HHsearch alignment for GI: 254780724 and conserved domain: PRK06547

>PRK06547 hypothetical protein; Provisional.
Probab=95.44  E-value=0.023  Score=35.20  Aligned_cols=37  Identities=38%  Similarity=0.471  Sum_probs=26.7

Q ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECC
Q ss_conf             58848998188888889999998303876767999642
Q gi|254780724|r  249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT  286 (483)
Q Consensus       249 ~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~  286 (483)
T Consensus        14 ~~~iVaIDG~sGaGKTTLA~~La~~~~~-~~vvHmDD~   50 (184)
T PRK06547         14 DMITVLIDGRSGSGKTTLAGELAACWEG-SQLVHLDDL   50 (184)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCC-CCEEEECCC
T ss_conf             7699998689988889999999974579-828970577