HHsearch alignment for GI: 254780724 and conserved domain: PRK06995

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=96.77  E-value=0.0043  Score=40.26  Aligned_cols=115  Identities=17%  Similarity=0.218  Sum_probs=54.6

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHH-HCC-C-CCCEEEE-ECCHHH----CCC---CCCEEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             88489981888888899999983-038-7-6767999-642131----256---78756778741666653000189999
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTR-YID-K-DERIVTC-EDTAEL----QLQ---QPHVVRLETRPPNIEGEGEITMRDLV  318 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~-~i~-~-~~rivtI-ED~~El----~l~---~~~~v~~~~~~~~~e~~~~~t~~~ll  318 (483)
T Consensus       176 ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~IlgvPv~vv------~~~~eL~~aL  249 (404)
T PRK06995        176 GGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGVPVHAV------KDAADLRLAL  249 (404)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEE------CCHHHHHHHH
T ss_conf             7558986688876375899999999998389837999768754789999999998759559995------9999999999


Q ss_pred             HHHHHCCCCEEEECCC----CCHHHHH---HHHHHHCCCCEEEHHHCCCCHHHHHHHHHHHH
Q ss_conf             8752059988996575----8799999---99998739701020004788888999999755
Q gi|254780724|r  319 KNCLRMRPERIILGEV----RGPEVLD---LLQAMNTGHDGSMGTIHANNARESFGRMEAMI  373 (483)
Q Consensus       319 ~~aLR~~PD~IiVGEi----Rg~Ea~~---~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~m~  373 (483)
T Consensus       250 ~~-l-~~~dlILIDTaGrs~rD~~~~e~l~~l~~~~~~~~-~~LVLsat~~~~dl~~i~~~f  308 (404)
T PRK06995        250 AE-L-RNKHIVLIDTVGMSQRDRMVSEQIAMLHGAGAPVQ-RLLLLNATSHGDTLNEVVQAY  308 (404)
T ss_pred             HH-H-CCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCE-EEEEECCCCCHHHHHHHHHHH
T ss_conf             97-0-89999998099989768889999999973578852-899977989999999999984