HHsearch alignment for GI: 254780724 and conserved domain: COG0593

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair].
Probab=97.37  E-value=0.0045  Score=40.08  Aligned_cols=169  Identities=18%  Similarity=0.227  Sum_probs=99.0

Q ss_pred             CCCCCCHHHHHHCCCCCHHHHHHHHHHHC---CCCCEEEECCCCCCHHHHHHHHHHHC---CCCCCEEEEECCHHHC---
Q ss_conf             76546678886506998899999898622---58848998188888889999998303---8767679996421312---
Q gi|254780724|r  220 KKDKLTLDHLVSFGAVTAEGARLLQIIGR---IRCNVLISGGTGSGKTTLLNCLTRYI---DKDERIVTCEDTAELQ---  290 (483)
Q Consensus       220 ~~~~~~l~~l~~~g~~~~~~~~~l~~~v~---~~~nilVsG~TGSGKTT~L~al~~~i---~~~~rivtIED~~El~---  290 (483)
T Consensus        80 l~~~ytFdnFv~g~~N~~A~aa~~~va~~~g~~~nplfi~G~~GlGKTHLl~Aign~~~~~~~~a~v~y~~se~f~~~~v  159 (408)
T COG0593          80 LNPKYTFDNFVVGPSNRLAYAAAKAVAENPGGAYNPLFIYGGVGLGKTHLLQAIGNEALANGPNARVVYLTSEDFTNDFV  159 (408)
T ss_pred             CCCCCCHHHEEECCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHH
T ss_conf             89888554220477449999999998756688689579987999978999999999998629986488504899899999


Q ss_pred             CC-------------CCCEEEEEEECCCCCCC--CCCHHHHHHHHHHHCCCCEEEECCCCCHHHHH-H---HHHHHCCCC
Q ss_conf             56-------------78756778741666653--00018999987520599889965758799999-9---999873970
Q gi|254780724|r  291 LQ-------------QPHVVRLETRPPNIEGE--GEITMRDLVKNCLRMRPERIILGEVRGPEVLD-L---LQAMNTGHD  351 (483)
Q Consensus       291 l~-------------~~~~v~~~~~~~~~e~~--~~~t~~~ll~~aLR~~PD~IiVGEiRg~Ea~~-~---l~A~~TGH~  351 (483)
T Consensus       160 ~a~~~~~~~~Fk~~y~~dlllI-DDiq~l~gk~~~qeefFh~F-N~l~~~~kqIvltsdr~P~~l~~~~~rL~SR~~~--  235 (408)
T COG0593         160 KALRDNEMEKFKEKYSLDLLLI-DDIQFLAGKERTQEEFFHTF-NALLENGKQIVLTSDRPPKELNGLEDRLRSRLEW--  235 (408)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEE-CHHHHHCCCHHHHHHHHHHH-HHHHHCCCEEEEECCCCCHHHCCCCHHHHHHHHC--
T ss_conf             9988504888887642673555-13867567715799999999-9888508879997078832211035889989863--


Q ss_pred             EEEHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             102000478888899999975530467999899999997423
Q gi|254780724|r  352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL  393 (483)
Q Consensus       352 G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia~av  393 (483)
T Consensus       236 Gl~~~I~~Pd~e~r~aiL~kka~~~~~~i~~ev~~-~la~~~  276 (408)
T COG0593         236 GLVVEIEPPDDETRLAILRKKAEDRGIEIPDEVLE-FLAKRL  276 (408)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHCCCCCCHHHHH-HHHHHH
T ss_conf             05775279888999999999998658888879999-999970