HHsearch alignment for GI: 254780724 and conserved domain: PRK00411

>PRK00411 cdc6 cell division control protein 6; Reviewed.
Probab=96.74  E-value=0.0036  Score=40.76  Aligned_cols=29  Identities=7%  Similarity=0.068  Sum_probs=10.2

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             8888899999975530467999899999997
Q gi|254780724|r  360 NNARESFGRMEAMIAMGGFTLPSQMVREIIT  390 (483)
Q Consensus       360 ~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia  390 (483)
T Consensus       319 g~vy~~Y~~lc~~~~~--~~ls~~~~~~~l~  347 (394)
T PRK00411        319 GEVYEEYKELCEELGY--EPRSHTRFYEYLN  347 (394)
T ss_pred             HHHHHHHHHHHHHCCC--CCCCHHHHHHHHH
T ss_conf             9999999999997399--8887999999999