HHsearch alignment for GI: 254780724 and conserved domain: COG1618

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism].
Probab=97.84  E-value=5.7e-05  Score=53.32  Aligned_cols=117  Identities=21%  Similarity=0.352  Sum_probs=69.0

Q ss_pred             HCCCCCEEEECCCCCCHHHHHHHHHHHCCCC-CC-------------------EEEEECCHHHCCCCCCEEEEEEECCCC
Q ss_conf             2258848998188888889999998303876-76-------------------799964213125678756778741666
Q gi|254780724|r  247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKD-ER-------------------IVTCEDTAELQLQQPHVVRLETRPPNI  306 (483)
Q Consensus       247 v~~~~nilVsG~TGSGKTT~L~al~~~i~~~-~r-------------------ivtIED~~El~l~~~~~v~~~~~~~~~  306 (483)
T Consensus         2 ~~~~mki~ITG~PGvGKtTl~~ki~e~L~~~g~kvgGf~t~EVR~gGkR~GF~Ivdl~tg~~~~la~~~~----~~~r--   75 (179)
T COG1618           2 IKMAMKIFITGRPGVGKTTLVLKIAEKLREKGYKVGGFITPEVREGGKRIGFKIVDLATGEEGILARVGF----SRPR--   75 (179)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCEEEEEEEEECCCCCEEEEEECCC----CCCC--
T ss_conf             8754599986799845899999999999855966513983114208827515999814795579888478----8762--


Q ss_pred             CCCCCCHH---H----HHHHHHHHCCCCEEEECCCCCHHH-----HHHH-HHHHCCCCEEEHHHCCCCHHHHHHHHHH
Q ss_conf             65300018---9----999875205998899657587999-----9999-9987397010200047888889999997
Q gi|254780724|r  307 EGEGEITM---R----DLVKNCLRMRPERIILGEVRGPEV-----LDLL-QAMNTGHDGSMGTIHANNARESFGRMEA  371 (483)
Q Consensus       307 e~~~~~t~---~----~ll~~aLR~~PD~IiVGEiRg~Ea-----~~~l-~A~~TGH~G~ltTlHa~s~~~ai~RL~~  371 (483)
T Consensus        76 vGkY~V~v~~le~i~~~al~rA~-~~aDvIIIDEIGpMElks~~f~~~ve~vl~~~kp-liatlHrrsr~P~v~~ik~  151 (179)
T COG1618          76 VGKYGVNVEGLEEIAIPALRRAL-EEADVIIIDEIGPMELKSKKFREAVEEVLKSGKP-LIATLHRRSRHPLVQRIKK  151 (179)
T ss_pred             CCEEEEEHHHHHHHHHHHHHHHH-HCCCEEEEECCCCHHHCCHHHHHHHHHHHCCCCC-EEEEEECCCCCHHHHHHHH
T ss_conf             10478627888998689999886-3499899943363302008899999999658993-7999962567758998642