HHsearch alignment for GI: 254780724 and conserved domain: COG0542

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].
Probab=97.67  E-value=6.4e-05  Score=52.99  Aligned_cols=99  Identities=27%  Similarity=0.377  Sum_probs=70.3

Q ss_pred             HCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCEEEEE--EECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             225884899818888888999999830387676799964213125678756778--741666653000189999875205
Q gi|254780724|r  247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE--TRPPNIEGEGEITMRDLVKNCLRM  324 (483)
Q Consensus       247 v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l~~~~~v~~~--~~~~~~e~~~~~t~~~ll~~aLR~  324 (483)
T Consensus       518 ~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHs--VSrLIGaPPGYV----GyeeGG~LTEaVRr  591 (786)
T COG0542         518 NRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHS--VSRLIGAPPGYV----GYEEGGQLTEAVRR  591 (786)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEECHHHHHHHHH--HHHHHCCCCCCC----EECCCCCHHHHHHC
T ss_conf             987357886678865699999999999659974445545687777877--998727999872----00655400376606


Q ss_pred             CCC-EEEECCCC--CHHHHHH-HHHHHCCCC
Q ss_conf             998-89965758--7999999-999873970
Q gi|254780724|r  325 RPE-RIILGEVR--GPEVLDL-LQAMNTGHD  351 (483)
Q Consensus       325 ~PD-~IiVGEiR--g~Ea~~~-l~A~~TGH~  351 (483)
T Consensus       592 ~PySViLlDEIEKAHpdV~nilLQVlDdGrL  622 (786)
T COG0542         592 KPYSVILLDEIEKAHPDVFNLLLQVLDDGRL  622 (786)
T ss_pred             CCCEEEEECHHHHCCHHHHHHHHHHHCCCCE
T ss_conf             9986888412644088999999998467805