HHsearch alignment for GI: 254780724 and conserved domain: PRK09087

>PRK09087 hypothetical protein; Validated.
Probab=95.36  E-value=0.22  Score=28.22  Aligned_cols=156  Identities=18%  Similarity=0.166  Sum_probs=67.9

Q ss_pred             CCCCCHHHHHHCCCCCHHHHHHHHHHHC-CCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC---CHHHCCCCCCE
Q ss_conf             6546678886506998899999898622-5884899818888888999999830387676799964---21312567875
Q gi|254780724|r  221 KDKLTLDHLVSFGAVTAEGARLLQIIGR-IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED---TAELQLQQPHV  296 (483)
Q Consensus       221 ~~~~~l~~l~~~g~~~~~~~~~l~~~v~-~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED---~~El~l~~~~~  296 (483)
T Consensus        15 ~~~~~~dnF~vs~-~N~~a~~~l~~~~~w~~~~~~L~Gp~gsGKTHL~~~~~~~~~a--~~~~~~~~~~~~~~~~~~~~~   91 (226)
T PRK09087         15 QPGYGRDDLVVTE-SNRAAVSLVDRWPNWPSPVVVLAGPVGSGKTHLASIWREKADA--LLVHPNEIGSDAANAAAERPV   91 (226)
T ss_pred             CCCCCCCCEEECC-CHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--EEECHHHCCHHHHHHHCCCCE
T ss_conf             8778733647757-6999999998472677775899899999886999999998099--683668747466765327988


Q ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCH-HH----HHHHHHHHCCCCEEEHHHCCCCHHHHHHHHHH
Q ss_conf             67787416666530001899998752059988996575879-99----99999987397010200047888889999997
Q gi|254780724|r  297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP-EV----LDLLQAMNTGHDGSMGTIHANNARESFGRMEA  371 (483)
Q Consensus       297 v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~IiVGEiRg~-Ea----~~~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~  371 (483)
T Consensus        92 ~-id--d~d~~~~dEe~LFhl~N-~~~~~~~~LLlts~~~p~~l~~~L~D-L~SRL~~--~~~~~I~~pdD~ll~~~L~k  164 (226)
T PRK09087         92 L-IE--DIDAGGFDETGLFHLIN-SVRQAGTSLLMTSRLWPSAWNVKLPD-LKSRLKA--ATVVEIGEPDDALLSGVIFK  164 (226)
T ss_pred             E-EE--CCCCCCCCHHHHHHHHH-HHHHCCCEEEEECCCCHHHCCCCCHH-HHHHHHC--CEEEEECCCCHHHHHHHHHH
T ss_conf             9-97--48777747899999999-99853987999889895666762468-9999857--85798359998999999999


Q ss_pred             HHHHCCCCCCHHHHH
Q ss_conf             553046799989999
Q gi|254780724|r  372 MIAMGGFTLPSQMVR  386 (483)
Q Consensus       372 m~~~~~~~~~~~~~~  386 (483)
T Consensus       165 ~~~~r~l~l~~~v~~  179 (226)
T PRK09087        165 LFADRQLYVEPHVVY  179 (226)
T ss_pred             HHHHCCCCCCHHHHH
T ss_conf             987576578888999