HHsearch alignment for GI: 254780724 and conserved domain: PRK08533

>PRK08533 flagellar accessory protein FlaH; Reviewed.
Probab=97.94  E-value=0.00017  Score=50.08  Aligned_cols=177  Identities=14%  Similarity=0.184  Sum_probs=100.6

Q ss_pred             CHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHH-HHCCCCCCEE--EEECCHHHCCCC--------------CCEEE
Q ss_conf             889999989862258848998188888889999998-3038767679--996421312567--------------87567
Q gi|254780724|r  236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLT-RYIDKDERIV--TCEDTAELQLQQ--------------PHVVR  298 (483)
Q Consensus       236 ~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~-~~i~~~~riv--tIED~~El~l~~--------------~~~v~  298 (483)
T Consensus        10 ~d~ld~~lggGip~gs~~li~G~~GtGKsi~~~~~~~~~l~~g~~~~yis~e~t~~~~i~qm~s~g~di~~~~~~G~l~~   89 (230)
T PRK08533         10 GDELHKRLGGGIPFGSIILIEGDESTGKSILSQRLAYGFLQNGYSVSYVSSQLTTTEFIKQMMSLGYDINKKLISGKLLY   89 (230)
T ss_pred             CHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHCCCCCHHHHHCCCEEE
T ss_conf             13578871789889848999868998789999999999987898699999438999999999986998179975796799


Q ss_pred             EEEECCCCCC-CCCCHHHHHHHHHHHCCCCEEEECCC-----CCHH---HHH---HH-HHHHCCCCEEEHHHCCCCHHHH
Q ss_conf             7874166665-30001899998752059988996575-----8799---999---99-9987397010200047888889
Q gi|254780724|r  299 LETRPPNIEG-EGEITMRDLVKNCLRMRPERIILGEV-----RGPE---VLD---LL-QAMNTGHDGSMGTIHANNARES  365 (483)
Q Consensus       299 ~~~~~~~~e~-~~~~t~~~ll~~aLR~~PD~IiVGEi-----Rg~E---a~~---~l-~A~~TGH~G~ltTlHa~s~~~a  365 (483)
T Consensus        90 i~~~~~~~~~~~~~~~L~~ll~~~~~~~~dvIIIDSlS~l~~~~~~~~~~~~~~~~lk~l~s~gkt-IilTv~p~~~---  165 (230)
T PRK08533         90 IPVYPLLSGNSEKRDFLDKLMNTRRFYEKDVVIIDSLSSLVSRDASEVQIRDLMAFFKRISSLNKV-IILTANPKEL---  165 (230)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHCCCCHHHHHHHHHHHHHHHHCCCE-EEEEECCCCC---
T ss_conf             961343354045789999997326643798999905318851677789999999999999858988-9999563313---


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHCCEEEEEEECCCCC--EEEEEEEEEEEEECCEEEEEEEEEEEEEC
Q ss_conf             99999755304679998999999974235889998769998--78999999984149889986789875406
Q gi|254780724|r  366 FGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS--RRITNICEIVGMEGNVIITQDLLKYEVMG  435 (483)
Q Consensus       366 i~RL~~m~~~~~~~~~~~~~~~~ia~avd~iV~~~r~~dG~--Rrv~~I~Ev~g~e~~~~~~~~if~~~~~~  435 (483)
T Consensus       166 ---------------~e~~l-~~lrs~aDv~i~L~~~~vGg~~~r~i~V~K~~ga~~---~~~~~I~F~V~p  218 (230)
T PRK08533        166 ---------------PESVL-LILRTASTILIRLEVKVFGGDLKNSAKIVKYNMAKG---SFQKIIPFRVEP  218 (230)
T ss_pred             ---------------CHHHH-HHHHEEEEEEEEEEEEECCCEEEEEEEEEEECCCCC---CCCCEEEEEECC
T ss_conf             ---------------62454-420410489999873610988999999998448987---778647899806