HHsearch alignment for GI: 254780724 and conserved domain: COG1119

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism].
Probab=96.25  E-value=0.0048  Score=39.87  Aligned_cols=39  Identities=33%  Similarity=0.218  Sum_probs=33.0

Q ss_pred             HHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             898622588489981888888899999983038767679
Q gi|254780724|r  243 LQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIV  281 (483)
Q Consensus       243 l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~riv  281 (483)
T Consensus        50 isW~V~~ge~W~I~G~NGsGKTTLL~ll~~~~~pssg~~   88 (257)
T COG1119          50 LSWQVNPGEHWAIVGPNGAGKTTLLSLLTGEHPPSSGDV   88 (257)
T ss_pred             CCEEECCCCCEEEECCCCCCHHHHHHHHHCCCCCCCCCE
T ss_conf             430536998479988898778999999961258877710