RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780723|ref|YP_003065136.1| hypothetical protein CLIBASIA_03050 [Candidatus Liberibacter asiaticus str. psy62] (137 letters) >d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Score = 26.1 bits (57), Expect = 1.3 Identities = 11/65 (16%), Positives = 22/65 (33%), Gaps = 5/65 (7%) Query: 49 IPTANTKRRKELREAIQKIELNHKAKIGNTK---SIDSLISCSGLPIS--KQHYYIGSCV 103 + + K ++++ K++ A + I IS SG+ I K Sbjct: 27 DDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHP 86 Query: 104 IGFIC 108 + I Sbjct: 87 VNKIS 91 >d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 94 Score = 23.6 bits (51), Expect = 6.1 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 10/54 (18%) Query: 58 KELREAIQKIELNHKAK----------IGNTKSIDSLISCSGLPISKQHYYIGS 101 K+L+E ++K+ + AK I + + +SL + GL + K+ + Sbjct: 11 KKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELAD 64 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.139 0.418 Gapped Lambda K H 0.267 0.0561 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 484,709 Number of extensions: 19989 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 3 Length of query: 137 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 61 Effective length of database: 1,364,116 Effective search space: 83211076 Effective search space used: 83211076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (22.6 bits)