HHsearch alignment for GI: 254780724 and conserved domain: PRK09452

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed.
Probab=96.72  E-value=0.0022  Score=42.32  Aligned_cols=42  Identities=19%  Similarity=0.258  Sum_probs=34.2

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        37 sl~I~~GE~~~llGpSGsGKSTLlr~iaGl~~p~sG~I~~~G   78 (378)
T PRK09452         37 DLTINNGEFLTLLGPSGCGKTTVLRLIAGFETPDSGRIMLDG   78 (378)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             779999989999989997699999999769999846999999