HHsearch alignment for GI: 254780724 and conserved domain: PRK08903

>PRK08903 hypothetical protein; Validated.
Probab=97.51  E-value=0.0068  Score=38.83  Aligned_cols=160  Identities=15%  Similarity=0.188  Sum_probs=72.2

Q ss_pred             CCCCCHHHHHHCCCCCHHHHHHHHH-HHCCC--CCEEEECCCCCCHHHHHHHHHHHCCC-CCCE--EEEECCHHHCCC--
Q ss_conf             6546678886506998899999898-62258--84899818888888999999830387-6767--999642131256--
Q gi|254780724|r  221 KDKLTLDHLVSFGAVTAEGARLLQI-IGRIR--CNVLISGGTGSGKTTLLNCLTRYIDK-DERI--VTCEDTAELQLQ--  292 (483)
Q Consensus       221 ~~~~~l~~l~~~g~~~~~~~~~l~~-~v~~~--~nilVsG~TGSGKTT~L~al~~~i~~-~~ri--vtIED~~El~l~--  292 (483)
T Consensus        12 ~~~~tfdnFv~g-~-n~~~~~~l~~~~~~~~~~~~l~i~G~~G~GKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~~~~~~   89 (227)
T PRK08903         12 PPPPTFDNFIAG-E-NAELVTRLRELAAGPVADRFFYLWGEAGSGRSHLLQALVAAASEGGKNARYLDPASPLLAFDFDP   89 (227)
T ss_pred             CCCCCHHCCCCC-C-HHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHH
T ss_conf             998764315577-7-59999999988743887866999899999888999999999980699749965110457774200


Q ss_pred             CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-CEEEECCCCCHHHHHH---HHHHHCCCCEEEHHHCCCCHHHHHHH
Q ss_conf             7875677874166665300018999987520599-8899657587999999---99987397010200047888889999
Q gi|254780724|r  293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP-ERIILGEVRGPEVLDL---LQAMNTGHDGSMGTIHANNARESFGR  368 (483)
Q Consensus       293 ~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~P-D~IiVGEiRg~Ea~~~---l~A~~TGH~G~ltTlHa~s~~~ai~R  368 (483)
T Consensus        90 ~~d~l~iDDi-~~i~~~~q~~lF~l~N~~-~~~~~~~ll~s~~~~p~~l~~~~DL~SRl~~--gl~~~i~~pdde~~~~i  165 (227)
T PRK08903         90 RAELYAVDDV-ERLDDAQQIALFNLFNRV-RAHGKTALLVAGPAAPLALDVREDLRTRLGW--GLVYEVKPLSDEDKIAA  165 (227)
T ss_pred             CCCEEEEECC-CCCCCHHHHHHHHHHHHH-HHCCCCEEEECCCCCHHHCCCCHHHHHHHHC--CCEEEEECCCHHHHHHH
T ss_conf             1898999641-148956999999999999-9729948997189971201200899999938--97389979799999999


Q ss_pred             HHHHHHHCCCCCCHHHHH
Q ss_conf             997553046799989999
Q gi|254780724|r  369 MEAMIAMGGFTLPSQMVR  386 (483)
Q Consensus       369 L~~m~~~~~~~~~~~~~~  386 (483)
T Consensus       166 L~~~a~~rgl~l~~~v~~  183 (227)
T PRK08903        166 LKAAAAERGLQLADEVPD  183 (227)
T ss_pred             HHHHHHHCCCCCCHHHHH
T ss_conf             999999629999889999