HHsearch alignment for GI: 254780724 and conserved domain: PRK05480

>PRK05480 uridine kinase; Provisional.
Probab=96.72  E-value=0.0019  Score=42.64  Aligned_cols=35  Identities=29%  Similarity=0.445  Sum_probs=27.2

Q ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             258848998188888889999998303876767999
Q gi|254780724|r  248 RIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTC  283 (483)
Q Consensus       248 ~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtI  283 (483)
T Consensus         4 k~P~iIgIaG~SgSGKTT~a~~L~~~l~~~-~v~vi   38 (209)
T PRK05480          4 KQPIIIGIAGGSGSGKTTVASTIYEELGDE-SIAVI   38 (209)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHCCCC-CEEEE
T ss_conf             898899998999778999999999980868-75999