQTFQFLQW-FV 123 I+ P GL +L + E V + D + D FL+ F+ Sbjct: 68 VVLQDIKKPEKD-EWGSGLEALELALDLEKLVNQSLLDLHKLASEHNDPHLADFLESEFL 126 Query: 124 KEQHE---EMALFRRILDKIRLIGSGP--HSRYMFD 154 +EQ E ++A + ++ +G Y+FD Sbjct: 127 EEQVESIKKLA---GYITNLKRVGKPQSGLGEYLFD 159 >gnl|CDD|153097 cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF). Length = 130 Score = 42.5 bits (100), Expect = 6e-05 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 11/136 (8%) Query: 7 RVLNELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVE 66 R+LN+ + EY A Y Q AA A +L + LL+ A EE H + + L +LG Sbjct: 1 RLLNDALAGEYAAIIAYGQLAARAPDPDLK---DELLEIADEERRHADALAERLRELGGT 57 Query: 67 -----AKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQW 121 A + A +++D E E + AY + IE D + + L+ Sbjct: 58 PPLPPAHLLAAYALPKTSDDPAEALRAALEVEARAIAAYRELIEQA---DDPELRRLLER 114 Query: 122 FVKEQHEEMALFRRIL 137 + ++ A FR++L Sbjct: 115 ILADEQRHAAWFRKLL 130 >gnl|CDD|37543 KOG2332, KOG2332, KOG2332, Ferritin [Inorganic ion transport and metabolism]. Length = 178 Score = 33.7 bits (77), Expect = 0.024 Identities = 36/158 (22%), Positives = 61/158 (38%), Gaps = 14/158 (8%) Query: 9 LNELMNMEYVAQYHYMQAAAWAASHN--LDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVE 66 +N +N+E A Y Y+ AA+ + L G F LK + EE H ++ K G Sbjct: 21 INSQINLELNASYVYLSMAAYFDRDDVALKGFAKFFLKQSQEEREHAEKLMKTQNMRGGR 80 Query: 67 AKFSSIEAPVI-----SANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQ- 120 + I+ P + +E L E V + + + D FL+ Sbjct: 81 IELQDIKKPELDEWGKGLEALEAALHL----EKNVNQSLLELHSLATKKNDPHLCDFLES 136 Query: 121 WFVKEQHEEMALFRRILDKIRLIGS--GPHSRYMFDLE 156 F+ EQ + + L ++ +G+ G Y+FD Sbjct: 137 HFLNEQVKSIKELSDYLANLKKMGAPDGGLGEYLFDKY 174 >gnl|CDD|39808 KOG4608, KOG4608, KOG4608, Uncharacterized conserved protein [Function unknown]. Length = 270 Score = 28.4 bits (63), Expect = 0.88 Identities = 11/57 (19%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 78 SANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQTFQFLQWFVKEQ-HEEMALF 133 + N+ + L Y+ +VT +AIE++L E++ + + E + Sbjct: 212 TVNERKQLKLEDYKGRLQVTSHLPEAIESLLQEEEPENDAKKIKALLNLPREPSVID 268 >gnl|CDD|143630 cd07892, PolyPPase_VTC2-3_like, Polyphosphate(polyP) polymerase domain of yeast vacuolar transport chaperone (VTC) proteins VTC-2, and -3 , and similar proteins. Saccharomyces cerevisiae VTC-1, -2, -3, and -4 comprise the membrane-integral VTC complex. VTC-2, -3, and -4 contain polyP polymerase domains. S. cerevisiae VTC-2,and -3 belong to this subgroup. For VTC4 it has been shown that this domain generates polyP from ATP by a phosphotransfer reaction releasing ADP. This activity is metal ion-dependent. The ATP gamma phosphate may be cleaved and then transferred to an acceptor phosphate to form polyP. PolyP is ubiquitous. In prokaryotes, it is a store of phosphate and energy. In eukaryotes, polyPs have roles in bone calcification, and osmoregulation, and in phosphate transport in the symbiosis of mycorrhizal fungi and plants. This subgroup belongs to the CYTH/triphosphate tunnel metalloenzyme (TTM)-like superfamily, whose enzymes have a unique active site located within an eight-stranded beta barrel. Length = 303 Score = 27.7 bits (62), Expect = 1.5 Identities = 17/98 (17%), Positives = 31/98 (31%), Gaps = 18/98 (18%) Query: 55 RIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHENKVTIAYDDAIETILAEKDHQ 114 + F T E K + + G Y+ E K+ E + Sbjct: 101 KTFDENTSSFEEDKL------QLKEKYINGFIFGKYKFEKKLQ---KMEKRGADLENLKK 151 Query: 115 TFQFLQWFVKEQHEEMAL---FRRIL------DKIRLI 143 + +Q F++E + L + R D+IR+ Sbjct: 152 DVENIQDFIRENKLQPVLRAVYTRTAFQIPGDDRIRVS 189 >gnl|CDD|36344 KOG1129, KOG1129, KOG1129, TPR repeat-containing protein [General function prediction only]. Length = 478 Score = 27.3 bits (60), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Query: 82 VEGLFSLMYEHENKVTIAYDDAIETI---LAEKDHQTFQFLQWFVKEQ 126 V+ LF ++ HEN V A+ + A+ T L W+ K+Q Sbjct: 181 VKALFEYLFYHENDVQKAHSLCQAVLEVERAKPSGSTGCTLDWWWKQQ 228 >gnl|CDD|107364 cd06369, PBP1_GC_C_enterotoxin_receptor, Ligand-binding domain of the membrane guanylyl cyclase C. Ligand-binding domain of the membrane guanylyl cyclase C (GC-C or StaR). StaR is a key receptor for the STa (Escherichia coli Heat Stable enterotoxin), a potent stimulant of intestinal chloride and bicarbonate secretion that cause acute secretory diarrhea. The catalytic domain of the STa/guanylin receptor type membrane GC is highly similar to those of the natriuretic peptide receptor (NPR) type and sensory organ-specific type membrane GCs (GC-D, GC-E and GC-F). The GC-C receptor is mainly expressed in the intestine of most vertebrates, but is also found in the kidney and other organs. Moreover, GC-C is activated by guanylin and uroguanylin, endogenous peptide ligands synthesized in the intestine and kidney. Consequently, the receptor activation results in increased cGMP levels and phosphorylation of the CFTR chloride channel and secretion. Length = 380 Score = 26.6 bits (59), Expect = 3.3 Identities = 22/98 (22%), Positives = 34/98 (34%), Gaps = 19/98 (19%) Query: 10 NELMNMEYVAQYHYMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKF 69 N L+ +YVA YH H L FL + I F++++ F Sbjct: 279 NSLLKDDYVAAYH---DGVLLFGHVLK---KFLESQEGVQTFSFINEFRNIS-------F 325 Query: 70 SSIEAPVI--SANDVEGLFSLMY----EHENKVTIAYD 101 P D + F+L+Y + KV +D Sbjct: 326 EGAGGPYTLDEYGDRDVNFTLLYTSTDTSKYKVLFEFD 363 >gnl|CDD|33995 COG4273, COG4273, Uncharacterized conserved protein [Function unknown]. Length = 135 Score = 26.1 bits (57), Expect = 4.3 Identities = 15/64 (23%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Query: 35 LDGCCNFLLKHAMEEHSHVIRIFKHLTDLGVEAKFSSIEAPVISANDVEGLFSLMYEHEN 94 LDGC + E + +TDLG++ + S DVE + + + Sbjct: 73 LDGCPLRCATKCLAEAGVQADVHLTITDLGIKKTYPSD----CKDEDVEKVARTI---KE 125 Query: 95 KVTI 98 +TI Sbjct: 126 ALTI 129 >gnl|CDD|133105 cd06247, M14_CPO, Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3.4.17.) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPO has not been well characterized as yet, and little is known about it. Based on modeling studies, CPO has been suggested to have specificity for acidic residues rather than aliphatic/aromatic residues as in A-like enzymes or basic residues as in B-like enzymes. It remains to be demonstrated that CPO is functional as an MCP. Length = 298 Score = 25.6 bits (56), Expect = 7.0 Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 118 FLQWFVKE---QHEEMALFRRILDKI 140 F QWFVKE ++ + R++L + Sbjct: 71 FCQWFVKEILQNYKTDPILRKVLKNV 96 >gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 415 Score = 25.6 bits (56), Expect = 7.6 Identities = 14/38 (36%), Positives = 21/38 (55%) Query: 109 AEKDHQTFQFLQWFVKEQHEEMALFRRILDKIRLIGSG 146 A+KD + + E E +A+ RRI ++ RLIG G Sbjct: 372 AKKDEIEVKLKRPVCAEIGERVAISRRIGNRWRLIGYG 409 >gnl|CDD|35265 KOG0042, KOG0042, KOG0042, Glycerol-3-phosphate dehydrogenase [Energy production and conversion]. Length = 680 Score = 25.3 bits (55), Expect = 8.8 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Query: 23 YMQAAAWAASHNLDGCCNFLLKHAMEEHSHVIRIFKHLT 61 Y++ A NLD L+K A+ E ++++ I HL+ Sbjct: 119 YLEKAIS----NLDYEQYRLVKEALNERANLLEIAPHLS 153 >gnl|CDD|100090 cd03088, ManB, ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate. In Mycobacterium tuberculosis, the causative agent of tuberculosis, PMM is involved in the biosynthesis of mannosylated lipoglycans that participate in the association of mycobacteria with host macrophage phagocytic receptors. ManB belongs to the the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.. Length = 459 Score = 25.2 bits (56), Expect = 8.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Query: 25 QAAAWAASHNLD 36 AAAWAA H LD Sbjct: 216 LAAAWAAEHGLD 227 >gnl|CDD|31301 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism]. Length = 386 Score = 25.1 bits (55), Expect = 9.1 Identities = 15/72 (20%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Query: 49 EHSHVIRIFKHLTDLGVEAKFSSIEAP-VISANDVEG-------LFSLMYEHENKVTIAY 100 EH V+ ++L G E + +++ ++ +E L S+M+ + TI Sbjct: 100 EHPAVLNTCRYLERQGFEVTYLPVDSNGLVDLEQLEEALRPDTILVSIMHANNETGTIQP 159 Query: 101 DDAIETILAEKD 112 I I E+ Sbjct: 160 IAEIGEICKERG 171 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.134 0.396 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,980,533 Number of extensions: 97913 Number of successful extensions: 242 Number of sequences better than 10.0: 1 Number of HSP's gapped: 235 Number of HSP's successfully gapped: 32 Length of query: 164 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 77 Effective length of database: 4,383,754 Effective search space: 337549058 Effective search space used: 337549058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 53 (24.3 bits)