RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780722|ref|YP_003065135.1| pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] (187 letters) >gnl|CDD|183282 PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase; Provisional. Length = 383 Score = 27.9 bits (63), Expect = 1.6 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 31/92 (33%) Query: 52 FRRVIETQHLGLSLSESISRMVRYMP-------LQEVSFFSTVIS--VQSQLGGNLSEAL 102 F+RV++ LG L ES YM L E FFS V+ + +L +L + L Sbjct: 47 FKRVLQEGSLG--LGES------YMDGWWDCDRLDE--FFSRVLRAGLDEKLPHHLKDTL 96 Query: 103 ANLSRILRDRKNMKAKVQALSMEAKASAWIIG 134 L L + ++ K AWI+G Sbjct: 97 RILRARLFNLQSKK------------RAWIVG 116 >gnl|CDD|151488 pfam11041, DUF2612, Protein of unknown function (DUF2612). This is a phage protein family expressed from a range of Proteobacteria species. The function is not known. Length = 186 Score = 27.7 bits (62), Expect = 1.7 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Query: 9 TAKFLDDFPNALDIIVRSVRAGLPVSDAVAVIVGQS 44 +FLDD P+ D I + GL D IVG S Sbjct: 30 LFEFLDDLPDVFD-IDTANGFGL---DVWGRIVGVS 61 >gnl|CDD|149326 pfam08203, RNA_polI_A14, Yeast RNA polymerase I subunit RPA14. This is a family of yeast proteins. A14 is one of the final two subunits of Saccharomyces cerevisiae RNA polymerase I and is proposed to play a role in the recruitment of pol I to the promoter. Length = 160 Score = 27.6 bits (61), Expect = 1.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 96 GNLSEALANLSRILRDRKNMKAKVQALSMEAKASA 130 LS L+ L R+ RD K + V E +S+ Sbjct: 72 TGLSSVLSQLKRVQRDLKGLPPTVSEPESEVPSSS 106 >gnl|CDD|179564 PRK03352, PRK03352, DNA polymerase IV; Validated. Length = 346 Score = 27.3 bits (61), Expect = 2.4 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 8/46 (17%) Query: 13 LDDFPNALDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEFRRVIET 58 LD F A++++ R AGLPV IVG + DP +E R+V+ Sbjct: 12 LDQFIAAVELLRRPELAGLPV------IVGGNGDP--TEPRKVVTC 49 >gnl|CDD|151020 pfam10443, RNA12, RNA12 protein. This family includes RNA12 from S. cerevisiae. That protein contains an RRM domain. This region is C-terminal to that and includes a P-loop motif suggesting this region binds to NTP. The RNA12 proteins is involved in pre-rRNA maturation. Length = 428 Score = 26.9 bits (60), Expect = 3.3 Identities = 8/33 (24%), Positives = 18/33 (54%) Query: 20 LDIIVRSVRAGLPVSDAVAVIVGQSSDPVRSEF 52 L + R +++G +AV+ I+ Q++ + F Sbjct: 272 LQALARRIKSGESPEEAVSDIISQAASEILKMF 304 >gnl|CDD|162226 TIGR01150, puhA, photosynthetic reaction center, subunit H, bacterial. This model describes the photosynthetic reaction center H subunit in non-oxygenic photosynthetic bacteria. The reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in the form of NADH. Ultimately, the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is an organic acid rather than water. Much of our current functional understanding of photosynthesis comes from the structural determination and spectroscopic studies on the reaction center of Rhodobacter sphaeroides. Length = 252 Score = 26.0 bits (57), Expect = 5.6 Identities = 27/109 (24%), Positives = 40/109 (36%), Gaps = 18/109 (16%) Query: 30 GLPVSDAVAVIVGQSSDPV--RSEFRRVIETQHLGLSLSESISRMVRYMPLQEVSFFSTV 87 GLPV A + G+ +D R E ++L + L+ +P+ S Sbjct: 153 GLPVVAADGEVAGKVTDLWVDRPE----QYFRYLEVELAGGART--ALLPMGMCKVKSDR 206 Query: 88 ISVQSQLGGNLSEALANLSRILRDRKNMKAKVQALSMEAKASAWIIGSL 136 + V S LS+ AN+ I L E K SA+ G L Sbjct: 207 VVVNSI----LSDLFANVPTI------KSPDQITLREEDKVSAYYAGGL 245 >gnl|CDD|181384 PRK08319, PRK08319, cobalt transport protein CbiM; Validated. Length = 224 Score = 25.6 bits (57), Expect = 8.6 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Query: 128 ASAWIIGSLPFCVSTLVYFTSPGYMNVLINDPRGHMLLGVAAAFMLI 174 A+ W + SLPF V L ++ DP LL +A AF+ + Sbjct: 13 AAFWWLLSLPFVVYGLRRLR-----KIVKEDPEQKPLLALAGAFIFV 54 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.136 0.380 Gapped Lambda K H 0.267 0.0738 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,007,081 Number of extensions: 182662 Number of successful extensions: 635 Number of sequences better than 10.0: 1 Number of HSP's gapped: 635 Number of HSP's successfully gapped: 27 Length of query: 187 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 99 Effective length of database: 4,092,969 Effective search space: 405203931 Effective search space used: 405203931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.6 bits)