HHsearch alignment for GI: 254780724 and conserved domain: PRK09361

>PRK09361 radB DNA repair and recombination protein RadB; Provisional.
Probab=96.85  E-value=0.0082  Score=38.26  Aligned_cols=44  Identities=23%  Similarity=0.184  Sum_probs=31.5

Q ss_pred             HHHHHHHCCCCCEEEECCCCCCHHHHHHHHH-HHCCCCCCEEEEE
Q ss_conf             9989862258848998188888889999998-3038767679996
Q gi|254780724|r  241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLT-RYIDKDERIVTCE  284 (483)
Q Consensus       241 ~~l~~~v~~~~nilVsG~TGSGKTT~L~al~-~~i~~~~rivtIE  284 (483)
T Consensus        14 ~~LgGGi~~G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYid   58 (224)
T PRK09361         14 ELLGGGIERGTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYID   58 (224)
T ss_pred             HHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             862699888879999899998599999999999997499099967