RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >gnl|CDD|179682 PRK03947, PRK03947, prefoldin subunit alpha; Reviewed. Length = 140 Score = 29.5 bits (67), Expect = 0.29 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 16/54 (29%) Query: 31 PGDSKSQDNAKVVRADRVI-----------PTANT-----KRRKELREAIQKIE 68 P + S AKV D+VI KR++EL +A++K+E Sbjct: 61 PIGAGSFVKAKVKDKDKVIVSLGAGYSAEKDLDEAIEILDKRKEELEKALEKLE 114 >gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup. Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favored under different circumstances. This model represents a narrowly defined clade of the succinate dehydrogenase flavoprotein subunit as found in mitochondria, in Rickettsia, in E. coli and other Proteobacteria, and in a few other lineages. However, this model excludes all known fumarate reductases. It also excludes putative succinate dehydrogenases that appear to diverged before the split between E. coli succinate dehydrogenase and fumarate reductase. Length = 565 Score = 29.3 bits (66), Expect = 0.31 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query: 37 QDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSL 84 Q++A V R V+ K L+E + +++N K+K+ NT +++L Sbjct: 441 QNHAGVFRTGEVLQKGVEKI-SALKERYKNVKINDKSKVWNTDLVEAL 487 >gnl|CDD|180382 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 577 Score = 28.1 bits (63), Expect = 0.75 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 39 NAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSL 84 N + R + + A K+ K+LRE + + + K++I NT D+L Sbjct: 462 NFGIFRDESGLAEA-LKKIKKLRERYKNVRIEDKSRIYNTDLKDAL 506 >gnl|CDD|178089 PLN02470, PLN02470, acetolactate synthase. Length = 585 Score = 27.8 bits (62), Expect = 0.98 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 49 IPTANTKRRKELREAIQKI 67 IP A R+ +LREAIQK+ Sbjct: 525 IPAARVTRKSDLREAIQKM 543 >gnl|CDD|178802 PRK00025, lpxB, lipid-A-disaccharide synthase; Reviewed. Length = 380 Score = 27.4 bits (62), Expect = 1.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 48 VIPTANTKRRKELREAIQK 66 V+P N KRR+++ EA+ + Sbjct: 224 VLPLVNPKRREQIEEALAE 242 >gnl|CDD|162174 TIGR01048, lysA, diaminopimelate decarboxylase. This family consists of diaminopimelate decarboxylase, an enzyme which catalyzes the conversion of diaminopimelic acid into lysine during the last step of lysine biosynthesis. Length = 417 Score = 27.3 bits (61), Expect = 1.6 Identities = 10/43 (23%), Positives = 15/43 (34%), Gaps = 5/43 (11%) Query: 43 VRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSLI 85 ++++ N K R EL A L + N S L Sbjct: 92 FPPEKIVFNGNGKSRAELERA-----LELGIRCINVDSESELE 129 >gnl|CDD|151349 pfam10902, DUF2693, Protein of unknown function (DUF2693). This viral family of proteins has no known function. Length = 83 Score = 27.1 bits (60), Expect = 1.6 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 15/71 (21%) Query: 35 KSQDNAKVVRADR---VIPTANTKR----------RKELREAIQKIELNHKAKIGNTKSI 81 K+ +V++A R ++PT + RKE +E+++ ++ + K + + Sbjct: 9 KADGTIRVMQATRDERLMPTEELGKELFEKATKPTRKESKESVRVYDV--ELKGWRSFRL 66 Query: 82 DSLISCSGLPI 92 D LIS +G + Sbjct: 67 DKLISVNGTKV 77 >gnl|CDD|180193 PRK05675, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 570 Score = 27.1 bits (60), Expect = 1.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 55 KRRKELREAIQKIELNHKAKIGNTKSIDSL 84 + +LRE I +++N K++ NT I++L Sbjct: 467 AQLADLRERIANVKINDKSQAFNTARIEAL 496 >gnl|CDD|130760 TIGR01699, XAPA, xanthosine phosphorylase. (TIGR01698, TIGR01700). Length = 248 Score = 26.9 bits (59), Expect = 1.8 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 74 KIGNTKSIDSLISCSGLPISKQHYYIGSCVIGFICGV 110 +I N +I S G P+S H + G V+G + GV Sbjct: 16 QIENAVAI-SYEKLPGFPVSTVHGHAGELVLGHLQGV 51 >gnl|CDD|181879 PRK09464, pdhR, transcriptional regulator PdhR; Reviewed. Length = 254 Score = 26.9 bits (60), Expect = 1.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 57 RKELREAIQKIE 68 R LREAIQ++E Sbjct: 48 RPSLREAIQRLE 59 >gnl|CDD|183368 PRK11901, PRK11901, hypothetical protein; Reviewed. Length = 327 Score = 26.6 bits (59), Expect = 2.1 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 14/42 (33%) Query: 90 LPISKQHYYIGSCVIGFICGVLSLTLSSSFFTFLCVSVSSAL 131 L +S+QH IG G+L L L L +++ SAL Sbjct: 31 LAVSRQHMMIG-------IGILVLLL-------LIIAIGSAL 58 >gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family. Length = 185 Score = 26.7 bits (59), Expect = 2.1 Identities = 10/41 (24%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Query: 60 LREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIG 100 REAI++ ++ N + + S S G H +I Sbjct: 97 RREAIEEAGY----QVKNLRKLLSFYSSPGGVTELIHLFIA 133 >gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional. Length = 880 Score = 26.6 bits (59), Expect = 2.5 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 4/27 (14%) Query: 55 KRRKELREAIQKIELNHKAKIGNTKSI 81 K ++E+ E I KI A+IG K Sbjct: 398 KAKEEIEEEISKI----TARIGELKKE 420 >gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 591 Score = 26.3 bits (58), Expect = 2.9 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 37 QDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSL 84 Q +A V R ++ ++ L E ++ I L K+K+ NT +++L Sbjct: 471 QKHAGVFRTQALL-DEGVEQILALAERVENIHLKDKSKVFNTARVEAL 517 >gnl|CDD|162542 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup. This model represents the succinate dehydrogenase flavoprotein subunit as found in Gram-negative bacteria, mitochondria, and some Archaea. Mitochondrial forms interact with ubiquinone and are designated EC 1.3.5.1, but can be degraded to 1.3.99.1. Some isozymes in E. coli and other species run primarily in the opposite direction and are designated fumarate reductase. Length = 566 Score = 26.1 bits (58), Expect = 3.0 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 37 QDNAKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIGNTKSIDSL 84 DN + R + ++ A + +ELRE + + +N K+K+ NT +++L Sbjct: 448 DDNVGIFRTEELLKKAVDEI-EELRERYKNVRINDKSKVFNTDLLEAL 494 >gnl|CDD|151167 pfam10661, EssA, Firmicute eSAT-6 protein secretion system EssA. The Wss (WXG100 protein secretion system) in S. aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system). This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria. Length = 166 Score = 26.0 bits (57), Expect = 3.1 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 33 DSKSQDNAKV-VRADRVIPTANTKRRKELRE 62 DS +D+ K+ + DR+ T K K+LRE Sbjct: 27 DSYLEDDGKMQFKVDRLQKTDQEKNEKKLRE 57 >gnl|CDD|180180 PRK05643, PRK05643, DNA polymerase III subunit beta; Validated. Length = 367 Score = 25.9 bits (58), Expect = 3.6 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Query: 46 DRVIPTANTKR----RKELREAIQKI 67 RVIP K+ RKEL +A+++ Sbjct: 246 RRVIPKEFDKKLTVDRKELLQALERA 271 >gnl|CDD|140068 PTZ00033, PTZ00033, 60S ribosomal protein L24; Provisional. Length = 125 Score = 25.7 bits (56), Expect = 4.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 40 AKVVRADRVIPTANTKRRKELREAIQKIELNHKAKIG 76 A+ V+ R I A+ +E+R +QK++ + KAK Sbjct: 77 ARTVKVQRAIVGADLSYIQEVRAYVQKVDRSAKAKAV 113 >gnl|CDD|184838 PRK14828, PRK14828, undecaprenyl pyrophosphate synthase; Provisional. Length = 256 Score = 25.5 bits (56), Expect = 4.7 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Query: 57 RKELREAIQKIELNHKAKIGNTKSIDSLISCSGLPISKQHYYIG 100 R+E+ +A++ + HK K SID L + H Y G Sbjct: 155 RQEIVDAVRSLLTEHKDKGT---SIDELAESVTVDAISTHLYTG 195 >gnl|CDD|148567 pfam07019, Rab5ip, Rab5-interacting protein (Rab5ip). This family consists of several Rab5-interacting protein (RIP5 or Rab5ip ) sequences. The ras-related GTPase rab5 is rate-limiting for homotypic early endosome fusion. Rab5ip represents a novel rab5 interacting protein that may function on endocytic vesicles as a receptor for rab5-GDP and participate in the activation of rab5. Length = 81 Score = 25.2 bits (56), Expect = 5.7 Identities = 9/35 (25%), Positives = 19/35 (54%) Query: 99 IGSCVIGFICGVLSLTLSSSFFTFLCVSVSSALVF 133 + S + G I G+L LT F + +S+ ++ ++ Sbjct: 9 VISLLAGVIAGILGLTGFLGFIFYFLISLGTSYLY 43 >gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown. Length = 595 Score = 25.0 bits (55), Expect = 6.4 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 16/57 (28%) Query: 38 DNAKVVRADRVIPTANTKRRKELREAI----------------QKIELNHKAKIGNT 78 D+ K ADR++ +E+RE + Q + LN+KAK G T Sbjct: 13 DHGKSTLADRLLEYTGAISEREMREQVLDSMDLERERGITIKAQAVRLNYKAKDGET 69 >gnl|CDD|147922 pfam06024, DUF912, Nucleopolyhedrovirus protein of unknown function (DUF912). This family consists of several Nucleopolyhedrovirus proteins of unknown function. Length = 101 Score = 24.9 bits (55), Expect = 7.1 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 8 FLVGLIT-VSVFCFLYAIFYNVI 29 L+GL+ V LYAI+Y VI Sbjct: 64 ILIGLLAFFCVLVLLYAIYYFVI 86 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.139 0.418 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,081,322 Number of extensions: 114836 Number of successful extensions: 482 Number of sequences better than 10.0: 1 Number of HSP's gapped: 481 Number of HSP's successfully gapped: 39 Length of query: 137 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 53 Effective length of database: 4,179,401 Effective search space: 221508253 Effective search space used: 221508253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.0 bits)