HHsearch alignment for GI: 254780724 and conserved domain: KOG0735

>KOG0735 consensus.
Probab=97.20  E-value=0.00097  Score=44.76  Aligned_cols=94  Identities=22%  Similarity=0.282  Sum_probs=58.5

Q ss_pred             HHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCE-EEEECCHHHCCCCCCEEEEEEECCCC
Q ss_conf             88650699889999989862258848998188888889999998303876767-99964213125678756778741666
Q gi|254780724|r  228 HLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERI-VTCEDTAELQLQQPHVVRLETRPPNI  306 (483)
Q Consensus       228 ~l~~~g~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~ri-vtIED~~El~l~~~~~v~~~~~~~~~  306 (483)
T Consensus       409 d~i~~~s~kke~~n~~~spv~~~~~Ill~G~~GsGKT~L~kal~~~~~k~~~~hv~~v~Cs~l~~~~------------~  476 (952)
T KOG0735         409 DFIQVPSYKKENANQELSPVFRHGNILLNGPKGSGKTNLVKALFDYYSKDLIAHVEIVSCSTLDGSS------------L  476 (952)
T ss_pred             CEEECCHHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEECHHCCCHH------------H
T ss_conf             6244304555443230454334661898679987776999999987515650699997522104204------------8


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             6530001899998752059988996575
Q gi|254780724|r  307 EGEGEITMRDLVKNCLRMRPERIILGEV  334 (483)
Q Consensus       307 e~~~~~t~~~ll~~aLR~~PD~IiVGEi  334 (483)
T Consensus       477 -e~iQk~l~~vfse~~~~~PSiIvLDdl  503 (952)
T KOG0735         477 -EKIQKFLNNVFSEALWYAPSIIVLDDL  503 (952)
T ss_pred             -HHHHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             -999999999999988637808997050