HHsearch alignment for GI: 254780724 and conserved domain: PRK10619

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional.
Probab=96.91  E-value=0.0014  Score=43.71  Aligned_cols=41  Identities=24%  Similarity=0.403  Sum_probs=33.9

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             98622588489981888888899999983038767679996
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE  284 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIE  284 (483)
T Consensus        25 sl~i~~Gei~~iiG~sGsGKSTLl~~i~gl~~p~~G~I~~~   65 (257)
T PRK10619         25 SLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVN   65 (257)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             66887997999998999819999999965999998189999